HHsearch alignment for GI: 254780822 and conserved domain: cd03020

>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.
Probab=98.22  E-value=2.8e-06  Score=57.30  Aligned_cols=81  Identities=22%  Similarity=0.390  Sum_probs=55.5

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCC-------------------------------------CCC--
Q ss_conf             89949999876997022213466665421000123332-------------------------------------267--
Q gi|254780822|r   18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKIT-------------------------------------KLD--   58 (107)
Q Consensus        18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~-------------------------------------~vd--   58 (107)
T Consensus        76 ~~~~~i~vFtDp~CpyC~kl~~~l~~~~~~i~v~~~~~P~~g~~~s~~~~~~i~Ca~d~~~a~~~~~~~~~~~~~~~~c~  155 (197)
T cd03020          76 NGKRVVYVFTDPDCPYCRKLEKELKPNADGVTVRIFPVPILGLPDSTAKAAAIWCAKDRAKAWTDAMSGGKVPPPAASCD  155 (197)
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             98879999979898789999999885458849999982157785169999999806899999999985799889644346


Q ss_pred             --CCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH
Q ss_conf             --232657777623156887999979989858874899989999999
Q gi|254780822|r   59 --IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI  103 (107)
Q Consensus        59 --~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i  103 (107)
T Consensus       156 ~~v~~~~~l~~~lGi~GTPtiv~-~dG~~----v~G~~~~~~L~~~L  197 (197)
T cd03020         156 NPVAANLALGRQLGVNGTPTIVL-ADGRV----VPGAPPAAQLEALL  197 (197)
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEE-CCCCC----CCCCCCHHHHHHHC
T ss_conf             49999999999829984777996-89979----77989999999439