>cd07014 S49_SppA Signal peptide peptidase A. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppA is an intramembrane enzyme found in all three domains of life and is involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. Unlike the eukaryotic functional homologs that are proposed to be aspartic proteases, site-directed mutagenesis and sequence analysis have shown these bacterial, archaeal and thylakoid SppAs to be ClpP-like serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain, cleaving peptide bonds in the plane of the lipid bilayer. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad (both residues absolutely conserved within bacteria, chloroplast and mitochondrial signal peptidase family members) and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. In addition to the carboxyl-terminal p

Probab=96.06 E-value=0.073 Score=34.96 Aligned_cols=130 Identities=15% Similarity=0.201 Sum_probs=82.3 Q ss_pred HCCCCCHHHHHHHHHHHHHHHHHCC--CEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCEEE Q ss_conf 1853577899999999999986289--68999768887765212467777889999999986299889985676420111 Q gi|254780820|r 132 IGGSIGIAAGEAIVKSCERAIAEKC--PLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVT 209 (284) Q Consensus 132 ~GGSmG~~~geki~~a~e~A~~~~~--PlI~~~~SGGaRMqEG~~sL~qMakt~~a~~~l~~~~lP~I~vl~~pt~GGv~ 209 (284) T Consensus 15 ~~~~~g~~~~~~i~~~l~~a~~d~~vkaIvL~InSPGG----s~~~s~~---i~~~I~~~r~~~KPV~a~~~~~aASg~Y 87 (177) T cd07014 15 SSDTQGNVSGDTTAAQIRDARLDPKVKAIVLRVNSPGG----SVTASEV---IRAELAAARAAGKPVVASGGGNAASGGY 87 (177) T ss_pred CCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCC----CHHHHHH---HHHHHHHHHHCCCCEEEEECCCCCCHHH T ss_conf 88888871699999999999519996289999618981----8899999---9999999886599899997785620577 Q ss_pred EEECCCCCEEEEECCCE---EECCCHHHHHHH-H-------------CCCCC-----CCC-----HHHHHHHHCCCCCEE Q ss_conf 12014685255531421---102327887876-3-------------67788-----720-----215999968983537 Q gi|254780820|r 210 ASYAMLGDIHLAEPGAE---IGFAGRRVIEQT-V-------------REKLP-----DGF-----QRSEYLVEHGMIDRI 262 (284) Q Consensus 210 AS~a~lgDiiiaep~a~---igFaG~rVi~~t-~-------------~~~lp-----~~f-----qtae~l~~~G~iD~i 262 (284) T Consensus 88 -~iA~aad~I~a~p~s~vGSIGV~~~~~~~q~~vd~~~~~Fv~~Va~~R~~~~~~~~~~~~~G~v~~g~~A~~~GLiD~i 166 (177) T cd07014 88 -WISTPANYIVANPSTLVGSIGIFGVQLADQLSIENGYKRFITLVADNRHSTPEQQIDKIAQGGVWTGQDAKANGLVDSL 166 (177) T ss_pred -HHHHCCCEEEECCCCEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCEEEHHHHHHCCCCCCC T ss_conf -8761278899869972776269866689999999999999999997479996786876068677889999986997656 Q ss_pred ECHHHHH Q ss_conf 3589999 Q gi|254780820|r 263 VHRHDIP 269 (284) Q Consensus 263 v~r~~l~ 269 (284) T Consensus 167 G~~~dai 173 (177) T cd07014 167 GSFDDAV 173 (177) T ss_pred CCHHHHH T ss_conf 9999999

HHsearch alignment for GI: 254780820 and conserved domain: cd07014