HHsearch alignment for GI: 254780822 and conserved domain: TIGR02661

>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD; InterPro: IPR013478 MauD appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulphide bonds. MauD shares sequence similarity, including a CPxC motif, with a number of thiol:disulphide interchange proteins. In MauD mutants, the small subunit apparently does not form properly and is rapidly degraded .; GO: 0030416 methylamine metabolic process.
Probab=97.30  E-value=0.00065  Score=43.69  Aligned_cols=85  Identities=31%  Similarity=0.465  Sum_probs=59.9

Q ss_pred             HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC--CC-----------------CHHHHHHHCCCCCCEE
Q ss_conf             4899499998769970222134666654210001233322672--32-----------------6577776231568879
Q gi|254780822|r   17 ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI--EE-----------------SSEISTRYQISSIPTL   77 (107)
Q Consensus        17 ~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~--d~-----------------~~~l~~~~~v~~~Pt~   77 (107)
T Consensus        72 a~~R~~LLMFTaPsCPvC~KL~PiIkSia~~E~~~Vv~I-SDG~~~EHr~FL~~H~L~~~~YVVSAE~GM~fQV~KiPYG  150 (189)
T TIGR02661        72 ALGRPTLLMFTAPSCPVCDKLLPIIKSIARAEEIDVVLI-SDGTPEEHRRFLKDHELGEERYVVSAEIGMAFQVGKIPYG  150 (189)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEE-ECCCCHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCE
T ss_conf             677750354438888532243278988886725325897-2799279998864288887137886202210011225622


Q ss_pred             EEEE-CCEEEEEEECCC-CCHHHHHHHHHH
Q ss_conf             9997-998985887489-998999999984
Q gi|254780822|r   78 ILFK-DGKVIDRMMPGA-SSQSDIIEWILS  105 (107)
Q Consensus        78 ~~~~-~g~~~~~~~~g~-~~~~~l~~~i~~  105 (107)
T Consensus       151 VLLD~~G~I~AK---GL~NTREHlESLlEa  177 (189)
T TIGR02661       151 VLLDQDGVIRAK---GLTNTREHLESLLEA  177 (189)
T ss_pred             EEECCCCEEEEC---CCCCHHHHHHHHHHH
T ss_conf             566799747742---676438889998862