HHsearch alignment for GI: 254780822 and conserved domain: PRK13703

>PRK13703 conjugal pilus assembly protein TraF; Provisional.
Probab=98.63  E-value=1.5e-07  Score=64.55  Aligned_cols=86  Identities=17%  Similarity=0.167  Sum_probs=68.6

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC---------CHHHHHHHCCCCCCEEEEEE--CCEEE
Q ss_conf             89949999876997022213466665421000123332267232---------65777762315688799997--99898
Q gi|254780822|r   18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE---------SSEISTRYQISSIPTLILFK--DGKVI   86 (107)
Q Consensus        18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~---------~~~l~~~~~v~~~Pt~~~~~--~g~~~   86 (107)
T Consensus       141 a~~~GLffFy~~~c~~c~~~apil~~fa~~yg~~vi~VS~DG~~~p~fp~~r~d~Gqa~~l~V~~~PAL~Lv~p~t~~~~  220 (247)
T PRK13703        141 AEHYGLMFFYRGQDPIDGQLAQVINGFRKTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPALMLVDPKSGSVR  220 (247)
T ss_pred             HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEEEECCCCCEE
T ss_conf             87123899986898046998999999999859779998338986877787777867897369841656999988999288


Q ss_pred             EEEECCCCCHHHHHHHHH
Q ss_conf             588748999899999998
Q gi|254780822|r   87 DRMMPGASSQSDIIEWIL  104 (107)
Q Consensus        87 ~~~~~g~~~~~~l~~~i~  104 (107)
T Consensus       221 Pva-~G~iS~deL~~Ri~  237 (247)
T PRK13703        221 PLS-YGFITQDDLAKRFL  237 (247)
T ss_pred             EEE-ECCCCHHHHHHHHH
T ss_conf             773-11277999999999