HHsearch alignment for GI: 254780822 and conserved domain: pfam11009

>pfam11009 DUF2847 Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed.
Probab=97.96  E-value=6.6e-05  Score=49.42  Aligned_cols=93  Identities=18%  Similarity=0.312  Sum_probs=72.3

Q ss_pred             CHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH----HHHHHHCCC-CCCEEEEE
Q ss_conf             767799999848-994999987699702221346666542100012333226723265----777762315-68879999
Q gi|254780822|r    7 DTKSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS----EISTRYQIS-SIPTLILF   80 (107)
Q Consensus         7 ~~~~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~----~l~~~~~v~-~~Pt~~~~   80 (107)
T Consensus         5 t~~ql~~i~~~S~~~pv~ifKHSt~C~IS~~a~~~~e~~~~~~~~~~~~y~ldv~~~R~vSn~IAe~~~V~HESPQ~ivi   84 (104)
T pfam11009         5 TEEQLDEIIEESKEKPVLIFKHSTTCPISRMALKQFEAFAEEDEEDLPVYYLDVQEYRDVSNEIAEKFGVKHESPQVIVI   84 (104)
T ss_pred             CHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             89999999996689828999439987210999999998862552348879999641855789999995996689818999


Q ss_pred             ECCEEEEEEECCCCCHHHH
Q ss_conf             7998985887489998999
Q gi|254780822|r   81 KDGKVIDRMMPGASSQSDI   99 (107)
Q Consensus        81 ~~g~~~~~~~~g~~~~~~l   99 (107)
T Consensus        85 ~~G~~v~~~SH~~It~~~l  103 (104)
T pfam11009        85 KNGEVVWHASHWDITADAL  103 (104)
T ss_pred             ECCEEEEECCCCCCCHHHC
T ss_conf             8997999665012798774