>cd06141 WRN_exo WRN is a unique RecQ DNA helicase exhibiting an exonuclease activity. It contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. Mutations in the WRN gene cause Werner syndrome, an autosomal recessive disorder associated with premature aging and increased susceptibility to cancer and type II diabetes. WRN interacts with key proteins involved in DNA replication, recombination, and repair. It is believed to maintain genomic stability and life span by participating in DNA processes. WRN is stimulated by Ku70/80, an important regulator of genomic stability.

Probab=97.72 E-value=7.7e-05 Score=50.22 Aligned_cols=86 Identities=16% Similarity=0.222 Sum_probs=59.2 Q ss_pred HHHHHHCCCCEEEEECCCCCCCEEEECHHCCCCCCCCCCHHCCCHHCCCCCCCC-CCCCHHHHHHH-HCCCCCC------ Q ss_conf 777530023202310232243112100000112222100001100000001776-42223789997-1875455------ Q gi|254780818|r 83 FWDFFNEQNAEWIAHNAKFDVGFINAELQRINKDPLDPSRIIDTLSIARRKHPS-SRNDLNSLCKR-YGITISH------ 154 (245) Q Consensus 83 f~~fi~~~~~~lVaHNa~FD~~fL~~el~r~~~~~~~~~~~iDTl~lar~~~p~-~~~~L~~l~~~-~~i~~~~------ 154 (245) T Consensus 65 L~~lL~~~~i~Kvg~~~~~D~~~L~~~~---g~~---~~~~~Dl~~~a~~~~~~~~~~sL~~l~~~~lg~~l~K~k~~q~ 138 (168) T cd06141 65 LKQLLEDPSILKVGVGIKGDARKLRRDF---GIE---VRGVVDLSHLAKRVGPRRKLVSLARLVEEVLGLPLSKDKKVRC 138 (168) T ss_pred HHHHHCCCCEEEEEEEEHHHHHHHHHHC---CCC---CCCEEEHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCCCCCCCC T ss_conf 9999759980799963188999998744---502---4876569999998577777632999999983962154665203 Q ss_pred ----------CCCCCCHHHHHHHHHHHHHH Q ss_conf ----------56664026999999999999 Q gi|254780818|r 155 ----------RSKHGALLDSHLLSDVYIKM 174 (245) Q Consensus 155 ----------r~~H~Al~Da~~~a~v~~~l 174 (245) T Consensus 139 SdW~~rpLs~~Qi~YAA~Da~~~~~l~~~L 168 (168) T cd06141 139 SNWEARPLSKEQILYAATDAYASLELYRKL 168 (168) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHHHC T ss_conf 888999999999999999999999999739

HHsearch alignment for GI: 254780818 and conserved domain: cd06141