BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62] (107 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Score = 211 bits (537), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 107/107 (100%), Positives = 107/107 (100%) Query: 1 MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60 MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE Sbjct: 1 MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60 Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV Sbjct: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 >gi|254781065|ref|YP_003065478.1| L-lysine 2,3-aminomutase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 23.5 bits (49), Expect = 1.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 45 ADELADKVKITKLDIEESSEISTRYQISSIPTL 77 A +L + I K I+E EIS Y I+ P + Sbjct: 11 AQDLYNANLIKKEQIDEIKEISNHYSIALTPVI 43 >gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 753 Score = 21.2 bits (43), Expect = 4.5, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 13/16 (81%) Query: 39 PIIDDIADELADKVKI 54 P+++DI DE A+ V+I Sbjct: 296 PLLEDIRDESAEDVRI 311 >gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62] Length = 806 Score = 20.8 bits (42), Expect = 5.8, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 39 PIIDDIADELADKVKITKLDIEESSE 64 P I + DE+AD + + + DIE + + Sbjct: 590 PYIVVVIDEMADLMMVARKDIESAVQ 615 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 20.8 bits (42), Expect = 6.9, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 78 ILFKDGKVIDRMMPGASSQSDIIEWIL 104 + FK GK+ + P S +S II ++ Sbjct: 374 LCFKSGKMTALVGPSGSGKSTIINLLM 400 >gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 170 Score = 20.4 bits (41), Expect = 7.8, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 16/28 (57%) Query: 56 KLDIEESSEISTRYQISSIPTLILFKDG 83 + D++ S+ I+ RY + I++ DG Sbjct: 101 RADVKRSAFITVRYMDCNAQHQIIYADG 128 >gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Score = 20.4 bits (41), Expect = 8.5, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 13/15 (86%) Query: 50 DKVKITKLDIEESSE 64 DKV ++++DIEE S+ Sbjct: 202 DKVLMSRIDIEEKSK 216 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.133 0.392 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,149 Number of Sequences: 1233 Number of extensions: 2158 Number of successful extensions: 12 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 107 length of database: 328,796 effective HSP length: 62 effective length of query: 45 effective length of database: 252,350 effective search space: 11355750 effective search space used: 11355750 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)