>cd02958 UAS UAS family; UAS is a domain of unknown function. Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP),

Probab=98.78 E-value=5.1e-08 Score=67.33 Aligned_cols=90 Identities=11% Similarity=0.218 Sum_probs=72.4 Q ss_pred HHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCCCCCEEEEEE--CCEEEE Q ss_conf 984899499998769970222134666---65421000123332267232--65777762315688799997--998985 Q gi|254780822|r 15 VLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE--SSEISTRYQISSIPTLILFK--DGKVID 87 (107) Q Consensus 15 v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~~~Pt~~~~~--~g~~~~ 87 (107) T Consensus 13 Ak~~~K~llVyl~~~~~~~~~~~~r~v~~~~~V~~~i~~~fV~w~~d~~~~eg~~~~~~y~~~~~P~i~iidp~tge~v~ 92 (114) T cd02958 13 AKSEKKWLLVYLQSEDEFDSQVLNRDLWSNESVKEFIRENFIFWQCDIDSSEGQRFLQSYKVDKYPHIAIIDPRTGEVLK 92 (114) T ss_pred HHHHCCEEEEEEECCCCCCHHHHHHHHCCCHHHHHHHHHHEEEEEEECCCHHHHHHHHHCCCCCCCEEEEEECCCCCEEE T ss_conf 99719889999846997438999998458889999997116898631698579999986699998979999789995998 Q ss_pred EEECCCCCHHHHHHHHHH Q ss_conf 887489998999999984 Q gi|254780822|r 88 RMMPGASSQSDIIEWILS 105 (107) Q Consensus 88 ~~~~g~~~~~~l~~~i~~ 105 (107) T Consensus 93 ~~-~G~~~p~~~l~~L~~ 109 (114) T cd02958 93 VW-SGNITPEDLLSQLIE 109 (114) T ss_pred EE-ECCCCHHHHHHHHHH T ss_conf 98-689998999999999

HHsearch alignment for GI: 254780822 and conserved domain: cd02958