HHsearch alignment for GI: 254780822 and conserved domain: KOG0190

>KOG0190 consensus.
Probab=99.85  E-value=1.3e-21  Score=145.52  Aligned_cols=102  Identities=28%  Similarity=0.600  Sum_probs=89.4

Q ss_pred             EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHCCCCCCEEEEE
Q ss_conf             177576779999984899499998769970222134666654210001--233322672326577776231568879999
Q gi|254780822|r    3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEESSEISTRYQISSIPTLILF   80 (107)
Q Consensus         3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~   80 (107)
T Consensus       368 VkvlVgknfd~iv~de~KdVLvEfYAPWCgHCk~laP~yeeLAe~~k~~~~vviAKmDaTaN-d~-~~~~~~~fPTI~~~  445 (493)
T KOG0190         368 VKVVVGKNFDDIVLDEGKDVLVEFYAPWCGHCKALAPIYEELAEKYKDDENVVIAKMDATAN-DV-PSLKVDGFPTILFF  445 (493)
T ss_pred             EEEEECCCHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC-CC-CCCCCCCCCEEEEE
T ss_conf             38985067888751578767999707543455655479999999965898708998016665-57-66643665468870


Q ss_pred             ECCEE-EEEEECCCCCHHHHHHHHHHC
Q ss_conf             79989-858874899989999999841
Q gi|254780822|r   81 KDGKV-IDRMMPGASSQSDIIEWILSR  106 (107)
Q Consensus        81 ~~g~~-~~~~~~g~~~~~~l~~~i~~~  106 (107)
T Consensus       446 pag~k~~pv~y~g~R~le~~~~fi~~~  472 (493)
T KOG0190         446 PAGHKSNPVIYNGDRTLEDLKKFIKKS  472 (493)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHCCC
T ss_conf             378988872247875467787542157