RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >d2a1ka1 b.40.4.7 (A:32-241) Gene 32 protein (gp32) core {Enterobacteria phage RB69 [TaxId: 12353]} Length = 210 Score = 25.3 bits (55), Expect = 3.5 Identities = 7/26 (26%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Query: 68 HSLSA-PDTDQYKTFEIMEERLFKVI 92 LS D++K+FE + + +V+ Sbjct: 183 VDLSEMTSKDKFKSFEELNTKFNQVL 208 >d1vkba_ d.269.1.1 (A:) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]} Length = 151 Score = 24.4 bits (52), Expect = 5.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Query: 60 YMPRIFVYHSL 70 +M IFVY +L Sbjct: 2 HMAHIFVYGTL 12 >d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 628 Score = 24.1 bits (52), Expect = 6.3 Identities = 8/54 (14%), Positives = 19/54 (35%) Query: 109 WKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIP 162 F+ + + + + + H L + +KF + ++ K F P Sbjct: 114 ATAFFTDLHHVLKVIAAGNIRTLCHRRLVLLEQKFNLHLMLNADKEFLAQKSAP 167 >d2o8ra4 d.136.1.4 (A:506-691) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} Length = 186 Score = 23.6 bits (51), Expect = 9.6 Identities = 5/26 (19%), Positives = 10/26 (38%) Query: 43 IKSIHILSVISWMAGLLYMPRIFVYH 68 + + V + L RI+ +H Sbjct: 72 MPQSRNIRVTRLVDMYLEHSRIWCFH 97 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.338 0.148 0.471 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 689,721 Number of extensions: 30917 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's gapped: 121 Number of HSP's successfully gapped: 32 Length of query: 178 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 98 Effective length of database: 1,309,196 Effective search space: 128301208 Effective search space used: 128301208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 50 (23.3 bits)