HHsearch results for GI: 254780814 and protein with PDBid: 3nuh_B

>3nuh_B DNA gyrase subunit B; topoisomerase, supercoiling, specialization, isomera; HET: DNA; 3.10A {Escherichia coli}
Probab=100.00  E-value=0  Score=1088.68  Aligned_cols=411  Identities=46%  Similarity=0.739  Sum_probs=389.7

Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEECCCCCCCHHHCCHHHHHCC
Q ss_conf             45532110011001246766766665555555217999825575432233465443023300562033443058766323
Q gi|254780814|r  392 ARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSS  471 (803)
Q Consensus       392 a~kar~~~rrK~~~~~~~lpgKL~Dc~~k~~~~~eL~ivEGDSAggsak~gRdr~~qai~PLrGKilNv~~a~~~~i~~n  471 (803)
                      |+||||+||||++|++++|||||+||+++||++|||||||||||||||||||||+|||||||||||||||+|+.++|++|
T Consensus         1 ~~~ar~l~rrk~~l~~~~lpgkl~d~~~~~~~~~~l~~~egdsa~~~~~~~r~~~~~~~~pl~gk~ln~~~~~~~~~~~n   80 (420)
T 3nuh_B            1 SNAAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSS   80 (420)
T ss_dssp             -----------------CCBTTBBCCSCCSTTSCEEEEEEHHHHHHHHHHHSCTTTEEEEEECC-------------CCC
T ss_pred             CCHHHHHHHHHCCCCCCCCCCCCHHHCCCCCCCCEEEEECCCCCHHHHHHHCCCCCEEEEECCCCCCCHHCCCHHHHHCC
T ss_conf             93578878410234568998620201148976557999757566777764348666688653886432402788788568


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCEEEEEECCCEE
Q ss_conf             66788887625787753321235673738998508888532899999999963077874895999438337887267179
Q gi|254780814|r  472 QEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQ  551 (803)
Q Consensus       472 ~Ei~~l~~~lG~~~g~~~~~~~~lrY~kiiimtDaD~DG~HI~~Llltff~~~~~~li~~g~~yia~ppl~~~~~~K~E~  551 (803)
                      +||.+|++|||||+|.++||+++||||||||||||||||+||||||||||||+||+||++|||||||||||+|++||+++
T Consensus        81 ~ei~~l~~~lg~~~~~~~~~~~~lry~~i~i~tdad~dg~hi~~ll~~~~~~~~~~l~~~g~~~~~~~p~~~~~~~k~~~  160 (420)
T 3nuh_B           81 QEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQ  160 (420)
T ss_dssp             HHHHHHHHHHC-------------CCSEEEECCCSSTTTTHHHHHHHHHHHHHCHHHHHTTCEEEECCCSEEEEETTEEE
T ss_pred             HHHHHHHHHHCCCCCCCCCCCHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCHHHHHCCCEEEEECCHHHEECCCCEE
T ss_conf             99999999976688977677000554527997357877520588999999986767650780699847246323487107


Q ss_pred             EEECHHHHHHHHHHHCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH--HHHH
Q ss_conf             98145789899985001100001457765435468999999999999999864344579999988742113511--2357
Q gi|254780814|r  552 YVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCE--SDQE  629 (803)
Q Consensus       552 YikDD~EL~~~Ll~~gl~~~~l~~~~~~~~l~ge~L~~li~~~~~~~~~l~~l~~~~~~~lle~l~~~~~l~~~--~d~~  629 (803)
                      |++||.||++||++.|+++..+....++..++|++|.+++..+.++++++.+++++++..++++++..+.+...  .++.
T Consensus       161 y~~~~~~~~~~li~~g~e~~~L~~~~~g~~isg~eL~~ll~~~~~~~~ll~~l~rr~~~~~l~~l~~~~~l~~~~l~~~~  240 (420)
T 3nuh_B          161 YIKDDEAMDQYQISIALDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDEQ  240 (420)
T ss_dssp             EECCHHHHHHHHHHHHHTTEEEEESSSCSEEEHHHHHHHHHHHHHHHHHHHHTTTTSCHHHHHHHHHSCCCCHHHHHCHH
T ss_pred             EEEEHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCHHHHCCHH
T ss_conf             88503678899997413574663155553246477888899999999999987542667789999853333244321179


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEECC------CCCCCEEEEEEECCCCEEEEECHHHHCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             789999999988765310000110024------45670599999518530266466774164278999988887751145
Q gi|254780814|r  630 INVSLASKLANRLNFIAEKSEKSWHGS------INNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLT  703 (803)
Q Consensus       630 ~~~~~~~~l~~~l~~~~~~~~~~~~~~------~~~~~i~~~~~~~Gv~~~~~l~~~~~~s~~~~~~~~~~~~l~~~~~~  703 (803)
                      ....|.+.+...++...... ..|...      .....+.+.+..+|+.....++..|+.+.+++.+..+...+...+..
T Consensus       241 ~~~~~~~~l~~~l~~~~~~~-~~~~~~~~~d~e~~~~~~~i~~~~~Gv~~~~~I~~~f~~s~e~~~l~~~~~~~~~~~~~  319 (420)
T 3nuh_B          241 TVTRWVNALVSELNDKEQHG-SQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEE  319 (420)
T ss_dssp             HHHHHHHHHHHHHHHHCCSS-CEEEEEEEECC---CEEEEEEEECSSSEEEEECCHHHHHSHHHHHHHHHHHHHHHTTTT
T ss_pred             HHHHHHHHHHHHHHHHHCCC-CEEEEEEEECCCCCCCEEEEEEEECCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999986553037-60589985346555221589998447322563398884476789999999987554124


Q ss_pred             CEEEEECCCEEEECCHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHCCCCHHHCEEEEEEHHHHHHHHHHHHHHCCC
Q ss_conf             50276558258739989999999986306762860377778895572230389613402123679889888786564189
Q gi|254780814|r  704 ILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGD  783 (803)
Q Consensus       704 ~~~l~~~~~~~~i~s~~el~~~i~~~gkKG~sIQRYKGLGEMNPeQLWETTMDP~tRtLLqV~IeDa~~Ad~iF~~LMGD  783 (803)
                      ++.+..+++.+++.+|.+++++|++.||||++||||||||||||||||||||||++|+||||+|+||++||+||++||||
T Consensus       320 ~~~~~~~~~~~~i~s~~ell~~v~~~gkKGlsIQRYKGLGEMNPeQLWETTMDP~~RtLLqV~IeDa~~AD~iFs~LMGD  399 (420)
T 3nuh_B          320 DAFIERGERRQPVASFEQALDWLVKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGD  399 (420)
T ss_dssp             SEEEEESSCEEEESSHHHHHHHHHHHHTTTCEEEECSCGGGSCHHHHHHHHTCTTTCCEEECCHHHHHHHHHHHHHHCSC
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             53012576452137689999999996078981234564777798898641528102617998513488999899872699


Q ss_pred             CCCCHHHHHHHHHHHC-CCCC
Q ss_conf             9876289988524412-3669
Q gi|254780814|r  784 EVEPRREFIQENSLPS-ALDI  803 (803)
Q Consensus       784 ~VEPRReFIe~NAL~v-NLDI  803 (803)
                      +|||||+|||+|||+| ||||
T Consensus       400 ~VEPRR~FIe~NAl~V~NLDI  420 (420)
T 3nuh_B          400 AVEPRRAFIEENALKAANIDI  420 (420)
T ss_dssp             C--------------------
T ss_pred             CCHHHHHHHHHHHHHHHHCCC
T ss_conf             957889999998403232599