HHsearch results for GI: 254780820 and protein with PDBid: 3p5m_A

>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium}
Probab=97.49  E-value=0.0034  Score=43.23  Aligned_cols=159  Identities=14%  Similarity=0.152  Sum_probs=98.9

Q ss_pred             EEEEEEECHHHCCCCCHHHHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCCCHH-----HHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999998330318535778999999999999862-89689997688877652124-----677778899999999862998
Q gi|254780820|r  122 LVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAE-KCPLVMFTASGGARMQEGIL-----SLMQLPRTTIAINMLKDAGLP  195 (284)
Q Consensus       122 vvv~~~df~F~GGSmG~~~geki~~a~e~A~~~-~~PlI~~~~SGGaRMqEG~~-----sL~qMakt~~a~~~l~~~~lP  195 (284)
                      |....+|-.=-.-++....-+.+..+++.+.++ .+.+|++...|. .---|..     .............++..-..|
T Consensus        16 v~~itlnrp~~~Nal~~~~~~~l~~~l~~~~~d~~v~~vVl~g~g~-~f~~g~~~~~~~~~~~~~~~~~~~~~l~~~~kP   94 (255)
T 3p5m_A           16 VLRIRLDRPEKLNAVDTPMLEELSVHIRDAEADESVRAVLLTGAGR-AFCSGGDLTGGDTAGAADAANRVVRAITSLPKP   94 (255)
T ss_dssp             EEEEEECCGGGTTEECHHHHHHHHHHHHHHHHCTTCCEEEEEESSS-CSBCEECC---CHHHHHHHHHHHHHHHHHCSSC
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCC-CCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             9999975888678989999999999999997499927999966676-533577430122234312577999999819998


Q ss_pred             EEEEECCCCCCEEEEEECCCCCEEEEECCCEEECC-----------CHHHHHHHHCCC------CCCCCHHHHHHHHCCC
Q ss_conf             89985676420111120146852555314211023-----------278878763677------8872021599996898
Q gi|254780820|r  196 YIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFA-----------GRRVIEQTVREK------LPDGFQRSEYLVEHGM  258 (284)
Q Consensus       196 ~I~vl~~pt~GGv~AS~a~lgDiiiaep~a~igFa-----------G~rVi~~t~~~~------lp~~fqtae~l~~~G~  258 (284)
                      +|+.+.++|.||- +.+++..|+.|+.+.|.++|.           |.....+.++..      +.-.--+++..++.|+
T Consensus        95 vIaav~G~a~GgG-~~lal~~D~ria~~~a~f~~pe~~~Gl~p~~g~~~~l~~~~g~~~a~~~~l~g~~~~a~ea~~~Gl  173 (255)
T 3p5m_A           95 VIAGVHGAAVGFG-CSLALACDLVVAAPASYFQLAFTRVGLMPDGGASALLPLLIGRARTSRMAMTAEKISAATAFEWGM  173 (255)
T ss_dssp             EEEEECSEEETHH-HHHHHHSSEEEECTTCEEECGGGGGTCCCCTTHHHHTHHHHCHHHHHHHHHHCCCEEHHHHHHTTS
T ss_pred             EEEEECCEEEEHH-HHHHHHCCEEEECCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCHHHHHHCCC
T ss_conf             9999789887377-899873788997899889677204064655576324554454310021111378788999987699


Q ss_pred             CCEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             353735899999999999997237
Q gi|254780820|r  259 IDRIVHRHDIPEVVSSLCKILTKS  282 (284)
Q Consensus       259 iD~iv~r~~l~~~i~~ll~il~~~  282 (284)
                      +|.||+..++.+....+.+-+.++
T Consensus       174 v~~vv~~~~l~~~a~~~a~~ia~~  197 (255)
T 3p5m_A          174 ISHITSADEYESVLTDVLRSVSGG  197 (255)
T ss_dssp             CSEECCTTCHHHHHHHHHHHHHTS
T ss_pred             CCEEECHHHHHHHHHHHHHHHHCC
T ss_conf             348818279999999999999669