BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780813|ref|YP_003065226.1| Maf-like protein [Candidatus Liberibacter asiaticus str. psy62] (199 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780813|ref|YP_003065226.1| Maf-like protein [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 396 bits (1018), Expect = e-112, Method: Compositional matrix adjust. Identities = 199/199 (100%), Positives = 199/199 (100%) Query: 1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK Sbjct: 1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60 Query: 61 ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG 120 ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG Sbjct: 61 ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG 120 Query: 121 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI 180 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI Sbjct: 121 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI 180 Query: 181 VGLPIIELINDLKIEKVID 199 VGLPIIELINDLKIEKVID Sbjct: 181 VGLPIIELINDLKIEKVID 199 >gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 29.3 bits (64), Expect = 0.046, Method: Compositional matrix adjust. Identities = 26/127 (20%), Positives = 46/127 (36%), Gaps = 27/127 (21%) Query: 24 QFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLG 83 QF + NI+ E ++ ER +PE+I L+ + L + + Sbjct: 67 QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGW--------------- 111 Query: 84 SSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIK 143 D L+ + L + + H + S L +G H + A+LT + I+ Sbjct: 112 --------DFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT----GADCIE 159 Query: 144 FYLNKIG 150 Y G Sbjct: 160 LYTGPYG 166 >gi|254780488|ref|YP_003064901.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 26.2 bits (56), Expect = 0.43, Method: Compositional matrix adjust. Identities = 11/43 (25%), Positives = 22/43 (51%) Query: 135 YKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSY 177 Y + F++ + N KK + + GSY ID+ ++ +I + Sbjct: 8 YPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWW 50 >gi|254780846|ref|YP_003065259.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 25.0 bits (53), Expect = 0.82, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 10/69 (14%) Query: 5 IILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEV 64 I + S + R ++Q+S F++ P+I E+ +E KM FS ++ K LE Sbjct: 50 ITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILE-KMGFSA---------LIRYKFTLET 99 Query: 65 SNRYPESFV 73 +N E F+ Sbjct: 100 ANYSAEQFI 108 >gi|254780383|ref|YP_003064796.1| endonuclease III [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 25.0 bits (53), Expect = 0.88, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 19/27 (70%) Query: 95 EAEKNLLRISGKKHRISSAYVLVQNGK 121 + E++LLRI KH+ ++ Y LV +G+ Sbjct: 177 KVEQSLLRIIPPKHQYNAHYWLVLHGR 203 >gi|254780365|ref|YP_003064778.1| UTP-glucose-1-phosphate uridylyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 299 Score = 24.6 bits (52), Expect = 1.1, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 99 NLLRISGKKHRISSAYVLVQNGKVLRHHI-SVAQLTMYKLSEEFI-KFYLN 147 N+L +S ++S Y +VQ GK + H + ++ + S FI F++N Sbjct: 161 NILAVSECDPQLSCKYGMVQVGKAIDHQVFHISDMIEKPDSSTFISNFFIN 211 >gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 24.3 bits (51), Expect = 1.7, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 29 KPNIDEREMEKKMDFSERK 47 K N D+RE EKK D+ +K Sbjct: 133 KKNYDKRETEKKRDWDRQK 151 >gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Score = 23.9 bits (50), Expect = 2.3, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 88 HKPVDMLEAEKNLLRISGKKHRISSAY 114 H PV +E E R+S + ++ S Y Sbjct: 154 HNPVQWMEEEGYFFRLSAYQDKLLSYY 180 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.135 0.361 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 122,853 Number of Sequences: 1233 Number of extensions: 4906 Number of successful extensions: 20 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 11 length of query: 199 length of database: 328,796 effective HSP length: 70 effective length of query: 129 effective length of database: 242,486 effective search space: 31280694 effective search space used: 31280694 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 36 (18.5 bits)