BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780817|ref|YP_003065230.1| preprotein translocase subunit SecB [Candidatus Liberibacter asiaticus str. psy62] (152 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780817|ref|YP_003065230.1| preprotein translocase subunit SecB [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Score = 306 bits (784), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVIL 60 MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVIL Sbjct: 1 MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVIL 60 Query: 61 SFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRD 120 SFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRD Sbjct: 61 SFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRD 120 Query: 121 GGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK 152 GGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK Sbjct: 121 GGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK 152 >gi|254780784|ref|YP_003065197.1| polynucleotide phosphorylase/polyadenylase [Candidatus Liberibacter asiaticus str. psy62] Length = 699 Score = 24.3 bits (51), Expect = 0.95, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 125 PLVIDTIDFLKLFQQEKSLIK 145 P+VID+ DF KL ++ +IK Sbjct: 229 PIVIDSKDFSKLEEEMSQMIK 249 >gi|254781176|ref|YP_003065589.1| cell division protein FtsZ [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 21.6 bits (44), Expect = 6.2, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 14/31 (45%) Query: 30 FFDIQNQQPTIKINVQVNANTISGADFDVIL 60 F++ I+ V AN I GA FD L Sbjct: 276 LFEVDEAATRIREEVDSEANIILGATFDEAL 306 >gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 21.6 bits (44), Expect = 6.3, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 14 QYIKDFSFESPNAPH 28 Q K+++ +SP APH Sbjct: 86 QTFKEYNSDSPRAPH 100 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.142 0.411 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,165 Number of Sequences: 1233 Number of extensions: 3844 Number of successful extensions: 12 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 6 length of query: 152 length of database: 328,796 effective HSP length: 67 effective length of query: 85 effective length of database: 246,185 effective search space: 20925725 effective search space used: 20925725 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 34 (17.7 bits)