RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >gnl|CDD|162002 TIGR00701, TIGR00701, conserved hypothetical integral membrane protein. It appears this conserved hypothetical integral membrane protein is found only in gram negative bacteria. Completed genomes that include a member of this family include Rickettsia prowazekii, Synechocystis sp. PCC6803, and Helicobacter pylori. These proteins have 3 (Helicobacter pylori) to 5 (Synechocystis sp. PCC 6803) GES predicted transmembrane regions. Most members have 4 GES predicted transmembrane regions. Length = 142 Score = 114 bits (287), Expect = 1e-26 Identities = 60/139 (43%), Positives = 92/139 (66%), Gaps = 1/139 (0%) Query: 41 LCIKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILS 100 L K+ H++S I WMAGL Y+PR+FVYH+ + ++ T ++ME++L++ IMNPAMI + Sbjct: 3 LWFKAFHLISAICWMAGLFYLPRLFVYHAEAKIGSELDSTLQVMEKKLYRFIMNPAMIST 62 Query: 101 WVCGLYLAW-KTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIIN 159 ++ G+ A + F GWL K+ +VL L YH Y + M+ K HS K+++I+N Sbjct: 63 FIFGIINAHIEPFVAKSGWLHFKLFAVLLLLIYHFYCARWMKDLAKGKNVHSKKFYRIVN 122 Query: 160 EIPTLIMIIIVFLSVIKPF 178 E PT++M+IIV L V+KPF Sbjct: 123 EAPTILMVIIVILVVVKPF 141 >gnl|CDD|177741 PLN00130, PLN00130, succinate dehydrogenase (SDH3); Provisional. Length = 213 Score = 30.9 bits (69), Expect = 0.20 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 16/92 (17%) Query: 79 KTFEIMEERL--FKVIMNPAM-ILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVY 135 K+F + L ++ MN + I + + G+YL TF ++ +L++ MI + + SFY V Sbjct: 122 KSFRPLSPHLSVYQPQMNSMLSIFNRISGVYLTGVTFAGYLLYLKMGMICLTYPSFYQV- 180 Query: 136 LSFVMRKFRDKKLFHSPKYFKIINEIPTLIMI 167 L+H+ + +I + L I Sbjct: 181 ------------LYHTQQQLPVITSVTALAAI 200 >gnl|CDD|152732 pfam12297, EVC2_like, Ellis van Creveld protein 2 like protein. This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism. Length = 429 Score = 27.1 bits (60), Expect = 2.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 18 FIALFVFLFLSLLCFFFL 35 +A V + L+LL FF L Sbjct: 71 VVAFLVSIVLTLLAFFLL 88 >gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed. Length = 574 Score = 26.3 bits (59), Expect = 5.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 1 MKFFLSDSIGKKAQAIAFIALFVF 24 M + + +G AQ A IALFVF Sbjct: 262 MLWLAAGGVGGNAQPGALIALFVF 285 >gnl|CDD|184397 PRK13922, PRK13922, rod shape-determining protein MreC; Provisional. Length = 276 Score = 26.1 bits (58), Expect = 5.3 Identities = 13/57 (22%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Query: 18 FIALFVFLFLSLLCFFFLTSQFNLCIKSI---HILSVISWMAGLLYMPRIFVYHSLS 71 + L + + L LL L + L S + V+S + ++ PR FV Sbjct: 10 LLLLLLLILLLLLALALLLADRRLGSLSPVRQVVGDVVSPVQRVVNAPREFVSGVFE 66 >gnl|CDD|177384 PHA02550, 32, single-stranded DNA binding protein; Provisional. Length = 304 Score = 25.8 bits (57), Expect = 6.0 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 68 HSLSA-PDTDQYKTFEIMEERLFKV 91 H LS D++K++E +E + KV Sbjct: 216 HDLSEFVAPDKFKSYEELETKFNKV 240 >gnl|CDD|162131 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein. Length = 1394 Score = 25.8 bits (57), Expect = 7.0 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 11/94 (11%) Query: 88 LFKVIMNPAM--ILSWV-CGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSF----VM 140 LF V N M ILS V L FY G L ++ F S + + ++ Sbjct: 423 LFMVFGNIIMALILSSVFYNLPKNTSDFYSRGGALFFAILFNAFSSLLEIASMYEARPIV 482 Query: 141 RKFRDKKLFHSPKYF---KIINEIPTLIMIIIVF 171 K R L+H P II+EIP I+ +VF Sbjct: 483 EKHRKYALYH-PSADAIASIISEIPFKIIESVVF 515 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.338 0.148 0.471 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,975,242 Number of extensions: 185750 Number of successful extensions: 1012 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1004 Number of HSP's successfully gapped: 84 Length of query: 178 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 91 Effective length of database: 4,114,577 Effective search space: 374426507 Effective search space used: 374426507 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 54 (24.5 bits)