RPSBLAST alignment for GI: 254780822 and conserved domain: KOG0191

>gnl|CDD|35412 KOG0191, KOG0191, KOG0191, Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]. Length = 383
 Score = 55.6 bits (133), Expect = 3e-09
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIEESSEISTR 68
           FD  V +     +V+F+A WC  C KL+P  + +A  L   + V++ K+D      +++R
Sbjct: 154 FDETVKDSDADWLVEFYAPWCGHCKKLAPEWEKLAKLLKSKENVELGKIDATVHKSLASR 213

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            ++   PTL LF  G+       G      I+ ++  +
Sbjct: 214 LEVRGYPTLKLFPPGEEDIYYYSGLRDSDSIVSFVEKK 251