HHsearch alignment for GI: 254780822 and conserved domain: cd02986

>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1. Like Dim1, it is also implicated in pre-mRNA splicing and cell cycle progression. DLP is located in the nucleus and has been shown to interact with the U5 small nuclear ribonucleoprotein particle (snRNP)-specific 102kD protein (or Prp6). Dim1 protein, also known as U5 snRNP-specific 15kD protein is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif.
Probab=97.83  E-value=0.00011  Score=48.12  Aligned_cols=96  Identities=21%  Similarity=0.354  Sum_probs=74.5

Q ss_pred             HHHHHHHH-HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEE
Q ss_conf             77999998-48994999987699702221346666542100012333226723265777762315688799997998985
Q gi|254780822|r    9 KSFDSEVL-ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVID   87 (107)
Q Consensus         9 ~~f~~~v~-~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~   87 (107)
T Consensus         3 ~~VDqAI~~e~drvvViRFGr~~d~~Cm~mDeiL~k~a~~v~nfAviYlvDid~Vpdf~~myeL~~~p~t~FFfrnkHm~   82 (114)
T cd02986           3 KEVDQAIKSTAEKVLVLRFGRDEDAVCLQLDDILSKTSHDLSKMASIYLVDVDKVPVYTQYFDISYIPSTIFFFNGQHMK   82 (114)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHCEECCCCCEEEEEECCCEEE
T ss_conf             56667763656369999846999934988989999999987461499998377576332103425797799998584789


Q ss_pred             EEEC-C--------CCCHHHHHHHHH
Q ss_conf             8874-8--------999899999998
Q gi|254780822|r   88 RMMP-G--------ASSQSDIIEWIL  104 (107)
Q Consensus        88 ~~~~-g--------~~~~~~l~~~i~  104 (107)
T Consensus        83 ~D~GTgnnnK~n~~~~~KQe~IDiiE  108 (114)
T cd02986          83 VDYGSPDHTKFVGSFKTKQDFIDLIE  108 (114)
T ss_pred             EECCCCCCCEEEEEECCHHHHHHHHH
T ss_conf             86179987789887085467889999