RPSBLAST alignment for GI: 254780822 and conserved domain: cd02966

>gnl|CDD|48515 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.. Length = 116
 Score = 54.5 bits (131), Expect = 7e-09
 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 25/95 (26%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEES----------------- 62
            V+V+FWASWC PC    P ++ +A E  D  V++  +++++                  
Sbjct: 21  VVLVNFWASWCPPCRAEMPELEALAKEYKDDGVEVVGVNVDDDDPAAVKAFLKKYGITFP 80

Query: 63  ------SEISTRYQISSIPTLILF-KDGKVIDRMM 90
                  E++  Y +  +PT  L  +DG++  R +
Sbjct: 81  VLLDPDGELAKAYGVRGLPTTFLIDRDGRIRARHV 115