>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.

Probab=99.95 E-value=2e-28 Score=184.91 Aligned_cols=102 Identities=28% Similarity=0.547 Sum_probs=95.0 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 51775767799999848994999987699702221346666542100012333226723265777762315688799997 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) T Consensus 2 ~Vv~Lt~~nF~~~v~~~~~~~lV~FyapwC~~Ck~~~P~~~~~a~~~~~~v~~~~vd~~~~~~~~~~~~V~~~PTi~lf~ 81 (104) T cd03004 2 SVITLTPEDFPELVLNRKEPWLVDFYAPWCGPCQALLPELRKAARALKGKVKVGSVDCQKYESLCQQANIRAYPTIRLYP 81 (104) T ss_pred CEEEECHHHHHHHHHCCCCEEEEEEECCCCHHHHHCCHHHHHHHHHHCCCEEEEEEECCCCHHHHHCCCCEECCEEEEEC T ss_conf 55992545148998479980999998999844665475799999996796289998884697477367818837899991 Q ss_pred CCEEEEEEECC-CCCHHHHHHHH Q ss_conf 99898588748-99989999999 Q gi|254780822|r 82 DGKVIDRMMPG-ASSQSDIIEWI 103 (107) Q Consensus 82 ~g~~~~~~~~g-~~~~~~l~~~i 103 (107) T Consensus 82 ~~~~~~~~y~G~~R~~e~l~~fi 104 (104) T cd03004 82 GNASKYHSYNGWHRDADSILEFI 104 (104) T ss_pred CCCCCEEECCCCCCCHHHHHHHC T ss_conf 98988545789998999999659

HHsearch alignment for GI: 254780822 and conserved domain: cd03004