HHsearch alignment for GI: 254780822 and conserved domain: KOG0912

>KOG0912 consensus.
Probab=99.77  E-value=3e-19  Score=132.00  Aligned_cols=101  Identities=32%  Similarity=0.663  Sum_probs=91.9

Q ss_pred             ECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHC----C-CCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE
Q ss_conf             5767799999848994999987699702221346666542100----0-1233322672326577776231568879999
Q gi|254780822|r    6 VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADEL----A-DKVKITKLDIEESSEISTRYQISSIPTLILF   80 (107)
Q Consensus         6 i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~----~-~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~   80 (107)
T Consensus         1 lt~~N~~~-il~s~elvfv~FyAdWCrFSq~L~piF~EAa~~~~~e~P~~kvvwg~VDcd~e~~ia~ky~I~KyPTlKvf   79 (375)
T KOG0912           1 LTSENIDS-ILDSNELVFVNFYADWCRFSQMLKPIFEEAAAKFKQEFPEGKVVWGKVDCDKEDDIADKYHINKYPTLKVF   79 (375)
T ss_pred             CCCCCHHH-HHCCCEEEEEEEEHHHCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCEEEEE
T ss_conf             96313777-62514089666330113588887688999999999868886459987055315677654100348614665


Q ss_pred             ECCEEEEEEECCCCCHHHHHHHHHHCC
Q ss_conf             799898588748999899999998419
Q gi|254780822|r   81 KDGKVIDRMMPGASSQSDIIEWILSRV  107 (107)
Q Consensus        81 ~~g~~~~~~~~g~~~~~~l~~~i~~~l  107 (107)
T Consensus        80 rnG~~~~rEYRg~RsVeaL~efi~kq~  106 (375)
T KOG0912          80 RNGEMMKREYRGQRSVEALIEFIEKQL  106 (375)
T ss_pred             ECCCHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             543013134313213999999999974