HHsearch alignment for GI: 254780822 and conserved domain: cd02993

>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red
Probab=99.92  E-value=1.9e-25  Score=167.71  Aligned_cols=102  Identities=17%  Similarity=0.415  Sum_probs=86.8

Q ss_pred             CEEEECHHHHHHHHHH--CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCC--HHHHHHHCCCCCCE
Q ss_conf             5177576779999984--899499998769970222134666654210001-233322672326--57777623156887
Q gi|254780822|r    2 SALKVDTKSFDSEVLE--CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEES--SEISTRYQISSIPT   76 (107)
Q Consensus         2 ~~i~i~~~~f~~~v~~--~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~--~~l~~~~~v~~~Pt   76 (107)
T Consensus         2 ~Vv~L~~~~f~~~v~~~~~~k~~lV~FYAPWCghCk~l~P~~~~lA~~l~~~~v~v~~vd~d~~~~~~~~~~~~V~gyPT   81 (109)
T cd02993           2 AVVTLSRAEIEALAKGERRNQSTLVVLYAPWCPFCQAMEASYEELAEKLAGSNVKVAKFNADGEQREFAKEELQLKSFPT   81 (109)
T ss_pred             CEEECCHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCCCCCCE
T ss_conf             64888777399997043569988999999988888867789999999865589789999778776643420269777788


Q ss_pred             EEEEECCEEEEEEECC-CCCHHHHHHHH
Q ss_conf             9999799898588748-99989999999
Q gi|254780822|r   77 LILFKDGKVIDRMMPG-ASSQSDIIEWI  103 (107)
Q Consensus        77 ~~~~~~g~~~~~~~~g-~~~~~~l~~~i  103 (107)
T Consensus        82 i~~f~~~~~~~~~y~g~~Rt~e~l~~Fi  109 (109)
T cd02993          82 ILFFPKNSRQPIKYPSEQRDVDSLLMFV  109 (109)
T ss_pred             EEEEECCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             9998398998026889994989999659