>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions. Phd and PhLPs specifically bind G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane and impeding G protein-mediated signal transduction by inhibiting the formation of a functional G protein trimer (G protein alphabetagamma). Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-te

Probab=99.82 E-value=1.1e-19 Score=134.47 Aligned_cols=100 Identities=23% Similarity=0.481 Sum_probs=86.6 Q ss_pred CEEEECHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 51775767799999848--9949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) T Consensus 5 ~v~eis~~~f~~~V~~~s~~~~VvV~f~~~~~~~C~~l~~~l~~lA~~~~~-vkF~ki~~~~-~~i~~~~~i~~lPt~l~ 82 (113) T cd02957 5 EVREISSKEFLEEVTKASKGTRVVVHFYEPGFPRCKILDSHLEELAAKYPE-TKFVKINAEK-AFLVNYLDIKVLPTLLV 82 (113) T ss_pred EEEEECHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCC-EEEEEEECCC-HHHHHHCCCCCCCEEEE T ss_conf 079806789999998368997799999789994478998999998632896-1999997572-88898769872668999 Q ss_pred EECCEEEEEEEC------CCCCHHHHHHHH Q ss_conf 979989858874------899989999999 Q gi|254780822|r 80 FKDGKVIDRMMP------GASSQSDIIEWI 103 (107) Q Consensus 80 ~~~g~~~~~~~~------g~~~~~~l~~~i 103 (107) T Consensus 83 yk~G~~v~~lvG~~~~~g~~~~~~~le~~L 112 (113) T cd02957 83 YKNGELIDNIVGFEELGGDDFTTEDLEKFL 112 (113) T ss_pred EECCEEEEEEECHHHHCCCCCCHHHHHHHH T ss_conf 999999899989577489879999999974

HHsearch alignment for GI: 254780822 and conserved domain: cd02957