RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780813|ref|YP_003065226.1| Maf-like protein [Candidatus Liberibacter asiaticus str. psy62] (199 letters) >d2amha1 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanosoma brucei [TaxId: 5691]} Length = 201 Score = 103 bits (257), Expect = 1e-23 Identities = 32/199 (16%), Positives = 73/199 (36%), Gaps = 9/199 (4%) Query: 2 IKNIILASSSLSRRKLLQNSG----IQFSVVKPNIDEREMEKKMDFSERKR-PEKIALIL 56 I+ +I+ +SS R +L+ F ++ P+IDE+ F + + Sbjct: 3 IRTMIIGTSSAFRANVLREHFGDRFRNFVLLPPDIDEKAYRAADPFELTESIARAKMKAV 62 Query: 57 AEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHR-ISSAYV 115 EK + + DQ + G + KP+ + + SG R +++ + Sbjct: 63 LEKARQHSPPISGPAIALTFDQVVVKGDEVREKPLSTEQCRSFIASYSGGGVRTVATYAL 122 Query: 116 LVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLF-SSIK 174 V + + + + K ++ ++ L + + S G ++ E + I Sbjct: 123 CVVGTENVLVAHNETETFFSKFGDDIVERTLERG--ACMNSAGGLVVEDEDMSRHVVRIV 180 Query: 175 GSYFSIVGLPIIELINDLK 193 G+ + + G+ + L Sbjct: 181 GTSYGVRGMEPAVVEKLLS 199 >d1ex2a_ c.51.4.2 (A:) Maf protein {Bacillus subtilis [TaxId: 1423]} Length = 185 Score = 102 bits (255), Expect = 2e-23 Identities = 57/193 (29%), Positives = 93/193 (48%), Gaps = 10/193 (5%) Query: 1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60 M K +ILAS S R++LL + +S++ ++E+ PE+ LA++K Sbjct: 1 MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFS-------PEENVQWLAKQK 53 Query: 61 ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG 120 A V++ +P + VIG D + L KP D EA L R+SG+ H + + V +Q Sbjct: 54 AKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVIT-AVSIQAE 112 Query: 121 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI 180 ++ + LSEE I Y+ K+ + G+Y I G I G Y+S+ Sbjct: 113 NHSETFYDKTEVAFWSLSEEEIWTYIET--KEPMDKAGAYGIQGRGALFVKKIDGDYYSV 170 Query: 181 VGLPIIELINDLK 193 +GLPI + + L+ Sbjct: 171 MGLPISKTMRALR 183 >d1l8na1 c.1.8.10 (A:143-678) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 536 Score = 29.3 bits (66), Expect = 0.23 Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 14/63 (22%) Query: 74 IGCDQTMSLGS---SIYHKPV-DMLE-----AEKNLLRISGKKHRISSAYVLVQNGKVLR 124 IG D+T++ G+ + Y M E ++ LL H + + L +G+ + Sbjct: 409 IGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFF----HHVPYTHRL-HSGETVI 463 Query: 125 HHI 127 HI Sbjct: 464 QHI 466 >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Score = 27.2 bits (59), Expect = 0.97 Identities = 5/21 (23%), Positives = 13/21 (61%) Query: 3 KNIILASSSLSRRKLLQNSGI 23 +I+++ ++ +LL SG+ Sbjct: 251 GEVIVSAGTIGTPQLLLLSGV 271 >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Score = 26.4 bits (57), Expect = 1.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 3 KNIILASSSLSRRKLLQNSGI 23 ++LA+ S +L+ SGI Sbjct: 287 HEVLLAAGSAISPLILEYSGI 307 >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Score = 26.1 bits (56), Expect = 2.2 Identities = 6/21 (28%), Positives = 12/21 (57%) Query: 3 KNIILASSSLSRRKLLQNSGI 23 +IL++ + ++L SGI Sbjct: 246 GRVILSAGAFGTSRILFQSGI 266 >d1s99a_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]} Length = 189 Score = 25.9 bits (57), Expect = 2.2 Identities = 9/51 (17%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Query: 127 ISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSY 177 I+ + ++Y ++++FI + K AL + + ++ + + + ++GS Sbjct: 2 IAGFRFSLYPMTDDFI-----SVIKSALAATDTSKVWTKTDHISTVLRGSI 47 >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Score = 25.6 bits (55), Expect = 2.9 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 3 KNIILASSSLSRRKLLQNSGI 23 ++LA+ S +L+ SGI Sbjct: 281 HEVLLAAGSAVSPTILEYSGI 301 >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 Score = 24.8 bits (53), Expect = 5.7 Identities = 8/32 (25%), Positives = 14/32 (43%) Query: 95 EAEKNLLRISGKKHRISSAYVLVQNGKVLRHH 126 +A + +R +HR + V GK+L Sbjct: 17 QASREQMRAQCLRHRATYIVVHDGMGKILVQR 48 >d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} Length = 249 Score = 24.2 bits (51), Expect = 8.8 Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 136 KLSEEFIKFYLNKIGKKALLSVG 158 + ++EFI F ++ KK ++ G Sbjct: 223 EQTKEFIAFLKSESAKKLIVEYG 245 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.135 0.361 Gapped Lambda K H 0.267 0.0569 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 705,815 Number of extensions: 31799 Number of successful extensions: 91 Number of sequences better than 10.0: 1 Number of HSP's gapped: 87 Number of HSP's successfully gapped: 17 Length of query: 199 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 118 Effective length of database: 1,295,466 Effective search space: 152864988 Effective search space used: 152864988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)