RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 33.8 bits (77), Expect = 0.020 Identities = 19/116 (16%), Positives = 35/116 (30%), Gaps = 56/116 (48%) Query: 47 HILSVISWMAGLLYMPRIFVYHSLSAPDTD------------------QYK-TFEIMEER 87 L+++ W+ + + PD D Y T +++ Sbjct: 211 QGLNILEWLE-----------NPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLG-- 257 Query: 88 LFKVIMNPAMI---LSWVC----GLYLA--------WKTFYIHIGWLRLKMISVLF 128 P + L GL A W++F++ + K I+VLF Sbjct: 258 -----FTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSV----RKAITVLF 304 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 27.7 bits (60), Expect = 1.5 Identities = 7/20 (35%), Positives = 10/20 (50%), Gaps = 4/20 (20%) Query: 1 MKFFLSDSIGKKAQAIAFIA 20 +K + DS A A+A A Sbjct: 29 LKLYADDS----APALAIKA 44 >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Score = 26.0 bits (56), Expect = 5.0 Identities = 16/100 (16%), Positives = 38/100 (38%), Gaps = 2/100 (2%) Query: 61 MPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLR 120 MP+ F + ++ + Q++ ++ L ++ + G KT+ + Sbjct: 66 MPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGD 125 Query: 121 LKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINE 160 + V+ SF H++ + + + S Y +I E Sbjct: 126 PEKRGVIPNSFDHIFTHISRSQNQQYLVRAS--YLEIYQE 163 >2a1k_A GP32 single stranded DNA binding protein; Zn2+ binding subdomain, 5-stranded beta-sheet, OB fold; 2.00A {Enterobacteria phage RB69} SCOP: b.40.4.7 PDB: 2atq_B* 1gpc_A Length = 233 Score = 26.1 bits (57), Expect = 5.4 Identities = 7/26 (26%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Query: 68 HSLSA-PDTDQYKTFEIMEERLFKVI 92 LS D++K+FE + + +V+ Sbjct: 194 VDLSEMTSKDKFKSFEELNTKFNQVL 219 >2iqc_A Protein FACF, fanconi anemia group F protein; heat-like repeat, DNA-damage, complex subunit, protein binding; 2.40A {Homo sapiens} Length = 210 Score = 26.0 bits (57), Expect = 5.6 Identities = 7/43 (16%), Positives = 17/43 (39%) Query: 98 ILSWVCGLYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVM 140 ++ W+ G + F + L +++ + VYL + Sbjct: 90 LVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLT 132 >3cl3_A ORF K13, KS-vflip; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Human herpesvirus 8} Length = 183 Score = 25.5 bits (56), Expect = 8.0 Identities = 5/25 (20%), Positives = 11/25 (44%) Query: 1 MKFFLSDSIGKKAQAIAFIALFVFL 25 + F D+IG ++ F+ + Sbjct: 118 LIFLSKDTIGSRSTPQTFLHWVYCM 142 >2a3l_A AMP deaminase, AMPD; atampd, AT2G38280, adenosine 5'-monophosphate deaminase, coformycin 5'-phosphate, structural genomics; HET: CF5; 3.34A {Arabidopsis thaliana} SCOP: c.1.9.1 Length = 701 Score = 24.9 bits (54), Expect = 9.3 Identities = 6/45 (13%), Positives = 17/45 (37%) Query: 109 WKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPK 153 F+ + + + + + H L + +KF + ++ K Sbjct: 187 ATAFFTDLHHVLKVIAAGNIRTLCHRRLVLLEQKFNLHLMLNADK 231 >2bgh_A Vinorine synthase; VS, BAHD, acetyltransferase, auto-rickshaw, transferase; 2.6A {Rauvolfia serpentina} Length = 421 Score = 25.2 bits (54), Expect = 9.9 Identities = 9/44 (20%), Positives = 22/44 (50%) Query: 49 LSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVI 92 +S + + ++P I Y + + D +T + +++ L KV+ Sbjct: 28 ISHLDQLLLTCHIPFILFYPNPLDSNLDPAQTSQHLKQSLSKVL 71 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.338 0.148 0.471 Gapped Lambda K H 0.267 0.0497 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,564,448 Number of extensions: 68586 Number of successful extensions: 282 Number of sequences better than 10.0: 1 Number of HSP's gapped: 278 Number of HSP's successfully gapped: 44 Length of query: 178 Length of database: 5,693,230 Length adjustment: 86 Effective length of query: 92 Effective length of database: 3,608,246 Effective search space: 331958632 Effective search space used: 331958632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 53 (24.7 bits)