BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780823|ref|YP_003065236.1| double-strand break repair
protein AddB [Candidatus Liberibacter asiaticus str. psy62]
         (1040 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter
            asiaticus str. psy62]
 gi|254040500|gb|ACT57296.1| double-strand break repair protein AddB [Candidatus Liberibacter
            asiaticus str. psy62]
          Length = 1040

 Score = 2126 bits (5508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/1040 (100%), Positives = 1040/1040 (100%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL
Sbjct: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR
Sbjct: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
            NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW
Sbjct: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIP 240
            WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIP
Sbjct: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIP 240

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL
Sbjct: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
            DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA
Sbjct: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360

Query: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
            LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP
Sbjct: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420

Query: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNK 480
            LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNK
Sbjct: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNK 480

Query: 481  NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTN 540
            NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTN
Sbjct: 481  NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTN 540

Query: 541  KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKA 600
            KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKA
Sbjct: 541  KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKA 600

Query: 601  NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAK 660
            NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAK
Sbjct: 601  NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAK 660

Query: 661  NPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL 720
            NPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL
Sbjct: 661  NPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL 720

Query: 721  VLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLIN 780
            VLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLIN
Sbjct: 721  VLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLIN 780

Query: 781  DPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIID 840
            DPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIID
Sbjct: 781  DPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIID 840

Query: 841  SHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTG 900
            SHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTG
Sbjct: 841  SHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTG 900

Query: 901  FADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANL 960
            FADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANL
Sbjct: 901  FADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANL 960

Query: 961  FYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNI 1020
            FYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNI
Sbjct: 961  FYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNI 1020

Query: 1021 QSEYDHLARVAEWREEYDIS 1040
            QSEYDHLARVAEWREEYDIS
Sbjct: 1021 QSEYDHLARVAEWREEYDIS 1040


>gi|315122047|ref|YP_004062536.1| double-strand break repair protein AddB [Candidatus Liberibacter
            solanacearum CLso-ZC1]
 gi|313495449|gb|ADR52048.1| double-strand break repair protein AddB [Candidatus Liberibacter
            solanacearum CLso-ZC1]
          Length = 1050

 Score = 1544 bits (3998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/1051 (72%), Positives = 885/1051 (84%), Gaps = 12/1051 (1%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M NKKPN+FTIAPSS FFREM+ +LLNGTLVE+F+YDP NPL LAS+TIYVPTKRAIQ L
Sbjct: 1    MENKKPNIFTIAPSSSFFREMVLSLLNGTLVESFQYDPSNPLSLASITIYVPTKRAIQAL 60

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            RSEF    G+KS ILP+IK LGD+V+E F  D  LS NLNPP+SN++RLLELARLIL WR
Sbjct: 61   RSEFTAAIGEKSIILPVIKPLGDIVDENFNTDFPLSCNLNPPISNMKRLLELARLILAWR 120

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
            N+ P+ IKD+YPESPL LP SPA+AIWLAKNLADIID+IE EEKKWEDL+ L+N+KYGMW
Sbjct: 121  NQFPNKIKDIYPESPLILPASPADAIWLAKNLADIIDVIEIEEKKWEDLYTLENDKYGMW 180

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK--GTKGPIIIAGSTGS 238
            WL A DFLKIAS+YW +RL EL+ SS V YQIALMRAEAE++ K  GT GPII+AGSTGS
Sbjct: 181  WLFALDFLKIASEYWKDRLSELSVSSAVHYQIALMRAEAEYIAKRKGT-GPIIVAGSTGS 239

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +PATARLMS VA+ PNGAIVLPG+D  +P+ IW+TI+EKS NIT SN T+  +PQYSL+K
Sbjct: 240  MPATARLMSAVASDPNGAIVLPGVDVFMPSNIWDTISEKSNNITQSNATHPMNPQYSLSK 299

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL FL IKREDVK LG V++EM  RS++ISKSF P  + +  +TD +E+KI ++QK FSD
Sbjct: 300  LLHFLKIKREDVKCLGIVNDEMRMRSIIISKSFFPSGSFNTYDTDRMEDKILDLQKSFSD 359

Query: 359  VALIEADNEREEAISIAIALRMSLDENKK-KSALITADRNLARRVKLELTRFGINIDISA 417
            VALIEA+NEREEA SIAIALRMSLDENKK KSALITADRNLARRVKLEL RFGI++DISA
Sbjct: 360  VALIEANNEREEATSIAIALRMSLDENKKTKSALITADRNLARRVKLELIRFGIDVDISA 419

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            GIPLSTTL  SILTSLLNA+FK ND MA+A L+KHPLA FGFPEK+L +AKNALEL+ALR
Sbjct: 420  GIPLSTTLQGSILTSLLNAVFKTNDPMALAVLIKHPLATFGFPEKHLFKAKNALELIALR 479

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTY 537
            GN+N  DI+DLKSLV+++I  QKN+ ++P WQSRLSEEDK+L++ L DHI++ I PL  Y
Sbjct: 480  GNRNPCDIIDLKSLVINKINEQKNDKYIPRWQSRLSEEDKKLSLWLADHIVKSIAPLAVY 539

Query: 538  KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSC 597
            K N+NS   +LS  DWT+LT  CLQNVCLDE++KLP+LW  EEGK LS+LFSKIIE G C
Sbjct: 540  KMNENSIGDSLSTPDWTELTAACLQNVCLDENKKLPSLWLAEEGKALSALFSKIIEAGPC 599

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
            IKANAIEWIDIIT LI GETVKPKIEKSST+FILGTLESRLLNFDTLILGGLNEG+WPK 
Sbjct: 600  IKANAIEWIDIITALIAGETVKPKIEKSSTIFILGTLESRLLNFDTLILGGLNEGIWPKY 659

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
            T KNPFLSR+MQSDL L+TAEKYIGQAAHDFEMA+GTRHLIYTRSL+ENNIPT+ASRWLQ
Sbjct: 660  TPKNPFLSRMMQSDLGLETAEKYIGQAAHDFEMASGTRHLIYTRSLQENNIPTVASRWLQ 719

Query: 718  RLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTT-KQPHYKRPKPFPPLEAQPRTYSFSEIK 776
            RLLV GG  F ++LKK+G+ YLDW R+LD +T KQ   KRP+PFPPLE QP+TYSFSEIK
Sbjct: 720  RLLVFGGNAFSNDLKKKGERYLDWARRLDDSTKKQIICKRPRPFPPLETQPKTYSFSEIK 779

Query: 777  QLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMK 836
            +L++DPYA+YA++IL+LDF+P FK DP+  DRG LFH I+T LI+++INKNTPEI   MK
Sbjct: 780  KLMSDPYAIYAQKILRLDFMPRFKNDPNPKDRGILFHKIVTGLIEEKINKNTPEITRRMK 839

Query: 837  QIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGI 896
             IIDS FEKENLPPHIDIIWR+LFHKI+  FLE+EE+ Q  IEK  VN+PAKM I+SIGI
Sbjct: 840  DIIDSCFEKENLPPHIDIIWRYLFHKIALPFLEYEEQRQPLIEKTIVNVPAKMKIDSIGI 899

Query: 897  HLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRK 956
            HLTG ADRID+LKSG+ DI DYKTG+NP K+ AQ LIDPQLSLEA ALKAGSFSQIDCR+
Sbjct: 900  HLTGIADRIDILKSGYADIIDYKTGNNPTKKIAQNLIDPQLSLEAVALKAGSFSQIDCRE 959

Query: 957  VANLFYIRLKQKFK-------IDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
            V  L YIRLK   K       IDCI  ++K  SADELSE+SLKN IEI+  LQ+G++PFI
Sbjct: 960  VGKLVYIRLKLDHKRLKPRLIIDCIAGNEKDLSADELSEESLKNFIEIIKSLQSGKKPFI 1019

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEWREEYDIS 1040
            SHLR SE +NI SEYDHLARV EW+E YD S
Sbjct: 1020 SHLRFSENANIPSEYDHLARVEEWKENYDAS 1050


>gi|222084228|ref|YP_002542754.1| double-strand break repair protein AddB [Agrobacterium radiobacter
            K84]
 gi|221721676|gb|ACM24832.1| double-strand break repair protein AddB [Agrobacterium radiobacter
            K84]
          Length = 1063

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1049 (45%), Positives = 659/1049 (62%), Gaps = 20/1049 (1%)

Query: 2    HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
            H K+  + TI    PF + +  AL +G L E+FR+DP +PL LA VTI++PT+RA + LR
Sbjct: 5    HRKR--ILTIPAGLPFLKTLASALCDGRLTEHFRHDPSDPLSLAKVTIFLPTRRAARVLR 62

Query: 62   SEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            SEF+++ G +S ILP+I+ LG+  ++   F   L  + +L  P++N  RLLELARLIL W
Sbjct: 63   SEFVDLLGGRSAILPVIRPLGETDDDSGYFEEALPATADLAQPLANTARLLELARLILAW 122

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            RNKLP I++D++ +SPL  P SPA+AIWLA+NLA++ID IETE++ W  L  L  E + +
Sbjct: 123  RNKLPQIVRDIHSDSPLVAPASPADAIWLARNLAELIDSIETEDRDWAALGDLSTEDHAL 182

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGS 238
            WW L A+FL+IAS +W  RL EL  SSP  ++ A++RAEA+ + +    GPIIIAGSTGS
Sbjct: 183  WWQLTAEFLQIASAFWPARLEELGKSSPARHRNAILRAEAQRIAIMQHAGPIIIAGSTGS 242

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +PATA L++ VA+ P G IVLPGLD  +P   W  +  ++      + T  +H QY L+ 
Sbjct: 243  VPATAELIAAVASLPQGVIVLPGLDLSMPEEDWQLVAPETGIGERVDPTTRSHSQYGLSL 302

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL  L   R +V+ +   + +M  R+ V+S++  P   +              I   F+D
Sbjct: 303  LLKRLHTPRSEVETVAEATEDMQMRAEVLSRALAPAKATSGWGAWQQTLAPDAISNAFAD 362

Query: 359  VALIEADNEREEAISIAIALRMSL-----DENKKKSALITADRNLARRVKLELTRFGINI 413
            VALIEA NEREEA +IAIALR++L     D  + ++ALIT DRNLARRV  EL RFGI  
Sbjct: 363  VALIEAANEREEATAIAIALRLALEKPGQDGGESQAALITPDRNLARRVTAELARFGITA 422

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PL+ T   ++L  LL A  +  D +AI +L+KHPLA+FG P+  L    +ALE+
Sbjct: 423  DDSAGTPLTATPQGALLQLLLEATLRPGDPVAIVSLLKHPLARFGLPQDALQLGVDALEI 482

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++A Q  N H P W+  L+ E  + A  L   +     P
Sbjct: 483  LALRGGIADVDIGALEPLLDRQLAEQAKNRHTPQWRKSLAPEAVDRARELARQVSGACEP 542

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
            L +   ++ S+ G  ++S+W + T   L+ V +DE   L  LW  E G TL+SL  +II+
Sbjct: 543  LAS-ALSQQSSDGLPTLSEWAERTGRALEAVAIDERGSLAALWSGEAGDTLASLLKEIID 601

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            T   ++A+  +WIDI+  L  G+ VKP+      LFI GTLE+RL + DTLILGGLNEG 
Sbjct: 602  TDGQLEADGPQWIDIMAALCAGQAVKPRALSHPRLFIFGTLEARLQSVDTLILGGLNEGS 661

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  TA NPF+SR M++++ L+  E+ IGQ AHDFEMANGTR LIY+R+LR+ + PT+AS
Sbjct: 662  WPGQTANNPFISRTMKTEIGLEPPERRIGQLAHDFEMANGTRDLIYSRALRQGSTPTVAS 721

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL+ LGG  F   LK RG  Y  W   +D    Q   +RP P PP E QP++YSFS
Sbjct: 722  RWLQRLIALGGKAFTSELKARGDQYRHWAGMIDQGENQAPAQRPAPRPPAELQPKSYSFS 781

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            E+ +L  DPYA+YARR+L+LD I  F +DP   +RGTL+H II   I++     TP+ + 
Sbjct: 782  EVGRLRRDPYAIYARRVLRLDPIDPFNRDPGPAERGTLYHKIIDRFIREGHIAGTPDASL 841

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIES 893
             M  I+   F+ E LP HID +WR  F +++ +F+  E + +  I K    +PA + IE 
Sbjct: 842  AMDHILTELFDAEQLPVHIDSVWRPRFREVARAFIIWEAERRPEIRKTATEVPAGVQIEP 901

Query: 894  IGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            IGI LTG ADRID       DI DYKTG NP    A+ L+DPQL+LEA ALKAG+F  ID
Sbjct: 902  IGIRLTGVADRIDFKGGKAADIIDYKTGYNPSPAQARTLLDPQLALEAYALKAGAFRDID 961

Query: 954  CRKVANLFYIRLK--QKFKIDCITND-------KKKYSADELSEKSLKNLIEIVTLLQNG 1004
                 NL Y+RL+   +FK+D + N+        +  SA +L+++S+  L++ V+LLQ+G
Sbjct: 962  ALVPENLLYVRLRPGDRFKVDQVNNELSSRGGKTETKSALDLAQESMDQLVKFVSLLQSG 1021

Query: 1005 EQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            E+ F S L  +++     +YDHLARV+EW
Sbjct: 1022 EKGFSSRLIPAQQFEYGGDYDHLARVSEW 1050


>gi|150398435|ref|YP_001328902.1| double-strand break repair protein AddB [Sinorhizobium medicae
            WSM419]
 gi|150029950|gb|ABR62067.1| Double-strand break repair protein AddB [Sinorhizobium medicae
            WSM419]
          Length = 1059

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1045 (44%), Positives = 654/1045 (62%), Gaps = 18/1045 (1%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            PNVFTI    PF R +   L +G L   FRYDP  PL LA VTI+VPT+R+ + LRSEF+
Sbjct: 5    PNVFTIPAGLPFLRTLAEKLCDGKLTAGFRYDPTEPLALAGVTIFVPTRRSARVLRSEFV 64

Query: 66   EITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL 123
            ++ G +S ILP+I++LG+  ++   F   L    +L PP+S   RL+EL RLIL WRN+L
Sbjct: 65   DLLGGRSAILPVIRALGETDDDSGFFDTQLPAILDLAPPLSGTARLIELGRLILAWRNRL 124

Query: 124  PDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            P ++ D++ ESPL  P SPA+AIWLA+NLA++ID IETEE  W+ L  L   ++ +WW L
Sbjct: 125  PQVVLDIHAESPLIAPASPADAIWLARNLAELIDAIETEELDWDALDGLDGGEHALWWQL 184

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKGPIIIAGSTGSIPAT 242
               FLKIA  YW ERL EL  SSP  ++ A+++AE + +  G   GPIIIAGSTGSIPAT
Sbjct: 185  TLAFLKIARTYWPERLAELKHSSPARHRNAVLKAETQRIAAGKVTGPIIIAGSTGSIPAT 244

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNIT--SSNTTYSTHPQYSLAKLL 300
            A L++ V   P+G IVLPGLD  +  A W  I  ++      S N    THPQY   +LL
Sbjct: 245  AALIAAVKALPHGTIVLPGLDGTMSNAEWQLIAGEADGAGAFSRNPASRTHPQYGFHRLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              + I+R+DV  L +  +++  RS V+S++ LP D +++     L  +   +   F+ VA
Sbjct: 305  RRMGIERDDVPALASAPDDLDCRSAVLSRALLPADATNVWMQARLSFEPGRLFSAFAGVA 364

Query: 361  LIEADNEREEAISIAIALRMSLD-ENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
            LIEA NEREEA +IAIALR++L+ + + ++ALIT DR+LARRV  EL RFGI  D SAGI
Sbjct: 365  LIEAANEREEATAIAIALRLALEGDEESQAALITPDRDLARRVGAELARFGIEADDSAGI 424

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
            PLS T   ++   +L A  + +D +A+  L+KHPLA+FG   K   RA + LELVALRG 
Sbjct: 425  PLSATAAGTLARLMLEATLRPDDPVALVALLKHPLARFGGSAKDARRAADVLELVALRGG 484

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
             +  DI  L+ ++   +A  +   H P W++ +  +D  LA  L   I   + PL +   
Sbjct: 485  TDVVDISALEPVLDKALAKHQAERHPPPWRNGIGLDDIALARALARRIATAVEPLAS-TL 543

Query: 540  NKNSTCGN-----LSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIET 594
            + ++  G      LS+SDW + T   L+ V +DE   L +LW  E G+TLS+L   I+ET
Sbjct: 544  SADAEIGRHRSTVLSLSDWAERTGRALEAVAVDERGSLGDLWASEAGETLSTLLRGIMET 603

Query: 595  GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVW 654
               ++++  +W DI+  L   E VKP+  +   +FI G LESRL + D ++LGG+NEG W
Sbjct: 604  DGQMESDGAQWCDILEALAASEAVKPRSMRHPRVFIFGALESRLQSVDLVVLGGMNEGTW 663

Query: 655  PKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASR 714
            P+ T+ +PFLSR M++ + L+  E+ IGQ AHDF+MA GTR LI++RS+R+ + PT+ASR
Sbjct: 664  PRQTSNDPFLSRTMKAGIGLEPPERRIGQLAHDFQMACGTRKLIFSRSMRQGSAPTVASR 723

Query: 715  WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSE 774
            WLQRL  LGG      L+  G  YL W R LDY  +QP  +RP+P PP E QPR YSFSE
Sbjct: 724  WLQRLQALGGERLTKQLRANGANYLHWMRILDYGERQPLSERPEPKPPAELQPRKYSFSE 783

Query: 775  IKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHL 834
            I +L  DPYAVYARRIL+L+ I  F +DP   +RG L+H I+   +K   +  + E    
Sbjct: 784  ITRLRRDPYAVYARRILRLEPIDPFNRDPGAAERGQLYHRIVERFVKGGFDPASREGEEA 843

Query: 835  MKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESI 894
            M ++ D  F++E LP HID IWR  F  +  +FL  E + +  + + F  +PA M + + 
Sbjct: 844  MIRLTDEAFDEEKLPAHIDTIWRPRFQAVGRAFLGWERERRRGVSRSFTEVPAAMDLGTA 903

Query: 895  GIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDC 954
             I LTG ADR+D L  G +DI DYKTG +P  + A+ L+DPQL+LEAAAL+AG+F  +  
Sbjct: 904  DIRLTGIADRLDRLTDGTIDIIDYKTGSSPSPKEARALLDPQLALEAAALRAGAFHTVGA 963

Query: 955  RKVANLFYIRLK--QKFKIDCITND----KKKYSADELSEKSLKNLIEIVTLLQNGEQPF 1008
             +  +L Y+RLK   +F +D + N+    K+  S ++L++++L  L +++  L +G   F
Sbjct: 964  ARPHSLRYVRLKPGARFAVDTVNNEGARSKETKSTEQLADEALAELRKLLAALVSGRHGF 1023

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEW 1033
             S L + ++ +   EYDHLARVAEW
Sbjct: 1024 ASRLIVQKQRDYGGEYDHLARVAEW 1048


>gi|222147061|ref|YP_002548018.1| double-strand break repair protein AddB [Agrobacterium vitis S4]
 gi|221734051|gb|ACM35014.1| double-strand break repair protein AddB [Agrobacterium vitis S4]
          Length = 1062

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1051 (44%), Positives = 649/1051 (61%), Gaps = 21/1051 (1%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M + +  +FTI P  PF R +   L +G L   FRYDP +PL L+ VTI VPT+RA++ L
Sbjct: 2    MSSLQARIFTIPPDRPFLRLIAETLCDGRLAPGFRYDPADPLSLSKVTILVPTRRAVRVL 61

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILI 118
            R++F+E+ G +S ILP+IK LG+  ++   F AD      LNPP+SN  RLLELA+LIL 
Sbjct: 62   RAQFVEVLGGQSAILPMIKPLGEAEDDASYFDADTPALLALNPPISNTVRLLELAQLILA 121

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            WRNKLPDI+  ++ E+PL  P SPA+A+WLA+ L ++ID +ETEE+ W DL  L    + 
Sbjct: 122  WRNKLPDIVLSIHTETPLVAPASPADAVWLARALVELIDSVETEERDWADLDKLDARDFA 181

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTG 237
             WW L   FL IAS YW  RL ELN SSPV ++ AL+R E + +       P+I+AGSTG
Sbjct: 182  SWWQLTLAFLGIASAYWPARLEELNRSSPVLHRNALLRTERDRVGHLSDPHPVIVAGSTG 241

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            SIPA + L++ VA  P G IVLPGLD  +P   W+++  +         T  THPQY L 
Sbjct: 242  SIPAASELIAAVARLPQGVIVLPGLDKAMPDDQWHSVGGEQPPGMPPEPTARTHPQYGLH 301

Query: 298  KLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFS 357
            +LL  L + R+DV  L     ++  RS ++S++  P   +D              Q  F+
Sbjct: 302  RLLGRLGLTRDDVGVLEEAEPDLADRSEILSRALSPAKATDQWTAWRQAFGDNRFQAAFA 361

Query: 358  DVALIEADNEREEAISIAIALRMSL-----DENKKKSALITADRNLARRVKLELTRFGIN 412
            DVALIEA NEREEAI+IAIALR++L     D  + ++ALIT DRNLARRV  EL RFGI 
Sbjct: 362  DVALIEAANEREEAIAIAIALRLALERPGADGGESRAALITPDRNLARRVASELARFGIE 421

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
             D SAG P S T   ++L  +L A+ +  D +AI +L+KHPLA+FG P+     A +ALE
Sbjct: 422  ADDSAGTPFSATPQGTLLVLVLEAVLRPGDPVAIVSLLKHPLARFGLPDDGHREATDALE 481

Query: 473  LVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532
             +ALRG   + DI  L  L  +++  Q ++ H P W+   +++ ++ A +L + I + + 
Sbjct: 482  AIALRGGTGAIDIAALAPLFDEQVVAQFDDRHPPAWRRSFTDQTRQQARILAEAIAEAVE 541

Query: 533  PL---VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            PL   V  K + +     LS+ +W + T   L+ V   +   L  LW  E G  L+ L S
Sbjct: 542  PLAGHVVAKPDGHHFTTRLSLREWAERTGQVLEAVARTDEGDLGPLWANEAGAVLARLLS 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            +I+ET   + A+  +WI+I+  L   E+VKPK  +   +FI G LESRL + DT+ILGGL
Sbjct: 602  EIMETDGQLSADGPQWIEIVAALTASESVKPKSLRHPRVFIFGALESRLQSVDTMILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  T  NPFLSR M++++ L+  E+ IGQ AHDFEMANGTRHLIY R+LR+ + P
Sbjct: 662  NEGSWPGTTTNNPFLSRSMKTEMGLEPPERQIGQLAHDFEMANGTRHLIYCRALRQGSAP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL LGG DF + LK RG+ Y  +   LD    Q   +RP+P PP +  P+T
Sbjct: 722  TVASRWLQRLLALGGKDFAETLKARGERYRHFADLLDKGADQAAAQRPQPKPPADLHPKT 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPY++YARRILKLD +  F  DP  ++RGTL+H I+ + + +   K  P
Sbjct: 782  YSFSEVGRLRRDPYSIYARRILKLDPVEPFNSDPGASERGTLYHAIVEQFVARMPEKLGP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +   LM +I D+ F +ENLPPHI ++WR  F ++  +F+E +   Q    K+     A +
Sbjct: 842  DTEQLMSEIADTLFAEENLPPHIHVVWRKRFSEVGLAFIEWQR--QRDPAKLVTEARAGV 899

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +  I I LTG ADRID +++G  DI DYKTG NP    A+ L+DPQL+LEAAAL  G+F
Sbjct: 900  ELGEIDIRLTGIADRID-IRAGHADIIDYKTGLNPSVSQARSLLDPQLALEAAALTMGAF 958

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITND-----KKKYSADELSEKSLKNLIEIVTLLQ 1002
              +      NL Y+RL+   +FK D + N+      K  SA +L+ +S+  L   VTLLQ
Sbjct: 959  KDVGRLNPDNLIYVRLRPGGRFKADQVNNELTGKGDKAKSALDLAHESIAQLTRFVTLLQ 1018

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +GE+ ++S L  +  ++   +YDHLARVAEW
Sbjct: 1019 SGERGYVSRLMPAMMNDFSGDYDHLARVAEW 1049


>gi|325291477|ref|YP_004277341.1| double-strand break repair protein AddB [Agrobacterium sp. H13-3]
 gi|325059330|gb|ADY63021.1| double-strand break repair protein AddB [Agrobacterium sp. H13-3]
          Length = 1061

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1053 (43%), Positives = 648/1053 (61%), Gaps = 29/1053 (2%)

Query: 2    HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
            H K+  V TIA  +PF + +   L +GTL   ++YDP +PL LA VTIYVPT+R+ + LR
Sbjct: 6    HAKR--VLTIAAGTPFLKTLAETLCDGTLTAGYKYDPADPLSLAKVTIYVPTRRSARVLR 63

Query: 62   SEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            SEF+++ G +S ILP+I+ LG+  ++   F  +     +L PP+S   R +ELARLIL W
Sbjct: 64   SEFVDLLGGRSAILPLIRPLGETDDDSGFFEIENPEIMDLAPPISGTGRQIELARLILAW 123

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            RN LPD I+ ++ +SPL  P SPA+AIWLA+ L ++ID ++TEEK+WE L  L    +  
Sbjct: 124  RNSLPDAIRAIHSDSPLVAPASPADAIWLARALGEVIDAMDTEEKEWEALAHLDTGDHAQ 183

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGS 238
            WW L ADFLKIAS +W  RL ELN +S   ++  ++RAEA  L      GPI++AGSTGS
Sbjct: 184  WWQLTADFLKIASVFWPARLAELNRTSAGRHRNGILRAEANRLANLPDTGPIVVAGSTGS 243

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            IPA A L+++VA+ P G +VLPGLD  +P   W  I E  T+ +S      TH QY L  
Sbjct: 244  IPAAADLIASVASLPQGVVVLPGLDLTMPEEQWEAIAEDPTDPSSR-----THSQYGLYM 298

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNI-QKCFS 357
            LL  LDI R+DV ++G + +++  R+ V S +  P  ++   N    E+K P      F+
Sbjct: 299  LLQKLDIMRDDVVQIGVIDSDLEKRAAVFSAALAPAKSTSDWNR-WREDKQPGFFDDAFA 357

Query: 358  DVALIEADNEREEAISIAIALRMSLDE----NKKKSALITADRNLARRVKLELTRFGINI 413
               LIEA NEREEA +IA+ALR++L+        ++ALIT DR LARRV  EL RFGI  
Sbjct: 358  AATLIEAANEREEATAIAVALRLALEAPGAGRPSQAALITPDRGLARRVATELQRFGIEA 417

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS T  + +    L AI +  D + + +L+KHPL++FG   +  ++A  ALEL
Sbjct: 418  DDSAGTPLSATPQAGLTQLALEAILRPGDPVPVISLLKHPLSRFGLSLEAFTKASKALEL 477

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG +   +I +L++++  ++A Q+++ H P W+  L E   + A  L   I     P
Sbjct: 478  IALRGGRVETEIGNLEAVLDAQLAAQRDDRHPPAWRLALPEGSVDAARDLARRIAVSTEP 537

Query: 534  L----VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L    V    +  S    L +SDW + T   ++ +C D++  L  LW  E G  LS LF 
Sbjct: 538  LGSAFVRRDRSGRSFTDKLPLSDWAERTGRVIEAICADDNNDLATLWSGEAGDKLSGLFG 597

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            +++E+G  + A+  +W DI   L+ GE++KP+  +   +FI G LE+RL + DT+++GGL
Sbjct: 598  ELMESGEILDADGPQWADIFAALVAGESIKPRSMRHPRIFIFGALEARLQSVDTVVIGGL 657

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG+WP  TA NPFLSR M++ + L+  E+ IGQ AHDFEMANGTR + Y+R+LR+ + P
Sbjct: 658  NEGLWPGQTANNPFLSRNMKTAIGLEPPERRIGQLAHDFEMANGTRQIFYSRALRQGSTP 717

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             +ASRWLQRLL LGG DF D LKKRG+ Y  W   +D +  Q   KRP P PP + QP++
Sbjct: 718  AVASRWLQRLLALGGEDFADQLKKRGETYRHWAALMDASIDQEAAKRPAPKPPADLQPKS 777

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPY++YARRILKL+ +  F +DP+  DRGTL+H II    ++     TP
Sbjct: 778  YSFSEVGRLRRDPYSIYARRILKLNPLDGFNRDPNAADRGTLYHAIIERYSREGHIPGTP 837

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
                 M++I+D  F+ E+LP H+D+IWR  F  ++ +F++ E++   SI + F    A  
Sbjct: 838  ASLEAMQRILDESFDAEDLPAHVDVIWRPRFEAVARAFIDWEKERHPSIRRSFFEARAGQ 897

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             I   GI LTG ADRID+   G  DI DYKTG  P    A+ L+DPQL+LEAAAL  G+F
Sbjct: 898  EIPEAGIRLTGIADRIDIKTGGQADIIDYKTGLAPSVNQARALLDPQLALEAAALMRGAF 957

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITND-------KKKYSADELSEKSLKNLIEIVTL 1000
             +   +   NL Y+RL+   +F  D + N+       K   SA EL+ +S+  L + V  
Sbjct: 958  REAGSQTPENLIYVRLRPGTRFFADQVNNEHSNRGGKKAPKSAIELATESIDQLAKFVRS 1017

Query: 1001 LQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            L++GE  F S L   E+ +   EYDHLARV+EW
Sbjct: 1018 LRDGENGFASRLVPEEQQSYGGEYDHLARVSEW 1050


>gi|15963788|ref|NP_384141.1| hypothetical protein SMc02759 [Sinorhizobium meliloti 1021]
 gi|15072963|emb|CAC41422.1| Hypothetical protein SMc02759 [Sinorhizobium meliloti 1021]
          Length = 1059

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1044 (44%), Positives = 648/1044 (62%), Gaps = 16/1044 (1%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            PNVFTI    PF R +   L NG L   FRYDP  PL LA VTI+VPT+R+ + LRSEF+
Sbjct: 5    PNVFTIPAGLPFLRTVAERLCNGELTPGFRYDPAQPLALAGVTIFVPTRRSARVLRSEFV 64

Query: 66   EITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL 123
            ++ G +S ILP+I++LG+  ++   F A++    +L PP+S   RL+EL RLIL WRN+L
Sbjct: 65   DLLGGRSAILPMIRALGETDDDSGFFDAEVPAILDLAPPLSGTARLIELGRLILAWRNRL 124

Query: 124  PDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            P ++ D++ ESPL  P SPA+AIWLA+NLA++ID IETEE  W+ L  L   ++ +WW L
Sbjct: 125  PQVVLDIHAESPLIAPASPADAIWLARNLAELIDAIETEELDWDALDGLDGGEHALWWQL 184

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKGPIIIAGSTGSIPAT 242
               FLKIA  YW ERL EL  SSP  ++ A+++AE + +  G   GPIIIAGSTGSIPAT
Sbjct: 185  TLAFLKIARTYWPERLAELKHSSPARHRNAVLKAETQRIAAGKVSGPIIIAGSTGSIPAT 244

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSS--NTTYSTHPQYSLAKLL 300
            A L++ V   PNG IVLPGLD  +  A W  I  +++   +S  N    THPQY   +LL
Sbjct: 245  AALIAAVKTLPNGTIVLPGLDGSMSDAEWRLIAGETSGSGTSARNPASRTHPQYGFHRLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              + I+  DV  L + ++++  RS V+S++ LP D +D+            +   F+DVA
Sbjct: 305  KRMGIELGDVPALASAADDLDYRSAVLSRALLPADATDVWMEARRSFDAERLLSAFADVA 364

Query: 361  LIEADNEREEAISIAIALRMSLDENKK-KSALITADRNLARRVKLELTRFGINIDISAGI 419
            LIEA NEREEA +IAIALR++L+ +++ ++ALIT DR LARRV  EL RFGI  D SAGI
Sbjct: 365  LIEAANEREEATAIAIALRLALEADEESQAALITPDRGLARRVGTELARFGIEADDSAGI 424

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
            PLS T   ++   LL A  + +D +A+  L+KHPLA+FG       RA + LEL ALRG 
Sbjct: 425  PLSATPAGALARLLLEATLRPDDPVALVALLKHPLARFGRTADDARRAADVLELAALRGG 484

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
             ++ D+  L++++   +  QK + H P W++ +  +D  +A  L   I   + PL +  +
Sbjct: 485  TDAADVSALEAVLDKALDRQKTDRHPPPWRAGIGPDDIAMARALARRIASAVGPLSSNLS 544

Query: 540  NKNSTCGN----LSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
                T  +    L +SDW + T   L+   +DE   L  LW  E G+ L++L   IIET 
Sbjct: 545  ADPQTGRHRSTVLPLSDWAERTGRALEAAAIDEQGNLGALWASEAGEILATLLRGIIETD 604

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
              ++A+  +W DI+  L   E VKP+  +   +FI G LESRL + D ++LGG+NEG WP
Sbjct: 605  GQMEADGPQWCDILEALAASEAVKPRSMRHPRVFIFGALESRLQSVDLVVLGGMNEGTWP 664

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
              T+ +PFLSR M++ + L+  E+ IGQ AHDF+MA GTR LI +RS+R+ + PT+ASRW
Sbjct: 665  GQTSNDPFLSRTMKAGIGLEPPERRIGQLAHDFQMACGTRRLILSRSMRQGSAPTVASRW 724

Query: 716  LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
            LQRL  LGG      LK  G  YL W R LD   +QP  +RP+P PP E QPR YSFSE+
Sbjct: 725  LQRLQALGGERLTALLKANGADYLHWMRILDQGERQPLSERPEPKPPAELQPRKYSFSEV 784

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
             +L  DPYAVYARRIL+L+ I  F +DP   +RG L+H I+   +K   +    E    M
Sbjct: 785  TRLRRDPYAVYARRILRLEPIQPFNRDPGAAERGLLYHRIVDRFVKGGFDPAAREGEEAM 844

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG 895
             ++ D  F++E LP HID IWR  F  +  +FLE E + +  I K F  +PA M +    
Sbjct: 845  IRLTDEAFDEEKLPAHIDTIWRPRFQAVGRAFLEWERERRHGIVKSFTEVPAAMDLGIGD 904

Query: 896  IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCR 955
            I LTG ADR+D L  G +DI DYKTG +P  + A+ L+DPQL+LEAAAL+AG+F  I   
Sbjct: 905  IRLTGIADRLDRLADGTIDIIDYKTGSSPSPKEARALLDPQLALEAAALRAGAFRVIGPA 964

Query: 956  KVANLFYIRLK--QKFKIDCITND----KKKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
            +  +L Y+RLK   +F +D + N+    K+  S  +L+++SL  L ++++ L +G   F 
Sbjct: 965  QPHSLRYVRLKPGSRFAVDTVNNEGAGSKETKSTGQLADESLAELRKLLSALMSGRFGFA 1024

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEW 1033
            S L + ++ +   EYDHLARVAEW
Sbjct: 1025 SRLIVQKQRDYGGEYDHLARVAEW 1048


>gi|307310976|ref|ZP_07590621.1| double-strand break repair protein AddB [Sinorhizobium meliloti
            BL225C]
 gi|307322013|ref|ZP_07601392.1| double-strand break repair protein AddB [Sinorhizobium meliloti AK83]
 gi|306892351|gb|EFN23158.1| double-strand break repair protein AddB [Sinorhizobium meliloti AK83]
 gi|306899656|gb|EFN30283.1| double-strand break repair protein AddB [Sinorhizobium meliloti
            BL225C]
          Length = 1059

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1044 (44%), Positives = 648/1044 (62%), Gaps = 16/1044 (1%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            PNVFTI    PF R +   L NG L   FRYDP  PL LA VTI+VPT+R+ + LRSEF+
Sbjct: 5    PNVFTIPAGLPFLRTVAERLCNGELTPGFRYDPAQPLALAGVTIFVPTRRSARVLRSEFV 64

Query: 66   EITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL 123
            ++ G +S ILP+I++LG+  ++   F A++    +L PP+S   RL+EL RLIL WRN+L
Sbjct: 65   DLLGGRSAILPMIRALGETDDDSGFFDAEVPAILDLAPPLSGTARLIELGRLILAWRNRL 124

Query: 124  PDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            P ++ D++ ESPL  P SPA+AIWLA+NLA++ID IETEE  W+ L  L   ++ +WW L
Sbjct: 125  PQVVLDIHAESPLIAPASPADAIWLARNLAELIDAIETEELDWDALDGLDGGEHALWWQL 184

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKGPIIIAGSTGSIPAT 242
               FLKIA  YW ERL EL  SSP  ++ A+++AE + +  G   GPIIIAGSTGSIPAT
Sbjct: 185  TLAFLKIARTYWPERLAELKHSSPARHRNAVLKAETQRIAAGKVSGPIIIAGSTGSIPAT 244

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSS--NTTYSTHPQYSLAKLL 300
            A L++ V   PNG IVLPGLD  +  A W  I  +++   +S  N    THPQY   +LL
Sbjct: 245  AALIAAVKTLPNGTIVLPGLDGSMSDAEWRLIAGETSGSGTSARNPASRTHPQYGFHRLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              + I+  DV  L + ++++  RS V+S++ LP D +D+            +   F+DVA
Sbjct: 305  KRMGIELGDVPALASAADDLDYRSAVLSRALLPADATDVWMEARRSFDAERLLSAFADVA 364

Query: 361  LIEADNEREEAISIAIALRMSLDENKK-KSALITADRNLARRVKLELTRFGINIDISAGI 419
            LIEA NEREEA +IAIALR++L+ +++ ++ALIT DR LARRV  EL RFGI  D SAGI
Sbjct: 365  LIEAANEREEATAIAIALRLALEADEESQAALITPDRGLARRVGTELARFGIEADDSAGI 424

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
            PLS T   ++   LL A  + +D +A+  L+KHPLA+FG       RA + LEL ALRG 
Sbjct: 425  PLSATPAGALARLLLEATLRPDDPVALVALLKHPLARFGRTADDARRAADVLELAALRGG 484

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
             ++ D+  L++++   +  QK + H P W++ +  +D  +A  L   I   + PL +  +
Sbjct: 485  TDAADVSALEAVLDKALDRQKTDRHPPPWRAGIGPDDIAMARALARRIASAVGPLSSNLS 544

Query: 540  NKNSTCGN----LSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
                T  +    L +SDW + T   L+   +DE   L  LW  E G+ L++L   IIET 
Sbjct: 545  ADPQTGRHRSTVLPLSDWAERTGRALEAAAIDEQGNLGALWASEAGEILATLLRGIIETD 604

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
              ++A+  +W DI+  L   E VKP+  +   +FI G LESRL + D ++LGG+NEG WP
Sbjct: 605  GQMEADGPQWCDILEALAASEAVKPRSMRHPRVFIFGALESRLQSVDLVVLGGMNEGTWP 664

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
              T+ +PFLSR M++ + L+  E+ IGQ AHDF+MA GTR LI +RS+R+ + PT+ASRW
Sbjct: 665  GQTSNDPFLSRTMKAGIGLEPPERRIGQLAHDFQMACGTRRLILSRSMRQGSAPTVASRW 724

Query: 716  LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
            LQRL  LGG      LK  G  YL W R LD   +QP  +RP+P PP E QPR YSFSE+
Sbjct: 725  LQRLQALGGERLTALLKANGADYLHWMRILDQGERQPLSERPEPKPPAELQPRKYSFSEV 784

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
             +L  DPYAVYARRIL+L+ I  F +DP   +RG L+H I+   +K   +    E    M
Sbjct: 785  TRLRRDPYAVYARRILRLEPIQPFNRDPGAAERGLLYHRIVDRFVKGGFDPAAREGEEAM 844

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG 895
             ++ D  F++E LP HID IWR  F  +  +FLE E + +  I K F  +PA M +    
Sbjct: 845  IRLTDEAFDEEKLPAHIDTIWRPRFQAVGRAFLEWERERRHGIVKSFTEVPAAMDLGIGD 904

Query: 896  IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCR 955
            I LTG ADR+D L  G +DI DYKTG +P  + A+ L+DPQL+LEAAAL+AG+F  I   
Sbjct: 905  IRLTGIADRLDRLADGTIDIIDYKTGSSPSPKEARALLDPQLALEAAALRAGAFRVIGPA 964

Query: 956  KVANLFYIRLK--QKFKIDCITND----KKKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
            +  +L Y+RLK   +F +D + N+    K+  S  +L+++SL  L ++++ L +G   F 
Sbjct: 965  QPHSLRYVRLKPGSRFAVDTVNNEGARSKETKSTGQLADESLAELRKLLSALMSGRFGFA 1024

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEW 1033
            S L + ++ +   EYDHLARVAEW
Sbjct: 1025 SRLIVQKQRDYGGEYDHLARVAEW 1048


>gi|209551531|ref|YP_002283448.1| double-strand break repair protein AddB [Rhizobium leguminosarum bv.
            trifolii WSM2304]
 gi|209537287|gb|ACI57222.1| double-strand break repair protein AddB [Rhizobium leguminosarum bv.
            trifolii WSM2304]
          Length = 1064

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1051 (43%), Positives = 656/1051 (62%), Gaps = 26/1051 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P + TI     F + +   L +G L   FR++  +PL L+ VTIY+PT+RA++ LRSEF
Sbjct: 6    QPRILTIPAGLSFLKTLATTLCDGRLTPLFRHEADDPLSLSRVTIYLPTRRAVRVLRSEF 65

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  RLLELARLIL WRNK
Sbjct: 66   VDLLGGRSAILPVIRPLGETDDDSGYFDEALPATIDLAQPLSNTARLLELARLILAWRNK 125

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  WW 
Sbjct: 126  LPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSELSKLDTGDYAAWWQ 185

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGSIP 240
            L A+FL+IAS +W ERL EL  SSP  ++ A++RAEA  L   TK  GPIIIAGSTGS+P
Sbjct: 186  LTAEFLQIASAFWPERLSELGKSSPARHRNAILRAEASRL-SATKPTGPIIIAGSTGSVP 244

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA L++ VAN P G IVLPGLD  +P   W  +  + +    +N    +HPQY L+ LL
Sbjct: 245  ATADLIAAVANLPEGVIVLPGLDLAMPERHWQMVAPELSPGQHANPASRSHPQYGLSSLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN--IQKCFS 357
              L + R DV  L     ++  R+ ++S++ +P + TSD       ++++P       F+
Sbjct: 305  KRLKLTRADVTLLDRPEADLDRRAEILSRALVPAEATSDW---GAWKSELPEGAFSSAFA 361

Query: 358  DVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINI 413
            DV+LIEA NEREEA +IAIALR++L+    + + ++ALIT DRNLARRV  EL+RFGI  
Sbjct: 362  DVSLIEAANEREEATAIAIALRLALERPGQDGESRAALITPDRNLARRVMAELSRFGILA 421

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PL+ T   ++L  LL A  +  D +AI +L+KHPLA+FG     L      LEL
Sbjct: 422  DDSAGTPLAATPQGTLLQLLLEAALRPGDPVAIVSLLKHPLARFGLDRAALISTTETLEL 481

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++A Q  + H P W+  L+ +  E A  L   + Q   P
Sbjct: 482  LALRGGVAEVDISRLEPLLTHQLAEQAGDRHAPQWRKALAPDAAEAAYDLARRVTQATEP 541

Query: 534  LVT----YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L +    ++        + ++S+W + T   L+ V  D H  L +LW  E G  L++L  
Sbjct: 542  LASALMRHRPEVRGRTASFTLSEWAERTGRSLEAVAADPHGNLADLWSGEAGDALAALLG 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++I+T   ++A+  +WIDI+  L  G  +KP+      LFI GTLE+RL + DT+ILGGL
Sbjct: 602  EVIDTNGQMEADGPQWIDIMAALAAGHALKPRALSHPRLFIFGTLEARLQSVDTMILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  TA NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + P
Sbjct: 662  NEGTWPGQTANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL L G  F   LK RG  +L W   +D    Q   +RP P PPL  QP +
Sbjct: 722  TVASRWLQRLLALAGETFEAELKGRGNRFLQWAGLIDRGEAQAPAQRPSPKPPLTLQPTS 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPYA+YARRIL+LD +  F +DP   +RGTL+H II   I++     TP
Sbjct: 782  YSFSEVGRLRRDPYAIYARRILRLDPVDAFNRDPGAAERGTLYHTIIDRFIREAHVAGTP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +    M++I+   F+ E LPPHID +WR  F  ++ +FL+ E   +  I K    +   +
Sbjct: 842  DAAAAMERILSELFDMEQLPPHIDAVWRPRFRAVAGAFLDWEAGRRPGIRKTLTEVRGGV 901

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E+I I L G ADRID+      DI DYKTG NP    A+ L+DPQL+LEAAAL+ G+F
Sbjct: 902  ELEAINIRLNGVADRIDVTGPHAADIIDYKTGYNPSPAQARVLLDPQLALEAAALRDGAF 961

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQ 1002
              +      +L Y+RL+  ++F++D + N+      K  SA +L+E+S+  L++ V+LLQ
Sbjct: 962  RDVGSLIPQDLLYVRLRPGRRFQVDTVNNESSARSDKAKSAMDLAEESIDQLVKFVSLLQ 1021

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +GE+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1022 SGEKGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|15887383|ref|NP_353064.1| hypothetical protein Atu0024 [Agrobacterium tumefaciens str. C58]
 gi|15154886|gb|AAK85849.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 1061

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1053 (43%), Positives = 646/1053 (61%), Gaps = 29/1053 (2%)

Query: 2    HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
            H K+  V TIA  +PF + +   L +G L   +RYDP +PL LASVTIYVPT+R+ + LR
Sbjct: 6    HAKR--VLTIAAGTPFLKTLAETLCDGRLTAGYRYDPTDPLSLASVTIYVPTRRSARVLR 63

Query: 62   SEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIW 119
            SEF+++ G +S ILP+I+ LG+  ++    D+      +L PP+S   R +ELARLIL W
Sbjct: 64   SEFVDLLGGRSAILPLIRPLGETDDDSGFFDIENPEIMDLAPPISGTGRQIELARLILAW 123

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            RN LPD I+ ++ +SPL  P SPA+AIWLA+ L ++ID ++TEEK WE L  L   ++  
Sbjct: 124  RNSLPDAIRAIHSDSPLVAPASPADAIWLARALGEVIDAMDTEEKDWEALQHLDTGEHAQ 183

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGS 238
            WW L ADFLKIAS +W  RL ELN SS   ++ A++RAEA+ L      GPII+AGSTGS
Sbjct: 184  WWQLTADFLKIASVFWPARLAELNRSSAGRHRNAILRAEADRLANLPDTGPIIVAGSTGS 243

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            IPA A L++ VA  P G +VLPGLD  +P   W  I E  T+ +S      THPQY L  
Sbjct: 244  IPAAADLIAAVAALPQGTVVLPGLDLAMPEEQWQAIIEDPTDPSSR-----THPQYGLYM 298

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNI-QKCFS 357
            LL  L + R++V ++G +  ++  R+ V S +  P  ++   N    E + P    + F+
Sbjct: 299  LLQKLGMSRDEVVQIGALDRDLEKRAAVFSAALAPAKSTSDWNG-WREGRDPGFFDEAFA 357

Query: 358  DVALIEADNEREEAISIAIALRMSLDE----NKKKSALITADRNLARRVKLELTRFGINI 413
               LIEA N+REEA +IA+ALR++L+        ++ALIT DR LARRV  EL RFGI  
Sbjct: 358  AATLIEAANQREEATAIAVALRLALEAPGPGRPSQAALITPDRGLARRVATELQRFGIEA 417

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS T  + +    L AI +  D + I +L+KHPLA+FG      ++A  ALEL
Sbjct: 418  DDSAGTPLSATPQAGLTQLALEAILRPGDPVPIISLLKHPLARFGLSGDAFTKASKALEL 477

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG +   +I +L+ ++  ++  Q++N H P W+  L E   + A  L   I     P
Sbjct: 478  IALRGGRVETEIGNLEVVLDAQLLAQRDNRHPPAWRVALPEGSVDAARDLARRIAIATEP 537

Query: 534  LVTYKTNKNST----CGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L +    ++ +       L +SDW   T   ++ +C D+   L  LW  E G  LSSLF+
Sbjct: 538  LGSAFIRRDRSGRAFTDKLPLSDWAGRTGRVIEAICADDSNDLAALWSGEAGDKLSSLFA 597

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            +++E+G  + A+  +WIDI   L+ GE++KP+  +   +FI G LE+RL + DT+++GGL
Sbjct: 598  ELMESGDILDADGPQWIDIFAALVAGESIKPRSMRHPRIFIFGALEARLQSVDTVVIGGL 657

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG+WP  TA NPFLSR M++ + L+  E+ IGQ AHDFEMANGTR + YTR+LR+ + P
Sbjct: 658  NEGLWPGQTANNPFLSRSMKTAIGLEPPERRIGQLAHDFEMANGTRQIFYTRALRQGSTP 717

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             +ASRWLQRLL LGG +F + L+KRG+ Y  W   +D +  Q   KRP P PP + QP++
Sbjct: 718  AVASRWLQRLLALGGENFAEQLRKRGETYRHWAGLMDESIDQETAKRPAPKPPADLQPKS 777

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPYA+YARRILKLD +  F +DP+  DRGTL+H II    ++     TP
Sbjct: 778  YSFSEVGRLRRDPYAIYARRILKLDPLDPFNRDPNAADRGTLYHGIIERYSREGHIPGTP 837

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
                 M++I+D  F+ ENLP H+D+IWR  F  ++ +F++ E++   SI + F    A  
Sbjct: 838  ASLEAMQRILDDCFDAENLPVHVDVIWRPRFAAVARAFIDWEKERHPSIRRSFFEARAGQ 897

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             I   GI LTG ADRID+  SG  DI DYKTG  P    A+ L+DPQL+LEAAAL  G+F
Sbjct: 898  EIAEAGIRLTGVADRIDIKTSGQADIIDYKTGLAPSVNQARALLDPQLALEAAALMRGAF 957

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITND-------KKKYSADELSEKSLKNLIEIVTL 1000
             +       NL Y+RL+   +F  D + N+       +   SA EL+ +S+  L + V  
Sbjct: 958  RETGSPTPENLIYVRLRPGDRFFADQVNNEHSNRSGKRPPKSAIELATESIDQLAKFVRS 1017

Query: 1001 LQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            L++GE  F S L   E+ +   EYDHLARV+EW
Sbjct: 1018 LRDGENGFASRLVPEEQQSYGGEYDHLARVSEW 1050


>gi|116249793|ref|YP_765631.1| hypothetical protein RL0027 [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254441|emb|CAK05515.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
            3841]
          Length = 1063

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1053 (44%), Positives = 653/1053 (62%), Gaps = 26/1053 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
             ++P + TI    PF + +   L +G L   FR++  +PL LA VTIY+PT+RA++ LRS
Sbjct: 4    RQQPRILTIPAGLPFLKMLATTLCDGRLTPLFRHEADDPLSLAKVTIYLPTRRAVRVLRS 63

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLL--SYNLNPPVSNIQRLLELARLILIWR 120
            EF+++ G +S ILP+I+ LG+  ++    D +L  + +L  P+SN  RLLELARLIL WR
Sbjct: 64   EFVDLLGGRSAILPVIRPLGETDDDSGYFDEVLPATIDLAQPLSNTARLLELARLILAWR 123

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
            NKLP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  W
Sbjct: 124  NKLPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSELSKLDTGDYAAW 183

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGS 238
            W L A+FL+IAS +W +RL EL  SSP  ++ A++RAEA  L   TK  GPIIIAGSTGS
Sbjct: 184  WQLTAEFLQIASAFWPQRLSELGKSSPARHRNAILRAEASRL-SATKPAGPIIIAGSTGS 242

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +PATA L++ VA+ P G IVLPGLD  +P   W  +  +      +N    +HPQY L+ 
Sbjct: 243  VPATADLIAAVAHLPEGVIVLPGLDLSMPERHWQMVAPEPAPGQHANPASRSHPQYGLSV 302

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN--IQKC 355
            LL  L + R DV  L     ++  R+ ++S++  P + TSD       +N +P   +   
Sbjct: 303  LLKRLKLTRADVTLLDRPEADLERRAEILSRALAPAEATSDW---GAWKNDLPAGALTSA 359

Query: 356  FSDVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGI 411
            FSD++LIEA NEREEA +IAIALR++L+    +++ ++ALIT DRNLARRV  EL+RFGI
Sbjct: 360  FSDISLIEAANEREEATAIAIALRLALERPGQDSESRAALITPDRNLARRVMAELSRFGI 419

Query: 412  NIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
              D SAG PLS     ++L  LL A  +  D +AI +L+KHPLA+FG     L  A  AL
Sbjct: 420  LADDSAGTPLSAMPQGTLLQLLLEAALRPGDPVAIVSLLKHPLARFGLERGALISATEAL 479

Query: 472  ELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCI 531
            EL+ALRG     DI  L+ L+  ++A Q  + H P W+  LS E  + A  L   + Q  
Sbjct: 480  ELLALRGGVAEVDISTLEPLLAHQLAEQALDRHAPQWRKALSPEAADAAYDLARRVAQAT 539

Query: 532  TPLVT----YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSL 587
             PL +    ++          ++S+W + T   L+ V +D    L +LW  E G  L++L
Sbjct: 540  EPLASALMRHRPEDRGRTTRFTLSEWAERTGRSLEAVAVDPQGNLADLWSNEAGDALAAL 599

Query: 588  FSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
              ++I+T   ++A+  +WIDI+  L  G  VKP+      LFI GTLE+RL + DTLILG
Sbjct: 600  LGEVIDTDGQMEADGPQWIDIMAALAAGHAVKPRALSHPRLFIFGTLEARLQSVDTLILG 659

Query: 648  GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENN 707
            GLNEG WP  TA NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ +
Sbjct: 660  GLNEGTWPGQTANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGS 719

Query: 708  IPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP 767
             PT+ASRWLQRLL LGG  F   LK RG  +L W   +D    Q   +RP P PPL  QP
Sbjct: 720  TPTVASRWLQRLLALGGEAFEAELKGRGNRFLQWAALIDRGEAQAPAQRPSPKPPLALQP 779

Query: 768  RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKN 827
            ++YSFSE+ +L  DPYA+YARRIL+LD +  F +DP   +RGTL+H II   I++     
Sbjct: 780  KSYSFSEVGRLRRDPYAIYARRILRLDPVDPFNRDPGAAERGTLYHKIIDRFIREAHIAG 839

Query: 828  TPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA 887
            TP+    M+ ++   F+ E LPPHID +WR  F  ++ +FLE E   +  I K    +  
Sbjct: 840  TPDAAAAMEHVLSELFDMEKLPPHIDAVWRPRFRAVARAFLEWEAGRRHGILKTLTEVRG 899

Query: 888  KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
             M +E I I LTG ADRID+      DI DYKTG NP    A+ L+DPQL+LEAAAL AG
Sbjct: 900  GMELEPINIRLTGVADRIDITGPHSADIIDYKTGYNPSPAQARVLLDPQLALEAAALSAG 959

Query: 948  SFSQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTL 1000
            +F          L Y+RL+   +F++D + N+      K  SA +L+ +S+  L++ V L
Sbjct: 960  AFRDAGSLVPQELLYVRLRPGSRFQVDTVNNESSARSDKAKSAMDLAAESIDQLVKFVGL 1019

Query: 1001 LQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            LQ+ E+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1020 LQSSERGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|190889667|ref|YP_001976209.1| hypothetical protein RHECIAT_CH0000028 [Rhizobium etli CIAT 652]
 gi|190694946|gb|ACE89031.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 1064

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1051 (44%), Positives = 656/1051 (62%), Gaps = 26/1051 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P + TI+   PF + +   L +G L   FR+D  +PL LA VTIY+PT+RA++ LRSEF
Sbjct: 6    QPRILTISAGLPFLKTLATTLCDGRLTPLFRHDVDDPLSLARVTIYLPTRRAVRVLRSEF 65

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  R LELARLIL WRNK
Sbjct: 66   VDLLGGRSAILPVIRPLGETDDDSGYFDEALPATIDLAQPLSNTARQLELARLILAWRNK 125

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  WW 
Sbjct: 126  LPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSELSKLDTGDYAAWWQ 185

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGSIP 240
            L A+FL+IAS +W  RL EL  SSP  ++ A++RAEA  L   TK  GPIIIAGSTGS+P
Sbjct: 186  LTAEFLQIASAFWPARLAELGKSSPARHRNAILRAEAARL-SATKPGGPIIIAGSTGSVP 244

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA L+S VAN   G IVLPGLD  +P   W  +  +      +N    +HPQY L+ LL
Sbjct: 245  ATADLISAVANLREGVIVLPGLDLAMPEEHWQMVAPEPVPGQHANPASRSHPQYGLSSLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN--IQKCFS 357
              L + R DV  L     ++  R+ ++S++  P + TSD     I ++++P   +   F+
Sbjct: 305  KRLRLTRADVSTLDRPDADLDRRAEILSRALAPAEATSDW---GIWKSELPGGALTSAFN 361

Query: 358  DVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINI 413
            DV+LIEA NEREEA +IA+ALR++L+    + + ++ALIT DRNLARRV  EL+RFGI  
Sbjct: 362  DVSLIEAANEREEATAIAVALRLALERPGQDGESRAALITPDRNLARRVMAELSRFGILA 421

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS T   S+L  LL A  +  D +AI +L+KHPLA+FG     L+ A  ALEL
Sbjct: 422  DDSAGTPLSATPQGSLLQLLLEASLRPGDPVAIVSLLKHPLARFGLERNALTFATEALEL 481

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++A Q  + H P W+  L  E  + A  L   + +   P
Sbjct: 482  LALRGGVAEVDIGALEPLLTHQLAEQALDRHAPQWRKALPTEAADAAFELAGRVSRATEP 541

Query: 534  L----VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L    V ++        + ++S+W + T   L+ V  D    L +LW  E G  L+SL  
Sbjct: 542  LAAALVRHRPEDRGKTASFTLSEWAQRTGRALEAVAADPQGNLADLWSNEAGDALASLLG 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++I+T   ++A+  +WIDI   L  G  VKP+      LFI GTLE+RL + DTLILGGL
Sbjct: 602  EVIDTDGQMEADGPQWIDITAALAAGHAVKPRALSHPRLFIFGTLEARLQSVDTLILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  +A NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + P
Sbjct: 662  NEGSWPGQSANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL LGG  F   LK RG  +L W   +D    Q   +RP P PPL  QP++
Sbjct: 722  TVASRWLQRLLALGGEAFEAELKGRGARFLQWAGLVDRGGTQAPAQRPSPKPPLALQPQS 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPYA+YARRIL+LD I  F +DP   +RGTL+H II   I+      TP
Sbjct: 782  YSFSEVGRLRRDPYAIYARRILRLDPIDAFNRDPGAAERGTLYHKIIDRFIRAAHVAGTP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            E    M+ I+   F+ E LPPHID +WR  F +++ +FLE E   + +I +    +   +
Sbjct: 842  EAAAAMELILTELFDMEKLPPHIDAVWRPRFREVARAFLEWEAGRRPAIRRTLTEVRGGV 901

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E+I I L G ADRID+      DI DYKTG NP    A+ L+DPQL+LEAAAL+AG+F
Sbjct: 902  ELETINIRLNGVADRIDITGPNAADIIDYKTGYNPSPAQARALLDPQLALEAAALRAGAF 961

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQ 1002
                     +L Y+RL+   +F++D + N+      K  SA +L+E+S+  L++ V+LLQ
Sbjct: 962  RDAGSLTPQDLLYVRLRPGNRFQVDMVNNENAARSDKAKSAIDLAEESVDQLVKFVSLLQ 1021

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +GE+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1022 SGEKGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|327192795|gb|EGE59723.1| hypothetical protein RHECNPAF_192003 [Rhizobium etli CNPAF512]
          Length = 1064

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1051 (44%), Positives = 656/1051 (62%), Gaps = 26/1051 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P V TI    PF + +   L +G L   FR+D  +PL LA VTIY+PT+RA++ LRSEF
Sbjct: 6    QPRVLTIPAGLPFLKTLATTLCDGRLTPLFRHDVDDPLSLAGVTIYLPTRRAVRVLRSEF 65

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  RLLELARLIL WRNK
Sbjct: 66   VDLLGGRSAILPVIRPLGETDDDSGYFDEALPATIDLAQPLSNTARLLELARLILAWRNK 125

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  WW 
Sbjct: 126  LPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSELSKLDTGDYAAWWQ 185

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGSIP 240
            L A+FL+IAS +W  RL EL  SSP  ++ A++RAEA  L   TK  GPIIIAGSTGS+P
Sbjct: 186  LTAEFLQIASAFWPARLTELGKSSPARHRNAILRAEAARL-SATKPGGPIIIAGSTGSVP 244

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA L+S VAN   G IVLPGLD  +P   W  +  +      +N    +HPQY L+ LL
Sbjct: 245  ATADLISAVANLREGVIVLPGLDLAMPEGHWQMVAPEPVPGQHTNPASRSHPQYGLSSLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN--IQKCFS 357
              L + R DV  L     ++  R+ ++S++  P + TSD     I ++++P   +   F+
Sbjct: 305  KRLRLTRADVSTLDRPEADLDRRAEILSRALAPAEATSDW---GIWKSELPGRALTSAFN 361

Query: 358  DVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINI 413
            DV+LIEA NEREEA +IA+ALR++L+    + + ++ALIT DRNLARRV  EL+RFGI  
Sbjct: 362  DVSLIEAANEREEATAIAVALRLALERPGQDGESRAALITPDRNLARRVMAELSRFGILA 421

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS T   S+L  LL A  +  D +AI +L+KHPLA+FG     L+ A  ALEL
Sbjct: 422  DDSAGTPLSATPQGSLLQLLLEASLRPGDPVAIVSLLKHPLARFGLERNALTFATEALEL 481

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++A Q  + H P W+  L  E  + A  L   + +   P
Sbjct: 482  LALRGGVAEVDIGALEPLLTHQLAEQALDRHAPQWRKALPAEAADAAFELAGRVSRATEP 541

Query: 534  L----VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L    V ++        + ++S+W + T   L+ V  D    L +LW  E G  L+SL  
Sbjct: 542  LAAALVRHRPEDRGKTASFTLSEWAQRTGRALEAVAADPQGNLADLWSNEAGDALASLLG 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++I+T   ++A+  +WIDI   L  G  VKP+      LFI GTLE+RL + DTLILGGL
Sbjct: 602  EVIDTDGQMEADGPQWIDITAALAAGHAVKPRALSHPRLFIFGTLEARLQSVDTLILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  +A NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + P
Sbjct: 662  NEGSWPGQSANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL LGG  F   LK RG  +L W   +D    Q   +RP P PPL  QP++
Sbjct: 722  TVASRWLQRLLALGGEAFEAELKGRGARFLQWAGLVDRGETQAPAQRPSPKPPLALQPQS 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPY +YARRIL+LD +  F +DP   +RGTL+H II   I+      TP
Sbjct: 782  YSFSEVGRLRRDPYTIYARRILRLDPVDAFNRDPGAAERGTLYHKIIDRFIRAAHVAGTP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            E    M+ I+   F+ E LPPHID +WR  F +++ +FLE E   + +I +    +   +
Sbjct: 842  EAAAAMELILTELFDMEKLPPHIDAVWRPRFREVARAFLEWEAGRRPAIRRTLTEVRGGV 901

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E+I I L G ADRID++     DI DYKTG NP    A+ L+DPQL+LEAAAL+AG+F
Sbjct: 902  ELEAINIRLNGVADRIDMIGPNAADIIDYKTGYNPSPAQARALLDPQLALEAAALRAGAF 961

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQ 1002
                     +L Y+RL+   +F++D + N+      K  SA +L+E+S+  L++ V+LLQ
Sbjct: 962  RDAGSLTPQDLLYVRLRPGNRFQVDMVNNENAARSDKAKSAIDLAEESVDQLVKFVSLLQ 1021

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +GE+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1022 SGEKGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|241206970|ref|YP_002978066.1| double-strand break repair protein AddB [Rhizobium leguminosarum bv.
            trifolii WSM1325]
 gi|240860860|gb|ACS58527.1| double-strand break repair protein AddB [Rhizobium leguminosarum bv.
            trifolii WSM1325]
          Length = 1064

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1051 (44%), Positives = 650/1051 (61%), Gaps = 26/1051 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P + TI     F + +   L +G L   FR+D  +PL LA VTIY+PT+RA++ LRSEF
Sbjct: 6    QPRIVTIPAGLSFLKTLATTLCDGRLTPIFRHDADDPLSLAKVTIYLPTRRAVRVLRSEF 65

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  RLLELARLIL WRNK
Sbjct: 66   VDLLGGRSAILPMIRPLGETDDDSGYFDEALPATIDLAQPLSNTARLLELARLILAWRNK 125

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  WW 
Sbjct: 126  LPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSELSKLDTGDYAAWWQ 185

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGSIP 240
            L A+FL+IAS +W ERL EL  SSP  ++ A++RAEA  L   TK  GPIIIAGSTGS+P
Sbjct: 186  LTAEFLQIASAFWPERLAELGKSSPARHRNAILRAEASRL-SATKPAGPIIIAGSTGSVP 244

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA L++ VA+ P G IVLPGLD  +P   W  +  +      +N    +HPQY L+ LL
Sbjct: 245  ATADLIAAVAHLPEGVIVLPGLDLSMPERHWQMVAPEPAPGQHANPASRSHPQYGLSSLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMR--NTDILENKIPNIQKCFS 357
              L + R D+  L     ++  R+ ++S++  P + TSD     TD+    +      FS
Sbjct: 305  KRLKLTRADLTLLDRPEADLERRAEILSQALAPAEATSDWGAWKTDLPAGAL---SSSFS 361

Query: 358  DVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINI 413
            DV+LIEA NEREEA +IAIALR++L+    +++ ++ALIT DRNLARRV  EL+RFGI  
Sbjct: 362  DVSLIEAANEREEATAIAIALRLALERPGQDSESRAALITPDRNLARRVMAELSRFGILA 421

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS     ++L  LL A  +  D +AI +L+KHPLA+FG     L  A  ALEL
Sbjct: 422  DDSAGTPLSAMPQGTLLQLLLEAALRPGDPVAIISLLKHPLARFGLERGALISATEALEL 481

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++A Q  + H P W+  LS E  + A  L   + Q   P
Sbjct: 482  LALRGGVAEVDISTLEPLLAHQLAEQALDRHAPQWRKALSPEAADAAYDLARRVTQATEP 541

Query: 534  LVTY----KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L +     +          ++S+W K T   L+ V +D H  L +LW  E G  L++L  
Sbjct: 542  LASALMRERPEDRGRTARFTLSEWAKRTGRSLEAVAVDPHGNLADLWSNEAGDALAALLG 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++I+T   ++A+  +WIDI+  L  G  VKP+      LFI GTLE+RL + DTLILGGL
Sbjct: 602  EVIDTDGQMEADGPQWIDIMAALAAGHAVKPRALSHPRLFIFGTLEARLQSVDTLILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  TA NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + P
Sbjct: 662  NEGTWPGQTANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL LGG  F   LK RG  +L W   +D    Q   +RP P PPL  QP++
Sbjct: 722  TVASRWLQRLLALGGEAFEAELKGRGNRFLQWAALIDRGDAQAPAQRPSPKPPLALQPKS 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPYA+YARR+L+LD +  F +DP   +RGTL+H II   I++     TP
Sbjct: 782  YSFSEVGRLRRDPYAIYARRVLRLDPVEPFNRDPGAAERGTLYHKIIDRFIREAHIAGTP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +    M+ I+   F+ E LPPHID +WR  F  ++ +FLE E   +  I K    +   M
Sbjct: 842  DAAAAMEAILSELFDMEKLPPHIDAVWRPRFRAVARAFLEWEAGRRHGILKTLTEVRGGM 901

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E I I LTG ADRID+      DI DYKTG NP    A+ L+DPQL+LEAAAL AG+F
Sbjct: 902  ELEPINIRLTGVADRIDVTGPHSADIIDYKTGFNPSPAQARVLLDPQLALEAAALSAGAF 961

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQ 1002
                     +L Y+RL+   +F++D + N+      K  SA +L+ +S+  L++ V LLQ
Sbjct: 962  RDAGSLMPQDLLYVRLRPGSRFQVDTVNNESSARSDKAKSAMDLAAESIDQLVKFVGLLQ 1021

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            + E+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1022 SNERGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|86355695|ref|YP_467587.1| hypothetical protein RHE_CH00027 [Rhizobium etli CFN 42]
 gi|86279797|gb|ABC88860.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 1064

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1051 (44%), Positives = 653/1051 (62%), Gaps = 26/1051 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P + TI    PF + +   L +G L   FR++  +PL LA VTIY+PT+RA++ LRSEF
Sbjct: 6    QPRILTIPAGLPFLKTLATTLCDGRLTPLFRHESDDPLSLARVTIYLPTRRAVRVLRSEF 65

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  RLLELARLIL WRNK
Sbjct: 66   VDLLGGRSAILPVIRPLGETDDDSGYFEEALPATIDLAQPLSNTARLLELARLILAWRNK 125

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  WW 
Sbjct: 126  LPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWTELSKLDTGDYAAWWQ 185

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGSIP 240
            L A+FL+IAS +W ERL EL  SSP  ++ A++RAEA  +   TK  GPIIIAGSTGS+P
Sbjct: 186  LTAEFLQIASAFWPERLSELGKSSPARHRNAILRAEATRI-SATKPAGPIIIAGSTGSVP 244

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            AT  L++ VAN P G IVLPGLD  +P   W  +  +      SN    +HPQY L+ LL
Sbjct: 245  ATTDLIAAVANLPEGVIVLPGLDLSMPERHWQMVAPEPLPGQHSNPASRSHPQYGLSSLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN--IQKCFS 357
              L + R D+  L     ++  R+ ++S++  P + TSD       +  +P   +   F+
Sbjct: 305  KRLRLTRGDISLLDRPEADLNRRAEILSRALAPAEATSDW---GAWKGALPEGALDSAFA 361

Query: 358  DVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINI 413
            DV+LIEA NEREEA +IAIALR++L+    + + ++ALIT DRNLARRV  EL+RFGI  
Sbjct: 362  DVSLIEAANEREEATAIAIALRLALERPGRDGESRAALITPDRNLARRVMAELSRFGILA 421

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS T   ++L  LL A  +  D +AI +L+KHPLA+FG     L  A  ALEL
Sbjct: 422  DDSAGTPLSATPQGTLLQLLLEAALRPGDPVAIVSLLKHPLARFGLERDALISATEALEL 481

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++  Q  + H P W+  L  E    A  L   + +   P
Sbjct: 482  LALRGGVAEVDISALELLLTHQLGEQVLDRHAPQWRKALPAEAANAASELARRVTRATQP 541

Query: 534  L----VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L    V ++  +       ++S+W + T   L+ V  D H  L +LW  E G  L+SL  
Sbjct: 542  LASALVRHRPEERGKTARFTLSEWAERTGRSLEAVAADPHGNLADLWSHEAGDALASLLG 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++I+T   I+A+  +WIDI+  L  G  VKP+      LFI GTLE+RL + DTLILGGL
Sbjct: 602  EVIDTDGQIEADGPQWIDIMAALAAGHAVKPRALNHPRLFIFGTLEARLQSVDTLILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  +A NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + P
Sbjct: 662  NEGSWPGQSANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL LGG  F   L+ RG  YL W   +D    Q   +RP P PPL  QP++
Sbjct: 722  TVASRWLQRLLALGGEAFEAALRGRGNRYLQWAGLIDRGEAQAPAQRPSPKPPLALQPKS 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPYA+YARRIL+LD +  F +DP   +RGTL+H II   I++     TP
Sbjct: 782  YSFSEVGRLRRDPYAIYARRILRLDPVDAFNRDPGAAERGTLYHTIIDRFIREAHVAGTP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            E    M+ I+   F+ E LPPHID +WR  F +++ +FLE E   + +I +    +   +
Sbjct: 842  EAAAAMEWILTELFDMEKLPPHIDAVWRPRFREVARAFLEWEAGRRPAIRRTLTEVRGGV 901

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E+I I L G ADRID+   G  DI DYKTG NP    A+ L+DPQL+LEAAAL AG+F
Sbjct: 902  ELEAINIRLNGVADRIDITGPGAADIIDYKTGYNPSPAQARALLDPQLALEAAALSAGAF 961

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQ 1002
                     +L Y+RL+  ++F++D + N+      K  SA +L+  S+  LI+ V+LLQ
Sbjct: 962  RDAGSLIPQDLLYVRLRPGRRFQVDTVNNENSARSDKAKSAMDLAGDSVDQLIKFVSLLQ 1021

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +GE+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1022 SGEKGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|45505283|gb|AAS67013.1| AddB [Rhizobium etli]
          Length = 1064

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1051 (44%), Positives = 653/1051 (62%), Gaps = 26/1051 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P + TI    PF + +   L +G L   FR++  +PL LA VTIY+PT+RA++ LRSEF
Sbjct: 6    QPRILTIPAGLPFLKTLATTLCDGRLTPLFRHESDDPLSLARVTIYLPTRRAVRVLRSEF 65

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  RLLELARLIL WRNK
Sbjct: 66   VDLLGGRSAILPVIRPLGETDDDSGYFEEALPATIDLAQPLSNTARLLELARLILAWRNK 125

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  WW 
Sbjct: 126  LPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWTELSKLDTGDYAAWWQ 185

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGSIP 240
            L A+FL+IAS +W ERL EL  SSP  ++ A++RAEA  +   TK  GPIIIAGSTGS+P
Sbjct: 186  LTAEFLQIASAFWPERLSELGKSSPARHRNAILRAEATRI-SATKPAGPIIIAGSTGSVP 244

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            AT  L++ VAN P G IVLPGLD  +P   W  +  +      SN    +HPQY L+ LL
Sbjct: 245  ATTDLIAAVANLPEGVIVLPGLDLSMPERHWQMVAPEPLPGQHSNPASRSHPQYGLSSLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN--IQKCFS 357
              L + R D+  L     ++  R+ ++S++  P + TSD       +  +P   +   F+
Sbjct: 305  KRLRLTRGDISLLDRPEADLNRRAEILSRALAPAEATSDW---GAWKGALPEGALDSAFA 361

Query: 358  DVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINI 413
            DV+LIEA NEREEA +IAIALR++L+    + + ++ALIT DRNLARRV  EL+RFGI  
Sbjct: 362  DVSLIEAANEREEATAIAIALRLALERPGRDGESRAALITPDRNLARRVMAELSRFGILA 421

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS T   ++L  LL A  +  D +AI +L+KHPLA+FG     L  A  ALEL
Sbjct: 422  DDSAGTPLSATPQGTLLQLLLEAALRPGDPVAIVSLLKHPLARFGLERDALISATEALEL 481

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +ALRG     DI  L+ L+  ++  Q  + H P W+  L  E    A  L   + +   P
Sbjct: 482  LALRGGVAEVDISALELLLTHQLGEQVLDRHAPQWRKALPAEAANAASELARRVTRATQP 541

Query: 534  L----VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            L    V ++  +       ++S+W + T   L+ V  D H  L +LW  E G  L+SL  
Sbjct: 542  LASALVRHRPEERGKTARFTLSEWAERTGRSLEAVAADPHGNLADLWSHEAGDALASLLG 601

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++I+T   I+A+  +WIDI+  L  G  VKP+      LFI GTLE+RL + DTLILGGL
Sbjct: 602  EVIDTDGQIEADGPQWIDIMAALAAGHAVKPRALNHPRLFIFGTLEARLQSVDTLILGGL 661

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  +A NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + P
Sbjct: 662  NEGSWPGQSANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTP 721

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRWLQRLL LGG  F   L+ RG  YL W   +D    Q   +RP P PPL  QP++
Sbjct: 722  TVASRWLQRLLALGGEAFEAALRGRGNRYLQWAGLIDRGEAQAPAQRPSPKPPLALQPKS 781

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPYA+YARRIL+LD +  F +DP   +RGTL+H II   I++     TP
Sbjct: 782  YSFSEVGRLRRDPYAIYARRILRLDPVDAFNRDPGAAERGTLYHTIIDRFIREAHVAGTP 841

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            E    M+ I+   F+ E LPPHID +WR  F +++ +FLE E   + +I +    +   +
Sbjct: 842  EAAAAMEWILTELFDMEKLPPHIDAVWRPRFREVARAFLEWEAGRRPAIRRTLTEVRGGV 901

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E+I I L G ADRID+   G  DI DYKTG NP    A+ L+DPQL+LEAAAL AG+F
Sbjct: 902  ELEAINIRLNGVADRIDITGPGAADIIDYKTGYNPSPAQARALLDPQLALEAAALSAGAF 961

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQ 1002
                     +L Y+RL+  ++F++D + N+      K  SA +L+  S+  LI+ V+LLQ
Sbjct: 962  RDAGSLIPQDLLYVRLRPGRRFQVDTVNNENSARSDKAKSAMDLAGVSVDQLIKFVSLLQ 1021

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +GE+ F S L  +++ +   +YDHLARV+EW
Sbjct: 1022 SGEKGFTSRLIPAQQFDFGGDYDHLARVSEW 1052


>gi|227823894|ref|YP_002827867.1| double-strand break repair protein AddB [Sinorhizobium fredii NGR234]
 gi|227342896|gb|ACP27114.1| double-strand break repair protein AddB [Sinorhizobium fredii NGR234]
          Length = 1059

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1050 (43%), Positives = 651/1050 (62%), Gaps = 19/1050 (1%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M  +  NVFTI    PF + +   LL G L  +F+Y+  +PL LA VTI+VPT+RA + L
Sbjct: 1    MPGRASNVFTIPAGLPFLKTLAEKLLGGVLTPDFQYESADPLALAGVTIFVPTRRAARVL 60

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILI 118
            RSEF+++ G +S ILP+I+ LG+  ++   F A++    +L PP+S  QRL+EL RLIL 
Sbjct: 61   RSEFVDLLGGRSAILPVIRPLGETDDDSGFFDAEMPAILDLAPPLSGTQRLIELGRLILA 120

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            WRN+LP ++ D++ ESPL  P SPA+AIWLA+NLA++ID IETEE  W+ L  L   ++ 
Sbjct: 121  WRNRLPQVVLDIHAESPLIAPASPADAIWLARNLAELIDAIETEELDWDALDGLDGGEHA 180

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKGPIIIAGSTG 237
            +WW L   FLKIA  YW ERL EL  SSP  ++ A+++AE + +  G   GPIIIAGSTG
Sbjct: 181  LWWQLTLAFLKIARIYWPERLDELKHSSPARHRNAMLKAETQRIAAGKVSGPIIIAGSTG 240

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS-THPQYSL 296
            SIPATA L++ V   PNG IVLPGLD  +    W  I E + +   +    S THPQY  
Sbjct: 241  SIPATAALIAAVKTLPNGTIVLPGLDLVMSETEWELIAEVAASGPPARGPASRTHPQYGF 300

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
             + L  + I+R DV  LG++ +++  R  V+S++ LP + +D         +   +   F
Sbjct: 301  HRFLKRMRIERLDVPVLGSLDDDLGYRGAVLSRALLPAEATDGWTEARGGFEPEKLLAAF 360

Query: 357  SDVALIEADNEREEAISIAIALRMSLD-ENKKKSALITADRNLARRVKLELTRFGINIDI 415
            +DVALIEA NEREEA +IAIALR++L+ + + ++ALIT DR LARRV  EL RFGI  D 
Sbjct: 361  ADVALIEAANEREEAAAIAIALRLALEGDEESQAALITPDRGLARRVGAELARFGIEADD 420

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            SAG+PLS T   ++   L+ A  + +D +A+  L+KHPLA+FG       RA + LEL+A
Sbjct: 421  SAGVPLSATSAGALARLLIEATLRPDDPVALVALLKHPLARFGQTAVDTRRAADVLELLA 480

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            LRG  +  DI  L++++   +A Q+   H   W+  + + D   A  L   I   + PL 
Sbjct: 481  LRGGTDLSDISGLEAVLDKALARQRTERHPRPWRRGIDQGDIARARALAGRISTAVEPLT 540

Query: 536  TYKTNKNSTCGN------LSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            +  TN   + G       L+++DW + T   L+ V +DE   L  LW  E G+ L++L  
Sbjct: 541  S--TNAGGSEGGRHHSMVLTLADWAERTGRALEAVAIDERGSLGELWGSEAGEALATLLR 598

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
             IIET   ++A+  +W DI+  L   E VKP+  +   +FI G LESRL + D ++LGGL
Sbjct: 599  SIIETDGQMEADGRQWCDIVVALAASEAVKPRSMRHPRVFIFGALESRLQSVDLVVLGGL 658

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP  T+ +PFLSR M+S + L+  E+ IGQ AHDF+MA GTR LI +RS+R+ + P
Sbjct: 659  NEGTWPGQTSNDPFLSRTMKSGIGLEPPERRIGQLAHDFQMACGTRRLILSRSMRQGSAP 718

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASRW+QRL  LGG    + LK  G  YL W R LD   +QP  +RP+P PP+E QPR 
Sbjct: 719  TVASRWVQRLQALGGKTLTEQLKANGASYLHWMRILDGGERQPLSERPQPKPPVELQPRK 778

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YSFSE+ +L  DPY++YARRIL+L+ I  F +DP   +RG L+H I+   +K   +  + 
Sbjct: 779  YSFSEVTKLRRDPYSIYARRILRLEPIDSFNRDPGAAERGLLYHRIVDRFVKGGFDPASG 838

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +    M ++I   F++E LP HID IWR  F  ++ +FL  E + + +I + F   PA M
Sbjct: 839  DGEEAMVRLIREAFDEEQLPAHIDTIWRPRFEAVARAFLSWERERRHTIVRSFTEAPAAM 898

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +    I LTG ADR+D L +G VDI DYKTG +P  + A+ L+DPQL+LEAAALKAG+F
Sbjct: 899  DVGVSDIRLTGIADRLDRLANGTVDIIDYKTGSSPSAKEARALLDPQLALEAAALKAGAF 958

Query: 950  SQIDCRKVANLFYIRLK--QKFKIDCITNDKKKY----SADELSEKSLKNLIEIVTLLQN 1003
              I   +   L Y+RLK   +F +D + N+  K     +A++L+E+SL  L +++  L +
Sbjct: 959  GTIGPARPHALRYVRLKPGSRFAVDTVNNENSKSRETKTAEQLAEESLAELRKLLAALTS 1018

Query: 1004 GEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            G+  F S L + ++ +   EYDHLARVAEW
Sbjct: 1019 GKYGFASRLIVQKERDYGGEYDHLARVAEW 1048


>gi|163757507|ref|ZP_02164596.1| hypothetical protein HPDFL43_18892 [Hoeflea phototrophica DFL-43]
 gi|162285009|gb|EDQ35291.1| hypothetical protein HPDFL43_18892 [Hoeflea phototrophica DFL-43]
          Length = 1068

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1067 (36%), Positives = 587/1067 (55%), Gaps = 36/1067 (3%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M    P++ TI P +PF   ++  +  G L++   Y P +PL LA  TI+VPT+RA + L
Sbjct: 1    MTRSAPHIVTIPPGAPFLSVLVEKIHGGGLIDGLAYRPEDPLSLARATIFVPTRRAARAL 60

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILI 118
            RSE  +  G  S ILP I+ LG+  E+   F +    + +L+P +      L LA L+L 
Sbjct: 61   RSELTDRIGVGSAILPSIRPLGETDEDAGFFDSADPATLSLDPAIPQTAATLRLADLVLA 120

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            W+  LP  + D    +PL  P +PA+AIWL ++L D+I  +ETEE  +  L  + +E   
Sbjct: 121  WKKALPRAVLDHLGGAPLVAPANPADAIWLGRSLFDLIQAVETEECDFAGLDQVVSEDLQ 180

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTG 237
             WW L  +FL IA +YW   L E++ SSP G+  A++      L    +  P+I+AGSTG
Sbjct: 181  QWWQLTREFLAIAREYWPALLTEISRSSPAGHHNAMIDVFTRALTTDPEDRPVIVAGSTG 240

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTT-------YST 290
            + P+TARL++ +A+ P GA+VLPGLD  +  + W  +  KS ++T+   T         +
Sbjct: 241  TRPSTARLIAAIAHLPRGAVVLPGLDHAMGLSHWQDLA-KSVSVTAPPGTPVSFDPAARS 299

Query: 291  HPQYSLAKLLDFLDIKREDVKRLGNV------SNEMYGRSMVISKSFLPPDTSDMRNTDI 344
            HPQY L +LL+   +   D+  LG++         M  R   +S + LP  T++      
Sbjct: 300  HPQYGLLRLLESCGV---DIASLGDIPEIAMLEGAMEVRRAAVSAALLPAGTTEAWGEPG 356

Query: 345  LENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKS----ALITADRNLAR 400
                   + + F+ V+LIEA NEREEA ++A A+R +L+   K +    AL+T DRNLAR
Sbjct: 357  FLPDASALSQAFASVSLIEAANEREEAAALAAAMRQALEPGSKSAEPVVALVTPDRNLAR 416

Query: 401  RVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFP 460
            RV +EL R+GI  + S GIPL ++    ++   +   F   D +AI  L+KHPLA+FG  
Sbjct: 417  RVVVELQRYGIEANDSGGIPLMSSPQGGLVRLAVQVAFAPGDAVAITALIKHPLARFGLD 476

Query: 461  EKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELA 520
            ++   +    +E +ALRG     D+  L++LV +R   +K   H   W +R+S++D E A
Sbjct: 477  QQSAQQLAGIVERIALRGGSGEADVDQLETLVAERSEARKK-PHAARWLTRISDQDAEAA 535

Query: 521  VLLVDHILQCITPLVT--YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFE 578
                  +   ++PL +   +         + I     LT   L+ +C DE   L  LW +
Sbjct: 536  RDFAARVADALSPLTSILVEAPGQRFSNAVDIGGLAGLTAETLEKICSDETGSLEPLWGD 595

Query: 579  EEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRL 638
            E G+ LS++  +  ++GS +     EWI  +  LI G  VKP+       FI G LE+RL
Sbjct: 596  EAGEVLSNILLETRDSGSTLTITGHEWIGALDALISGRMVKPRTGGHPRAFIWGALEARL 655

Query: 639  LNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLI 698
             + DT++LG LNEGVWP+   ++PFLSR M++ + L+  E+ IGQAAHDF+MA G   ++
Sbjct: 656  QHVDTILLGALNEGVWPQAGQEDPFLSRSMKAAMGLEPPERRIGQAAHDFQMAMGAPQVV 715

Query: 699  YTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPK 758
             +R+ R    PT+ASRWLQRLL + G+D    L+ RG   LD  R LD  T      RP+
Sbjct: 716  LSRANRSGKAPTVASRWLQRLLAVAGSDTATALRHRGDALLDHVRSLDQATPVSPAIRPE 775

Query: 759  PFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITE 818
            P PP + QP++YSFSE+  L  DPYA+YARR+L+LD +  F  DP   +RGTL+H I+ +
Sbjct: 776  PKPPAQMQPQSYSFSEVATLRRDPYAIYARRVLRLDPLEPFLTDPGPRERGTLYHAILEQ 835

Query: 819  LIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSI 878
             I  R   +       +++I  +HF    LP    +IW+  F K + +    E  I S  
Sbjct: 836  FIASRAPGD--RTLEALREIAAAHFLDAELPDATALIWQSRFDKAAAAIAGWEAGIASGH 893

Query: 879  EKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLS 938
             +  V   A + +   GI LTG ADRIDL   G   I DYKTG  P ++ A+ L+DPQL+
Sbjct: 894  GRSVVEARASLEMPLAGIRLTGMADRIDLRADGTAWIIDYKTGGTPSRKQARTLLDPQLA 953

Query: 939  LEAAALKAGSFSQIDCRKVANLFYIRLKQKFKI-DCITNDKKK------YSADELSEKSL 991
            LEA AL+ G F+ +     + L Y+RL  K    + + ND +K       + DEL++K+ 
Sbjct: 954  LEAHALRQGGFADLGALPASALLYLRLTGKDPFAERVDNDPEKPGRDEFLNPDELAQKAA 1013

Query: 992  KNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
              L  +VTLL++G++ F+S        +   +YDHLARVAEW+   D
Sbjct: 1014 DELTWLVTLLRSGKRGFLSRAIPKSVRDFAGDYDHLARVAEWQTVVD 1060


>gi|153008154|ref|YP_001369369.1| double-strand break repair protein AddB [Ochrobactrum anthropi ATCC
            49188]
 gi|151560042|gb|ABS13540.1| Double-strand break repair protein AddB [Ochrobactrum anthropi ATCC
            49188]
          Length = 1052

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1046 (36%), Positives = 586/1046 (56%), Gaps = 26/1046 (2%)

Query: 2    HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
             + K  +F+I P +PF      ALL G LVE F  +P +PL LA+ TIYVPT+RA + LR
Sbjct: 7    RDGKQRLFSIPPGTPFLPAFAKALLEGRLVEGFPGNPSDPLALANATIYVPTRRAARALR 66

Query: 62   SEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            S  ++    KS ILP IK LGDV E+   F A     +++NPP+   +RLL LARLI  W
Sbjct: 67   SILVDRNSTKSAILPTIKPLGDVDEDAAFFNAGSSGVFDINPPIGTAERLLLLARLIRPW 126

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            R  LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW +L  +  E    
Sbjct: 127  RESLPSHVRALFGVDDVSVPATTADAIWLARDLAGLMDQVETDGAKWSELAGIAPEDLAD 186

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGS 238
            WW +   FL I +  W + L E   S+P  ++  L+ +E + L      GP+I+AGSTGS
Sbjct: 187  WWQVTLGFLNIVTNLWPDILAERRLSNPAAHRNDLIWSEVKRLRAHPPAGPVIVAGSTGS 246

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            IPATA L+S +A+ PNGA+VLPGLD  +  A W  +   + N ++       HPQ+ L K
Sbjct: 247  IPATAELISAIADLPNGAVVLPGLDRDLDDAAWQMLASATDNPSTFG-----HPQFGLRK 301

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDM-----RNTDILENKIPNIQ 353
            LLD +   R DV+ L ++      R  V+S++  P +T+D      R+ D+    +   +
Sbjct: 302  LLDAMQTLRADVEHLDDMPASKRLRERVVSEALRPAETTDAWGQLARDPDMQPTAL---R 358

Query: 354  KCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINI 413
            +    + LIE  NEREEA+++A+ LR ++++  K +AL+TADRNLARRV  EL RFGI+ 
Sbjct: 359  QAAQTIDLIETANEREEALTVALVLRDAINDEGKTAALVTADRNLARRVVGELARFGIDA 418

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D S G  L     +++L  L+  +F   D +A+  LVKHPL +   P      A   LEL
Sbjct: 419  DDSGGRHLRDVETTTLLRLLVETVFNPGDPVALLALVKHPLLRLEAPRIERRLAAETLEL 478

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            +A RG      ++DL +    R+         P W   ++ +    A  L + +   + P
Sbjct: 479  IAFRGGTGRASVLDLPAFFDRRLEESAGQPWQPAWHDTVTPDMIAAARNLCESLSNAMAP 538

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
            LV +      T     I +  + TV  L+N+  +E   +   +  E G+ L++    ++ 
Sbjct: 539  LVPFVIAGRRT----EIGEIARATVEALENLARNEKASIAPFYSGERGEQLATFLRGLVS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A EW  ++  L+ GETVKP       LFI G LE+RL   DT+++GGLNEG 
Sbjct: 595  SEAGLDFEASEWPAVLDALMAGETVKPHPGGHPRLFIWGALEARLQTMDTVVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M+S + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPARTRNDPFMSRPMKSMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D    ++KRG  ++ W+R++D     P  KRP+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTAEMRKRGVRFIQWSREIDQAPDVPFVKRPQPAPPVLARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    ++ I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQEAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL  E +   +++  F  I + K  +E
Sbjct: 835  RLMELGRVLFADMDLPTEIEAVWWPRFTALIPQFLAWERERAYNVQTRFAEISSDKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
             +GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F ++
Sbjct: 895  GLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLVRGAFREL 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               + ++L Y+RLK   ++       I     + +A  L E+S + L +++   Q  E+ 
Sbjct: 955  GSVRASDLTYVRLKAGGEVKPESILKIGRPPSEKTAPALGEESWQRLAQLLVEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|306843519|ref|ZP_07476120.1| double-strand break repair protein AddB [Brucella sp. BO1]
 gi|306276210|gb|EFM57910.1| double-strand break repair protein AddB [Brucella sp. BO1]
          Length = 1052

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1046 (36%), Positives = 596/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LRS
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRS 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGIFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + LVE   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILVERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDDAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV+ L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVEVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGARFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKGGGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|13474240|ref|NP_105808.1| hypothetical protein mll5084 [Mesorhizobium loti MAFF303099]
 gi|14024992|dbj|BAB51594.1| mll5084 [Mesorhizobium loti MAFF303099]
          Length = 1044

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/1038 (36%), Positives = 585/1038 (56%), Gaps = 23/1038 (2%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF+I P +PF   +  ALL G LV  FR+D  +PL LA VTIYVPT+RA + LR  F++
Sbjct: 6    RVFSIPPGAPFLPTLAEALLAGRLVPGFRFDG-DPLALADVTIYVPTRRAARALRGVFVD 64

Query: 67   I----TGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
                  G  S ILP+I+ LG+  E++  F A+   + +L PP+S  +RLL L  L+  W+
Sbjct: 65   SLKGRGGGGSAILPVIRPLGEFDEDEALFDAEPSAAIDLAPPISATERLLLLTSLVRAWK 124

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
             +LP+ +  L+ E  + +P S A+AIWLA++LA ++D IETE   W  L  L       W
Sbjct: 125  RRLPEHVAKLFAEE-IVIPASTADAIWLARDLAGLMDEIETEGTDWTKLADLVTGNLAGW 183

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSI 239
            W +  +FL I +  W + L E + S+P  ++ AL+RAEA  L +    GP+I AGSTGSI
Sbjct: 184  WQVTLEFLGIVTDAWPKFLSESDRSNPAAHRSALIRAEAARLRRNPPAGPVIAAGSTGSI 243

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L++ ++  P GAIVLPGLD  +  A +  +         +      HPQY LA+L
Sbjct: 244  PATAELLAVISRLPGGAIVLPGLDRTLDEASFQALVAPG-----ARPAVLGHPQYGLARL 298

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDV 359
            +  + + R DV+ +G    ++  R+ ++ ++  P +T+++           +I   F +V
Sbjct: 299  IGKIGVLRSDVEEVGAAEPQLALRAALVGEALRPAETTELWAETRSGFSASDIAGAFGEV 358

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
             L+EA +ER+EA++IA+AL+ ++++  +++AL+T DR LARRV +EL RFG+  D S G 
Sbjct: 359  TLLEAASERDEAVAIAVALKQAVEQPGQRAALVTGDRALARRVAVELKRFGVVADDSGGT 418

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
            PL+ +  +S+L   L A+F+  D + + +L+KHPL   G     +  A   +ELVALRG 
Sbjct: 419  PLANSPAASLLRLALEAVFRPGDPVGLLSLLKHPLLGLGLERAAVRHAAELVELVALRGG 478

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
                DI+ L  L  +R+    +++  P W SRL+    E A  L+  + + + PL  ++ 
Sbjct: 479  TGRPDIVSLPELFENRLIGLGDDSRPPFWFSRLTVRSIEDARSLLARLTEALAPLSAFRG 538

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK 599
            + N+    L      + +V  L+N+       L  L+  + G+ L+ L   ++   + + 
Sbjct: 539  HANADLAAL-----VQASVVALENLGRSADGGLAELYAGDAGEKLAELLRGLVAASASLS 593

Query: 600  ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTA 659
              A EW D++  LI  ETVKP       + I G LE+RL + D L++GGLNEGVWP+   
Sbjct: 594  FAASEWPDVMDALIAPETVKPAQGTDRNIAIWGALEARLQDVDMLVIGGLNEGVWPRKPE 653

Query: 660  KNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRL 719
             + F+SR+M++ ++L+  E+ IG AAHDF+MA G RH++  RS R  + P + SRWLQRL
Sbjct: 654  SDRFMSRLMKTGIDLEPPERRIGLAAHDFQMAMGARHVVLARSARSGDAPAVPSRWLQRL 713

Query: 720  LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLI 779
            L   G D    L++RG   L W R+LD   KQ    RP+P PPL  +P  +S +EI+ L 
Sbjct: 714  LTFIGNDQAATLRRRGDELLAWARELDTGAKQDFAPRPQPKPPLAVRPTHFSVTEIESLR 773

Query: 780  NDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQII 839
             DPYAVYARRIL L  +    +DP   +RGTLFH I+     +  +   P+    +    
Sbjct: 774  RDPYAVYARRILGLMPLDALIRDPGAAERGTLFHAILHLFSSEVADPRAPDALAGLIAAG 833

Query: 840  DSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIESIGIHL 898
             + F +  LP  ++ +W   F K++ + +E E     ++ +      A K  +   G+ L
Sbjct: 834  RACFVEAALPADVEAVWWPRFEKLAANIVEWERTRADAVTRRHAEERAGKTLVGQSGVTL 893

Query: 899  TGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVA 958
            +G+ADR+DLL  G  DI DYKTG +P K  A  L+ PQL+LE A L+ G+F  +  R+ +
Sbjct: 894  SGYADRVDLLAGGMADILDYKTGSSPSKAQAHTLLAPQLALEGALLRRGAFKDLGAREPS 953

Query: 959  NLFYIRLK---QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLS 1015
             L +IRLK   + F+   + ++++  +A +L+E++   L +++    + +  ++S     
Sbjct: 954  QLAFIRLKPNGEVFEESILEHNRQPRTAADLAEEAWARLEKLLIHYTDPQTGYLSRALPF 1013

Query: 1016 EKSNIQSEYDHLARVAEW 1033
             +     +YDHLARV EW
Sbjct: 1014 REGETDGDYDHLARVLEW 1031


>gi|254718139|ref|ZP_05179950.1| hypothetical protein Bru83_01086 [Brucella sp. 83/13]
 gi|265983092|ref|ZP_06095827.1| double-strand break repair protein AddB [Brucella sp. 83/13]
 gi|306837653|ref|ZP_07470522.1| double-strand break repair protein AddB [Brucella sp. NF 2653]
 gi|264661684|gb|EEZ31945.1| double-strand break repair protein AddB [Brucella sp. 83/13]
 gi|306407211|gb|EFM63421.1| double-strand break repair protein AddB [Brucella sp. NF 2653]
          Length = 1052

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LRS
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRS 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGMDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGARFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLTELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKGGGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|306842787|ref|ZP_07475428.1| double-strand break repair protein AddB [Brucella sp. BO2]
 gi|306287060|gb|EFM58568.1| double-strand break repair protein AddB [Brucella sp. BO2]
          Length = 1052

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LRS
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRS 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDDAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGARFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKGGGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|237816449|ref|ZP_04595442.1| double-strand break repair protein AddB [Brucella abortus str. 2308
            A]
 gi|237788516|gb|EEP62731.1| double-strand break repair protein AddB [Brucella abortus str. 2308
            A]
          Length = 1058

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 14   DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 73

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 74   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 133

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 134  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 193

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 194  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRNHPPAGPVIAAGSTGSI 253

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 254  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 308

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 309  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 365

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 366  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 425

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 426  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 485

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 486  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 545

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 546  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 600

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 601  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 660

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 661  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 720

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 721  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 780

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 781  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 840

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 841  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 900

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 901  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 960

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 961  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1020

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1021 YLSRALPFRETDLTGDYDHLARVLEW 1046


>gi|148559179|ref|YP_001259903.1| double-strand break repair protein AddB [Brucella ovis ATCC 25840]
 gi|148370436|gb|ABQ60415.1| double-strand break repair protein AddB [Brucella ovis ATCC 25840]
          Length = 1052

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVVAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDVIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|254694723|ref|ZP_05156551.1| hypothetical protein Babob3T_08698 [Brucella abortus bv. 3 str.
            Tulya]
          Length = 1058

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 593/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 14   DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 73

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 74   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 133

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 134  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 193

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 194  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 253

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 254  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 308

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 309  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 365

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 366  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 425

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L   +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 426  DSGGRHLRDVETATLLRLLAETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 485

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 486  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 545

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 546  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 600

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 601  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 660

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 661  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 720

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 721  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 780

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 781  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 840

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 841  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 900

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 901  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 960

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 961  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1020

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1021 YLSRALPFRETDLTGDYDHLARVLEW 1046


>gi|294851329|ref|ZP_06792002.1| double-strand break repair protein AddB [Brucella sp. NVSL 07-0026]
 gi|294819918|gb|EFG36917.1| double-strand break repair protein AddB [Brucella sp. NVSL 07-0026]
          Length = 1052

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG     DI+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRADILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+  
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPL 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|256060065|ref|ZP_05450247.1| hypothetical protein Bneo5_06871 [Brucella neotomae 5K33]
 gi|261324042|ref|ZP_05963239.1| double-strand break repair protein AddB [Brucella neotomae 5K33]
 gi|261300022|gb|EEY03519.1| double-strand break repair protein AddB [Brucella neotomae 5K33]
          Length = 1052

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDHDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGRFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|254707380|ref|ZP_05169208.1| hypothetical protein BpinM_10505 [Brucella pinnipedialis M163/99/10]
 gi|254709078|ref|ZP_05170889.1| hypothetical protein BpinB_02192 [Brucella pinnipedialis B2/94]
 gi|254713495|ref|ZP_05175306.1| hypothetical protein BcetM6_09104 [Brucella ceti M644/93/1]
 gi|254716149|ref|ZP_05177960.1| hypothetical protein BcetM_06896 [Brucella ceti M13/05/1]
 gi|256030603|ref|ZP_05444217.1| hypothetical protein BpinM2_08117 [Brucella pinnipedialis M292/94/1]
 gi|256158599|ref|ZP_05456489.1| hypothetical protein BcetM4_07036 [Brucella ceti M490/95/1]
 gi|256254010|ref|ZP_05459546.1| hypothetical protein BcetB_06878 [Brucella ceti B1/94]
 gi|261217922|ref|ZP_05932203.1| double-strand break repair protein AddB [Brucella ceti M13/05/1]
 gi|261221151|ref|ZP_05935432.1| double-strand break repair protein AddB [Brucella ceti B1/94]
 gi|261314863|ref|ZP_05954060.1| double-strand break repair protein AddB [Brucella pinnipedialis
            M163/99/10]
 gi|261316579|ref|ZP_05955776.1| double-strand break repair protein AddB [Brucella pinnipedialis
            B2/94]
 gi|261321228|ref|ZP_05960425.1| double-strand break repair protein AddB [Brucella ceti M644/93/1]
 gi|265987651|ref|ZP_06100208.1| double-strand break repair protein AddB [Brucella pinnipedialis
            M292/94/1]
 gi|265997111|ref|ZP_06109668.1| double-strand break repair protein AddB [Brucella ceti M490/95/1]
 gi|260919735|gb|EEX86388.1| double-strand break repair protein AddB [Brucella ceti B1/94]
 gi|260923011|gb|EEX89579.1| double-strand break repair protein AddB [Brucella ceti M13/05/1]
 gi|261293918|gb|EEX97414.1| double-strand break repair protein AddB [Brucella ceti M644/93/1]
 gi|261295802|gb|EEX99298.1| double-strand break repair protein AddB [Brucella pinnipedialis
            B2/94]
 gi|261303889|gb|EEY07386.1| double-strand break repair protein AddB [Brucella pinnipedialis
            M163/99/10]
 gi|262551579|gb|EEZ07569.1| double-strand break repair protein AddB [Brucella ceti M490/95/1]
 gi|264659848|gb|EEZ30109.1| double-strand break repair protein AddB [Brucella pinnipedialis
            M292/94/1]
          Length = 1052

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEVLENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|23502950|ref|NP_699077.1| hypothetical protein BR2102 [Brucella suis 1330]
 gi|254700732|ref|ZP_05162560.1| hypothetical protein Bsuib55_07727 [Brucella suis bv. 5 str. 513]
 gi|256370500|ref|YP_003108011.1| double-strand break repair protein AddB [Brucella microti CCM 4915]
 gi|261751244|ref|ZP_05994953.1| double-strand break repair protein AddB [Brucella suis bv. 5 str.
            513]
 gi|23348985|gb|AAN30992.1| conserved hypothetical protein [Brucella suis 1330]
 gi|256000663|gb|ACU49062.1| double-strand break repair protein AddB [Brucella microti CCM 4915]
 gi|261740997|gb|EEY28923.1| double-strand break repair protein AddB [Brucella suis bv. 5 str.
            513]
          Length = 1052

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|62290944|ref|YP_222737.1| hypothetical protein BruAb1_2077 [Brucella abortus bv. 1 str. 9-941]
 gi|82700855|ref|YP_415429.1| hypothetical protein BAB1_2104 [Brucella melitensis biovar Abortus
            2308]
 gi|189025156|ref|YP_001935924.1| hypothetical protein BAbS19_I19680 [Brucella abortus S19]
 gi|254690235|ref|ZP_05153489.1| hypothetical protein Babob68_08702 [Brucella abortus bv. 6 str. 870]
 gi|254696351|ref|ZP_05158179.1| hypothetical protein Babob28_01193 [Brucella abortus bv. 2 str.
            86/8/59]
 gi|254731266|ref|ZP_05189844.1| hypothetical protein Babob42_08720 [Brucella abortus bv. 4 str. 292]
 gi|256258488|ref|ZP_05464024.1| hypothetical protein Babob9C_14307 [Brucella abortus bv. 9 str. C68]
 gi|260546207|ref|ZP_05821947.1| double-strand break repair protein AddB [Brucella abortus NCTC 8038]
 gi|260755776|ref|ZP_05868124.1| double-strand break repair protein AddB [Brucella abortus bv. 6 str.
            870]
 gi|260758999|ref|ZP_05871347.1| double-strand break repair protein AddB [Brucella abortus bv. 4 str.
            292]
 gi|260760723|ref|ZP_05873066.1| double-strand break repair protein AddB [Brucella abortus bv. 2 str.
            86/8/59]
 gi|260884800|ref|ZP_05896414.1| double-strand break repair protein AddB [Brucella abortus bv. 9 str.
            C68]
 gi|297247329|ref|ZP_06931047.1| double-strand break repair protein AddB [Brucella abortus bv. 5 str.
            B3196]
 gi|62197076|gb|AAX75376.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616956|emb|CAJ12060.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
            2308]
 gi|189020728|gb|ACD73450.1| hypothetical protein BAbS19_I19680 [Brucella abortus S19]
 gi|260096314|gb|EEW80190.1| double-strand break repair protein AddB [Brucella abortus NCTC 8038]
 gi|260669317|gb|EEX56257.1| double-strand break repair protein AddB [Brucella abortus bv. 4 str.
            292]
 gi|260671155|gb|EEX57976.1| double-strand break repair protein AddB [Brucella abortus bv. 2 str.
            86/8/59]
 gi|260675884|gb|EEX62705.1| double-strand break repair protein AddB [Brucella abortus bv. 6 str.
            870]
 gi|260874328|gb|EEX81397.1| double-strand break repair protein AddB [Brucella abortus bv. 9 str.
            C68]
 gi|297174498|gb|EFH33845.1| double-strand break repair protein AddB [Brucella abortus bv. 5 str.
            B3196]
          Length = 1052

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRNHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|161620014|ref|YP_001593901.1| double-strand break repair protein AddB [Brucella canis ATCC 23365]
 gi|161336825|gb|ABX63130.1| double-strand break repair protein AddB [Brucella canis ATCC 23365]
          Length = 1052

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  I  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDIDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  D+   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDDTGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGIDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|261215052|ref|ZP_05929333.1| double-strand break repair protein AddB [Brucella abortus bv. 3 str.
            Tulya]
 gi|260916659|gb|EEX83520.1| double-strand break repair protein AddB [Brucella abortus bv. 3 str.
            Tulya]
          Length = 1052

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1046 (36%), Positives = 593/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L   +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLAETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|260567426|ref|ZP_05837896.1| double-strand break repair protein AddB [Brucella suis bv. 4 str. 40]
 gi|260156944|gb|EEW92024.1| double-strand break repair protein AddB [Brucella suis bv. 4 str. 40]
          Length = 1052

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  D+   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDDTGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGIDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|254705104|ref|ZP_05166932.1| hypothetical protein Bsuib36_14511 [Brucella suis bv. 3 str. 686]
 gi|261755809|ref|ZP_05999518.1| double-strand break repair protein AddB [Brucella suis bv. 3 str.
            686]
 gi|261745562|gb|EEY33488.1| double-strand break repair protein AddB [Brucella suis bv. 3 str.
            686]
          Length = 1052

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  D+   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMVRDDTGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|260169509|ref|ZP_05756320.1| double-strand break repair protein AddB [Brucella sp. F5/99]
 gi|261759037|ref|ZP_06002746.1| double-strand break repair protein AddB [Brucella sp. F5/99]
 gi|261739021|gb|EEY27017.1| double-strand break repair protein AddB [Brucella sp. F5/99]
          Length = 1052

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ +
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAN 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEVLENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|17988307|ref|NP_540941.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|256045705|ref|ZP_05448583.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112425|ref|ZP_05453346.1| putative cytoplasmic protein [Brucella melitensis bv. 3 str. Ether]
 gi|260563007|ref|ZP_05833493.1| double-strand break repair protein AddB [Brucella melitensis bv. 1
            str. 16M]
 gi|265992126|ref|ZP_06104683.1| double-strand break repair protein AddB [Brucella melitensis bv. 1
            str. Rev.1]
 gi|265993863|ref|ZP_06106420.1| double-strand break repair protein AddB [Brucella melitensis bv. 3
            str. Ether]
 gi|17984080|gb|AAL53205.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153023|gb|EEW88115.1| double-strand break repair protein AddB [Brucella melitensis bv. 1
            str. 16M]
 gi|262764844|gb|EEZ10765.1| double-strand break repair protein AddB [Brucella melitensis bv. 3
            str. Ether]
 gi|263003192|gb|EEZ15485.1| double-strand break repair protein AddB [Brucella melitensis bv. 1
            str. Rev.1]
          Length = 1052

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1046 (36%), Positives = 594/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA +++ +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMNQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|163844119|ref|YP_001628523.1| double-strand break repair protein AddB [Brucella suis ATCC 23445]
 gi|163674842|gb|ABY38953.1| double-strand break repair protein AddB [Brucella suis ATCC 23445]
          Length = 1052

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1046 (36%), Positives = 593/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA ++D +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMDQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            P TA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PVTAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   + +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGNPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L + +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCESLSVAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   +LP  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDLPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|225853530|ref|YP_002733763.1| double-strand break repair protein AddB [Brucella melitensis ATCC
            23457]
 gi|256262986|ref|ZP_05465518.1| double-strand break repair protein AddB [Brucella melitensis bv. 2
            str. 63/9]
 gi|225641895|gb|ACO01809.1| double-strand break repair protein AddB [Brucella melitensis ATCC
            23457]
 gi|263092859|gb|EEZ17034.1| double-strand break repair protein AddB [Brucella melitensis bv. 2
            str. 63/9]
 gi|326410099|gb|ADZ67164.1| double-strand break repair protein AddB [Brucella melitensis M28]
 gi|326539816|gb|ADZ88031.1| double-strand break repair protein AddB [Brucella melitensis M5-90]
          Length = 1052

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1046 (36%), Positives = 592/1046 (56%), Gaps = 28/1046 (2%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + K  +F+I P  PF      AL+ G L+E F   P +PL LAS TIYVPT+RA + LR+
Sbjct: 8    DGKQRLFSIPPGQPFLPAFAKALIEGRLIEGFPGHPSDPLALASATIYVPTRRAARALRT 67

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLS--YNLNPPVSNIQRLLELARLILIWR 120
              +++   KS ILP I  LGDV E+    +   +  ++LNPP+   +RLL LARLI  WR
Sbjct: 68   ILVDLNPVKSAILPRISPLGDVDEDAAFFNAGAAGVFDLNPPIGTAERLLLLARLIRPWR 127

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              LP  ++ L+    +S+P + A+AIWLA++LA +++ +ET+  KW  L ++  +    W
Sbjct: 128  ESLPSHVRALFGVDDVSVPATTADAIWLARDLAALMNQVETDGAKWSKLTSIAPDDLADW 187

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSI 239
            W +   FL I ++ W + L E   S+P  ++  L+R+E + L      GP+I AGSTGSI
Sbjct: 188  WRVTLGFLDIVTRLWPDILAERRLSNPAAHRNDLIRSEVKRLRDHPPAGPVIAAGSTGSI 247

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+ST+A+ P GA+VLPGLD  +  A W  + E        N +   HPQY L KL
Sbjct: 248  PATAELISTIASLPQGAVVLPGLDRDLDEAAWKLLGE-----AGDNPSIFGHPQYGLHKL 302

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ-----K 354
            L  +   R+DV  L ++      R  ++S++  P +T+D      L N+ P++Q     +
Sbjct: 303  LQAIGALRQDVDVLEDMPRAKRLRERIVSEALRPAETTDAWG---LLNRDPDMQPSALRE 359

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
              + + L+EA NEREEA+++A+ALR +L + +K +AL+TADRNLARRV  EL RFGI+ D
Sbjct: 360  AAARIDLVEASNEREEALAVALALRDALADERKTAALVTADRNLARRVVGELARFGIDAD 419

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             S G  L     +++L  L+  +F   D +A+  LVKHPL + G        A   LELV
Sbjct: 420  DSGGRHLRDVETATLLRLLVETVFNPGDPVALLALVKHPLLRLGGARIDRRLAGETLELV 479

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            A RG      I+DL +    R+    +    P W + ++++  E A  L   +   + PL
Sbjct: 480  AFRGGTGRAGILDLPAFFERRLKESADQPWQPAWHTTVTQDMIEAARGLCKSLSAAVEPL 539

Query: 535  VTYKT-NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              + T N+ +  G ++     + TV  L+N+  DE   +   +  E G+ L+S    +I 
Sbjct: 540  APFVTANRRTDIGEIA-----RATVEALENMARDETGSVAAFYSGERGEKLASFLRGLIS 594

Query: 594  TGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            + + +   A+EW  I+  L+ GETVKP       LFI G LE+RL   D +++GGLNEG 
Sbjct: 595  SEAELDFEAMEWPAILDALMAGETVKPHPGGHPRLFIWGALEARLQTVDAIVIGGLNEGS 654

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP  T  +PF+SR M++ + L   E+  G AAHDF+MA G  H++ TRS R +N PT+ S
Sbjct: 655  WPTKTRNDPFMSRPMKAMIALDPPERRTGLAAHDFQMALGMDHVVLTRSQRSDNAPTVPS 714

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            RWLQRL  + G D  + ++ RG  ++ W+R++D     P  ++P+P PP+ A+P+ +S +
Sbjct: 715  RWLQRLETVLGADVTNEMRGRGTRFIHWSREIDRAEDVPFVRKPEPAPPVAARPKHFSVT 774

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+ L  DPYA++A++ILKL  +    +DP   +RGTLFH+I+    +  I+   P+   
Sbjct: 775  EIETLRRDPYAIFAKKILKLRPLEPLIRDPAAAERGTLFHDILGHFTQAAIDPLAPDAAE 834

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIE 892
             + ++    F   + P  I+ +W   F  +   FL+ E +    +++ F  I + K  +E
Sbjct: 835  KLMELGRILFADMDPPLEIEAVWWPRFTALIPQFLQWERERAYKVQERFAEIASQKREVE 894

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
            ++GI L+G ADRIDL++ G  +I DYKTG  P  + A  L+ PQL+LEAA L  G+F  +
Sbjct: 895  NLGITLSGRADRIDLMRDGTAEIIDYKTGSTPSPKQAHVLLSPQLALEAALLARGAFLDV 954

Query: 953  DCRKVANLFYIRLKQKFKIDC-----ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
               +  +L Y+RLK   ++       I+    + +A  L E++ + L +++   Q  E+ 
Sbjct: 955  GPVRACDLTYVRLKAAGEVKPESILKISRPPSEKTAPALGEEAWQRLAQLLAEYQKPEKG 1014

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S      ++++  +YDHLARV EW
Sbjct: 1015 YLSRALPFRETDLTGDYDHLARVLEW 1040


>gi|260463223|ref|ZP_05811425.1| double-strand break repair protein AddB [Mesorhizobium opportunistum
            WSM2075]
 gi|259031073|gb|EEW32347.1| double-strand break repair protein AddB [Mesorhizobium opportunistum
            WSM2075]
          Length = 1044

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1038 (35%), Positives = 574/1038 (55%), Gaps = 23/1038 (2%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF+I   +PF   +  ALL G LV  FR+D  +PL LA VTIYVPT+RA + LR  F++
Sbjct: 6    RVFSIPSGAPFLPTLAEALLAGRLVPGFRFDG-DPLALADVTIYVPTRRAARALRGVFVD 64

Query: 67   I----TGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
                  G  S ILP+I+ LG+  E++  F A+   + +L PP+   +RLL L  L+  W+
Sbjct: 65   SLKARGGGGSAILPVIRPLGEFDEDEAAFEAEPSAAIDLAPPIGATERLLLLTPLVRAWK 124

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
             +LP  +  L+ E  + +P S A+AIWLA++LA ++D IETE   W  L  L       W
Sbjct: 125  RRLPAHVAKLFAEE-IVIPASTADAIWLARDLAGLMDEIETEGTDWAKLEGLVTGNLAGW 183

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSI 239
            W +  +FL I +  W + L E + S+P  ++ AL+RAEA  L +    GP+I AGSTGSI
Sbjct: 184  WQVTLEFLGIVTDAWPKFLEEQDRSNPAAHRSALIRAEAARLRRNPPAGPVIAAGSTGSI 243

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L++ +A  P GAIVLPGLD  +  A +  +         +      HPQY LA+L
Sbjct: 244  PATAELLAAIARLPGGAIVLPGLDRTLDEASFQALVAPG-----ARPAVLGHPQYGLARL 298

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDV 359
            +  + + R DV+ +G     +  R+ ++ ++  P +T+++          P+I   F+DV
Sbjct: 299  IGKIGVLRGDVEEIGVAEPRLALRAALVGEALRPAETTELWAETRNAFSAPDIAAAFADV 358

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
             L+EA +ER+EA++IA+AL+ +++E  +++AL+T DR LARRV +EL RFG+  D S G 
Sbjct: 359  TLLEAASERDEAVAIAVALKRAVEEPGQRAALVTGDRALARRVSVELKRFGVVADDSGGT 418

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
            PL+ +  +S+L   L A+F+  D + + +L+KHPL   G     +  A   +ELVALRG 
Sbjct: 419  PLANSPAASLLRLALEAVFRPGDPVGLLSLLKHPLLCLGLGRADVRHAAELVELVALRGG 478

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
                DI  L  L   R+      +  P W +RL+    E A  L++ + + + PL  ++ 
Sbjct: 479  TGRPDIASLPDLFETRLTGFDEGSRPPFWVARLTVRAIESARDLLERLNRALAPLAAFRG 538

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK 599
               +    L      + +V  L+ +       L  L+  + G+ L+ L   ++   + + 
Sbjct: 539  QATADLAAL-----VEASVVALEVLGRAADGGLGELYAGDAGEKLAELLRGLVAAPATLS 593

Query: 600  ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTA 659
              A EW D++  LI  ETVKP       + I G LE+RL + DTL++GGLNEGVWP+   
Sbjct: 594  FAANEWPDVMDALIAPETVKPAQGTDRNIAIWGALEARLQDVDTLVIGGLNEGVWPRKPE 653

Query: 660  KNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRL 719
             + F+SR+M++ ++L+  E+ IG AAHDF+MA G   ++  RS R  + P + SRWLQRL
Sbjct: 654  SDRFMSRLMKTGIDLEPPERRIGLAAHDFQMAMGAGKVLLARSARSGDAPAVPSRWLQRL 713

Query: 720  LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLI 779
            L   G D    L++RG   L W R LD   KQ    RP+P PPL  +P  +S +EI+ L 
Sbjct: 714  LTFIGNDQAATLRRRGDELLAWARALDTGPKQDFAPRPQPKPPLSVRPTHFSVTEIETLR 773

Query: 780  NDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQII 839
             DPYAVYARRIL L  +    +DP   +RGTLFH I+        +   P+    +    
Sbjct: 774  RDPYAVYARRILGLMPLEPLIRDPGAAERGTLFHAILHLFSSSVADPRAPDALAGLIAAG 833

Query: 840  DSHFEKENLPPHIDIIWRHLFHKISHSFLEHEE-KIQSSIEKIFVNIPAKMAIESIGIHL 898
             + F +  LPP ++ +W   F K++ + +E E  +  + I +       K  +   G+ L
Sbjct: 834  RACFAEAALPPDVEAVWWPRFEKLAANIVEWERTRADAVIRRHAEERAGKTVVGQSGVTL 893

Query: 899  TGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVA 958
            +G+ADR+DLL  G  DI DYKTG +P K  A  L+ PQL+LE A L+ G+F  +   + +
Sbjct: 894  SGYADRVDLLAGGMADILDYKTGSSPSKAQAHTLLAPQLALEGALLRRGAFKDLGACEPS 953

Query: 959  NLFYIRLK---QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLS 1015
             L +IRLK   + F+   + ++++  +A +L+E++   L +++    + +  ++S     
Sbjct: 954  QLAFIRLKPNGEVFEESILEHNRQPRTASDLAEEAWARLEKLLIHYADPKTGYLSRALPF 1013

Query: 1016 EKSNIQSEYDHLARVAEW 1033
             +     +YDHLARV EW
Sbjct: 1014 REGETDGDYDHLARVLEW 1031


>gi|319780205|ref|YP_004139681.1| double-strand break repair protein AddB [Mesorhizobium ciceri biovar
            biserrulae WSM1271]
 gi|317166093|gb|ADV09631.1| double-strand break repair protein AddB [Mesorhizobium ciceri biovar
            biserrulae WSM1271]
          Length = 1044

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/1038 (36%), Positives = 574/1038 (55%), Gaps = 23/1038 (2%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF+I P +PF   +  ALL G LV  FR+D  +PL LA  TIYVPT+RA + LR  F++
Sbjct: 6    RVFSIPPGAPFLPTLAEALLAGRLVPGFRFDG-DPLALADATIYVPTRRAARALRGVFVD 64

Query: 67   I----TGKKSTILPIIKSLG--DVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
                  G  S ILP+I+ LG  D  E  F  +   + +L PP+S  +RLL L  L+  W+
Sbjct: 65   SLAARGGGGSAILPVIRPLGEFDEDEAAFETEAAAAIDLAPPISATERLLLLTPLVRAWK 124

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
             +LP  +  L+ E  + +P S A+AIWLA++LA ++D IETE   W  L  L       W
Sbjct: 125  RRLPAHVAALFAEE-IVIPASTADAIWLARDLARLMDEIETEGTDWAKLTDLVTGNLAGW 183

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSI 239
            W +  +FL I ++ W + L E + S+P  ++ AL+RAEA  L +    GP+I AGSTGSI
Sbjct: 184  WQVTLEFLGIVTEAWPKFLAESDRSNPAAHRSALIRAEAARLQRNPPAGPVIAAGSTGSI 243

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L++ +A  P GAIVLPGLD  +  A +  I         +      HPQY LA+L
Sbjct: 244  PATAELLAAIARLPGGAIVLPGLDRTLDEASFQAIAAPG-----ARPAVLGHPQYGLARL 298

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDV 359
            +  + + R DV+ +G        R+ ++ ++  P +T+++           +I   F++V
Sbjct: 299  IGKIGVLRGDVEEIGVAEPRRALRAALVGEALRPAETTELWAETRAGFPASDIAGAFAEV 358

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
             L+EA +ER+EA++IA+AL+ ++++  +++AL+T DR LARRV +EL RFG+  D S G 
Sbjct: 359  TLLEAASERDEAVAIAVALKRAVEQPGQRAALVTGDRALARRVSIELQRFGVVADDSGGT 418

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
            PL+ T  +S+L   L A+F+  D + + +L+KHPL   G     +  A   +ELVALRG 
Sbjct: 419  PLANTPAASLLRLALEALFRPGDPVGLLSLLKHPLLGLGLERADVRHAAELIELVALRGG 478

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
                DI+ L  L   R+      +  P W SRL+    E A  L++ + Q + PL  ++ 
Sbjct: 479  TGRPDIVSLPELFEARLTGLGGGSRQPFWFSRLTVRSIETARNLLERLKQALAPLAAFRG 538

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK 599
              ++    L      + +V  L+N+       L  L+  + G+ L+ L   ++   + + 
Sbjct: 539  RDDADLAAL-----VRASVVTLENLGRIADGGLGELYAGDAGEKLAELLRGLVAASASLS 593

Query: 600  ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTA 659
              A EW DI+  LI  ETVKP       + I G LE+RL   DTL++GGLNEGVWP+   
Sbjct: 594  FAATEWPDIMAALIAPETVKPAQGTDRNIAIWGALEARLQTVDTLVIGGLNEGVWPRKPE 653

Query: 660  KNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRL 719
             + F+SR+M++ ++L+  E+ IG AAHDF+MA G   ++ +RS R  + P + SRWLQRL
Sbjct: 654  SDRFMSRLMKTGIDLEPPERRIGLAAHDFQMAMGAGKVVLSRSARAGDAPAVPSRWLQRL 713

Query: 720  LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLI 779
            L   G+D    L++RG   L W R LD   +Q    RP+P PPL  +P  +S +EI+ L 
Sbjct: 714  LTFIGSDQAAELRRRGDELLAWARALDAGPRQDFAPRPQPKPPLSVRPTHFSVTEIETLR 773

Query: 780  NDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQII 839
             DPYAVYARRIL L  +    +DP   +RGTLFH I+        +   P+    +    
Sbjct: 774  RDPYAVYARRILGLMPLDPVIRDPGAAERGTLFHAILHLFSGSVADPRAPDALAGLIAAG 833

Query: 840  DSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAIESIGIHL 898
             + F +  LP  ++ +W   F K++ + +E E     ++ +      A K  +   G+ L
Sbjct: 834  RACFAEAALPADVEAVWWPRFEKLAANIIEWERTRADAVTRRHAEERAGKTVVGQSGVTL 893

Query: 899  TGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVA 958
            +G+ADR+DLL  G  DI DYKTG +P K  A  L+ PQL+LE A L+ G+F  +  R+ +
Sbjct: 894  SGYADRVDLLAGGMADILDYKTGSSPSKAQAHTLLAPQLALEGALLRRGAFKDLGVREPS 953

Query: 959  NLFYIRLK---QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLS 1015
             L +IRLK   + F+   + ++++  +A +L+E++   L +++    +    ++S     
Sbjct: 954  QLAFIRLKPNGEVFEESILEHNRQPRTATDLAEEAWARLEKLLIHYADPATGYLSRALPF 1013

Query: 1016 EKSNIQSEYDHLARVAEW 1033
             +     +YDHLARV EW
Sbjct: 1014 REGETDGDYDHLARVLEW 1031


>gi|110635906|ref|YP_676114.1| DNA helicase/exodeoxyribonuclease V, subunit B [Mesorhizobium sp.
            BNC1]
 gi|110286890|gb|ABG64949.1| DNA helicase/exodeoxyribonuclease V, subunit B [Chelativorans sp.
            BNC1]
          Length = 1042

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1050 (36%), Positives = 576/1050 (54%), Gaps = 39/1050 (3%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF+I P  PF   +  ALL G LV  FRYD  +PL LA  TIY+PT+RA +ELRS F+
Sbjct: 8    PRVFSIPPGVPFLPALADALLQGRLVPGFRYDG-DPLSLADATIYLPTRRAARELRSVFV 66

Query: 66   EITGKKSTILPIIKSLG-------DVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILI 118
            +  G  S ILP+I+ LG       D+ +E   A L    +  PP+  + R+L L  L   
Sbjct: 67   DRLGGVSAILPVIRPLGEFEAELADLSDEGGAAQL----DHAPPIPKLDRILLLGSLAQA 122

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            W+ ++P  +   + E  + +P S ++ +WLA++LA ++D IETEE  W  L  L  E+  
Sbjct: 123  WKARVPAHVAARFEEG-VIVPASLSDGLWLARDLAALMDEIETEEGDWSRLAELVPEELA 181

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTG 237
             WW +  +FL I ++ W E L E + S+P  ++ A++ AEA  LM+   +GP+I AGSTG
Sbjct: 182  GWWQVMLEFLNIVTRAWPELLAERDRSNPATHRNAMLAAEAARLMRTPPRGPVIAAGSTG 241

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            SIPATARL+ T+A   NGA+VLPGLD ++    W  +            +   HPQ+ L 
Sbjct: 242  SIPATARLLGTIARLENGAVVLPGLDLNLDEDSWRAVG------AIEGPSACGHPQFGLR 295

Query: 298  KLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDM--RNTDILENKIPNIQKC 355
            KL+  + + R  V  L   + E+  R  ++S++  P DT+D+   N  +++  +   Q  
Sbjct: 296  KLIGTIGVARAQVLELAAPAPELAARRQLLSEAMRPADTTDLWALNRSMVDRALS--QGA 353

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
             + V+LIEA NER+EA +IA+ALR ++      +AL+T +R LARRV  EL RFGI  D 
Sbjct: 354  LAGVSLIEAANERDEAAAIAVALRHAIAREGTTAALVTPNRTLARRVAAELKRFGIRADD 413

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            S G  L+ ++ +++L  +L AI +  + + I  L+KHPL + G P + + RA   +EL+A
Sbjct: 414  SGGSLLADSVPATLLRLMLEAICRPKEPVVIVGLLKHPLLRLGLPRERVRRAAEVIELMA 473

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            LRG     D+  L SL   R      +   P W SRLS  D   A  ++  + Q I PL 
Sbjct: 474  LRGGTGRPDVATLSSLFAQRHDAMMRDPRKPFWLSRLSASDIAEARQVLAALEQAIVPLS 533

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
            + +         + +S   + +V   + +  DE   L  L+  E G+ L+     ++E  
Sbjct: 534  SLRE-----AAAVGLSLLARASVEAFEALARDEDGTLNELYRGEAGEALARFLRDLVECR 588

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
            +  KA   EW D+   L+ GE VKP +     + I G LE+RL + D L+LGGLNEG WP
Sbjct: 589  TGTKAEISEWPDVFAALMAGEVVKPAMGADQRIAIWGALEARLQSVDMLVLGGLNEGTWP 648

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
            +    + F+SR+M+ +L L+  E+ IG AAHDF MA G   ++  RS R  + P +ASRW
Sbjct: 649  EAPRSDRFMSRLMKGELKLEPPERRIGLAAHDFMMAFGAPQVVLARSTRSESAPAVASRW 708

Query: 716  LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
            LQRL    G      ++ RGQ ++ W   L+     P   RP P PPLEA+P+ +S +EI
Sbjct: 709  LQRLAACAGPSETAAMRARGQRFIAWAHALEARDDVPFAPRPCPRPPLEARPKRFSVTEI 768

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            + L  DPYAVYARRILKL  +    +DP   +RGTLFH+I+   I+   + + P+    +
Sbjct: 769  ETLRRDPYAVYARRILKLMPLDPLIRDPGAAERGTLFHDILQAFIQSGADPSAPDA---L 825

Query: 836  KQIIDSH---FEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK-MAI 891
            ++++D+    F +  LP  ++ +W   F + ++  +  E     ++      I A  + +
Sbjct: 826  ERLLDAGKKLFAETKLPVDVEAVWWPRFERTAYGIIGWERGRAEAVAARHAEIRASAIEV 885

Query: 892  ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQ 951
             + G  L+G ADRID+   G  +I DYKTG  P K  A +L+ PQL+LEAA L  G+F +
Sbjct: 886  GATGKLLSGRADRIDIRADGSAEIIDYKTGSTPSKVQAHRLLAPQLALEAALLARGAFVE 945

Query: 952  IDCRKVANLFYIRLKQKFKIDCITNDKKKYS---ADELSEKSLKNLIEIVTLLQNGEQPF 1008
            +   + A L Y+RLK    ++  +  K K S     E++E++ + L  ++    N E  +
Sbjct: 946  LGQAQPAELCYVRLKANGTVEPESILKIKDSEKAGPEIAEEAWQRLERLLAWYDNSEAGY 1005

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            +S     ++ + + +YDHLARV EW    D
Sbjct: 1006 LSRALPFKEGDTEGDYDHLARVLEWSAGGD 1035


>gi|163867330|ref|YP_001608524.1| hypothetical protein Btr_0025 [Bartonella tribocorum CIP 105476]
 gi|161016971|emb|CAK00529.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 1041

 Score =  609 bits (1570), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 378/1046 (36%), Positives = 577/1046 (55%), Gaps = 25/1046 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP VF+I+P + F    + ALL+GTL+++F  +      LA   IYVPT+RA + LR  F
Sbjct: 4    KPRVFSISPGTAFLPHFVDALLSGTLIDDFAPNGDIQTALADSLIYVPTRRAARALRLAF 63

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            +E +  +ST LP I++LGDV E+ F      +  LNPP+   +RLL LARLI  WR  LP
Sbjct: 64   VERSETQSTFLPTIRALGDVDEDSFLFVENHTSVLNPPIGESERLLLLARLIRPWRESLP 123

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
              ++ L+    + +P   A+AIWLA++LA ++D IETE   W  L  +  +    WW + 
Sbjct: 124  AHLRALFGTEDVLIPAHSADAIWLAQDLAHLMDEIETEAADWSKLKDIAPDMVAEWWQIT 183

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGSIPATA 243
             DFL I ++ W + L E   S+P  ++   +   AE L +     PII AG +GSIPA +
Sbjct: 184  LDFLTIVTQNWPQILTERQRSNPAEWRNQALTMHAETLRRTQPDKPIIAAGVSGSIPAVS 243

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSN-----TTYSTHPQYSLAK 298
             L+  +A+ P GA+VLPGLD H+    WN ++  +   T  +         +HPQY L K
Sbjct: 244  HLLKVIASLPKGAVVLPGLDLHMDEDQWNALSTSNKEKTVCDFFDHAENVFSHPQYHLKK 303

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL  +D +R+ V  +G  S+    R  ++S++  P  T+D +   I+ +   + +   +D
Sbjct: 304  LLTLMDCQRDHVCEIGQQSSIKKRRMALLSEALRPASTTD-KWIQIVRD---DYESLCAD 359

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
             + IEA NEREEA++IA+ALR +++E +K +ALIT DRNLARRV  EL RFGI  + S G
Sbjct: 360  WSFIEAINEREEALAIAVALRKAIEEPQKTTALITNDRNLARRVAAELQRFGIEANDSGG 419

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            IPL+ TL  ++L  +L  +F+ +D +A  +L+KHPL         L       EL  LRG
Sbjct: 420  IPLAQTLPVTLLRLILENVFQSDDPIAFLSLLKHPLTTLQQNRHRLREMAENFELFVLRG 479

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT-Y 537
            N    ++ +    +   I T  ++ +     + L ++  E A LL   + + + PL +  
Sbjct: 480  NTGRINLCECDQFLEKWIETYSHDHNFSEINA-LDQQKFEEARLLCHLLKKAVEPLASLM 538

Query: 538  KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSC 597
            K  K  T    +I+     TV   +N    E   L +L+  E G+ LS+   +++   S 
Sbjct: 539  KQEKECTINEAAIA-----TVEVFENFGRSEDNSLAHLYQHEAGQALSNFLRELVSDQSG 593

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
            +  +  EW  + + LI   +V P       LFI GTLESRL   DT+++GGLNEG WP +
Sbjct: 594  LTFHLCEWPAVFSALIATRSVTPSPGGHPRLFIWGTLESRLQTVDTVVIGGLNEGSWPIS 653

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
            T  + FLSR M+  L L+  E+ IG +AHDF+ A G   ++ +R+LR N+ P+I SRWLQ
Sbjct: 654  TRNDAFLSRPMKMMLTLEPPEQRIGLSAHDFQWAMGMDKVVMSRALRVNHTPSIPSRWLQ 713

Query: 718  RLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
            R+  + G   +  ++ RG+    WT+ LD+T      +RP P PPL+ +PR +S +EI+ 
Sbjct: 714  RIETVVGKQAWKQIRARGEILRHWTKMLDHTNMISDVERPCPVPPLDGRPRHFSVTEIET 773

Query: 778  LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQ 837
            L  DPYA+YA++IL+L  +     DP   +RG L+H I+     +  N N      ++  
Sbjct: 774  LRYDPYAIYAKKILRLRPLKPLIHDPSAIERGILYHAILAAFCAQIKNPNAANALDVLLT 833

Query: 838  IIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIH 897
            +    F+K N PP I++IW + F  ++   ++ E+ +    E+    +  K++I + G+ 
Sbjct: 834  LGRKEFDKFNFPPDIEVIWWNSFENLAPHLIQWEQSLGPR-ERYAEVVSEKISIGTTGVT 892

Query: 898  LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKV 957
            L+G  DR+D+L    V+I D+KTG  P  +  +KL+ PQL+LE A L  G+F        
Sbjct: 893  LSGRVDRLDVLPDKTVEILDFKTGTPPSSKQVRKLLFPQLALETALLMEGAFPDFQDLTP 952

Query: 958  ANLFYIRL--KQKFKIDCITNDKKK----YSADELSEKSLKNLIEIVTLLQNGEQPFISH 1011
            +NLFYI L  K + K   I   KK+     SA  L E + KNLI ++T  QN +Q ++SH
Sbjct: 953  SNLFYIPLNGKGEIKSQSILLKKKEENTYLSAVNLGEIAWKNLIALITYYQNPQQGYLSH 1012

Query: 1012 LRLSEKSNIQSEYDHLARVAEWREEY 1037
                EK   + +YDHLAR+ EW   +
Sbjct: 1013 AVPMEK-RYEGDYDHLARLWEWSSGF 1037


>gi|49474857|ref|YP_032898.1| hypothetical protein BH00280 [Bartonella henselae str. Houston-1]
 gi|49237662|emb|CAF26844.1| hypothetical protein BH00280 [Bartonella henselae str. Houston-1]
          Length = 1040

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 385/1047 (36%), Positives = 581/1047 (55%), Gaps = 30/1047 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP VF+I+  + F    + ALL+  L+++F  +      LA   IYVPT+RA + LR+ F
Sbjct: 4    KPRVFSISSGTAFLPHFVDALLSSALIDDFAPNGDIQTALADTLIYVPTRRAARALRTAF 63

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            +E +  KST LP I++LGDV E+ F      +  LNPP+   +RLL LARLI  WR  LP
Sbjct: 64   VEKSDTKSTFLPTIRALGDVDEDSFLFGENHNNILNPPIEESERLLLLARLIRPWRENLP 123

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            D ++ ++    + +P   A+AIWLA++LA ++D +ETE   W  L  +  +    WW + 
Sbjct: 124  DHLRTMFGTEDVLIPAHTADAIWLAQDLAHLMDEMETEATDWSKLKEIAPDMVAEWWQIT 183

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGSIPATA 243
             DFL I ++ W + L E   S+P  ++  +++  AE L +     PI+ AG +GSIPA +
Sbjct: 184  LDFLTIVTQSWPQILKERGRSNPAEWRNQVLKMHAETLWRTQPNKPILAAGVSGSIPAVS 243

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIW---NTITEKST--NITSSNTTYSTHPQYSLAK 298
             L+  +A+ P GA+VLPGLD H+    W    TI EK T  N+        +HPQY   K
Sbjct: 244  HLLKVIASLPKGAVVLPGLDLHMDEEQWEALGTINEKKTICNVFDRTANAFSHPQYHFKK 303

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL  +  +R  V+ +G  S     R+ ++S++  P  T++ R   I+ +   N+ + +S 
Sbjct: 304  LLSLIGCQRIHVREIGQQSAIKKKRTALLSEALRPASTTE-RWVQIVRDDYENLCENWS- 361

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
               IEA NEREEA++IA+ALR +++E +K +ALIT DRNLARRV  EL RFGI  + S G
Sbjct: 362  --FIEAINEREEALAIAVALRNAIEEPQKTAALITNDRNLARRVAAELQRFGIEANDSGG 419

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            IPL+ TL +++L  LL  +F+  D +A  +L+KHPL   G     L       EL  LRG
Sbjct: 420  IPLAQTLPATLLRLLLENVFQSGDPIAFLSLLKHPLTTLGQNRHRLREMAENFELFVLRG 479

Query: 479  NKNSYDIMDLKSL--VLDRIATQK-NNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            N +  ++ +          I + K + T+V      + +++ E A LL   +++ + PL 
Sbjct: 480  NTSCINLCECDKFFETWTEIYSHKISETNV------IDQQNCEEARLLCHLLVKAVEPLA 533

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
            +    K     N ++      TV   +N   DE+  L +L+  E G+TL +   +++   
Sbjct: 534  SLMKQKKECTVNEAMV----ATVEVFENFGRDENNSLAHLYQHEAGQTLLTFLRELVSDQ 589

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
            S +K    EW+ I + LI   +V P       LFI GTLESRL   DT+++GGLNEG WP
Sbjct: 590  SGLKFQLCEWLAIFSALIATRSVTPSPGGHPRLFIWGTLESRLQTVDTVVIGGLNEGSWP 649

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
              T  + FLSR M+  L L+  EK IG +AHDF+ A G   ++ +R+LR N+ P++ SRW
Sbjct: 650  ITTRNDAFLSRPMKIMLTLEPPEKRIGLSAHDFQWAMGMNKVVMSRALRVNHAPSLPSRW 709

Query: 716  LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
            LQRL  + G   +  ++ RG+ +L WT+ LD+T      KRP P PPL+A+PR +S +EI
Sbjct: 710  LQRLETVIGKQVWKQIRARGEIFLHWTKMLDHTNIIAGAKRPYPVPPLDARPRHFSVTEI 769

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
              L  DPYA+YA++IL+L  +      P  ++RG L+H I +    K  N N+  +  ++
Sbjct: 770  ATLRYDPYAIYAKKILRLKPLKALIHAPGASERGILYHAIFSAFCTKVKNPNSANVLDVL 829

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG 895
              I    F K NLP  I+ IW + F  ++  FL+ E+ +        V +  K+ I + G
Sbjct: 830  LNIGREEFNKFNLPLDIEAIWWNNFENLAPFFLQWEQSLGPRKRYAEV-VSQKIPIGTTG 888

Query: 896  IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCR 955
            + L+G ADRID+L    V+I D+KT   P  +  + L+ PQL+LEAA L  G+F+     
Sbjct: 889  LTLSGRADRIDVLPGKMVEIIDFKTSTPPSSKQVRDLLFPQLALEAALLMQGAFTDFQDL 948

Query: 956  KVANLFYIRLKQKFKI----DCITNDKKKY-SADELSEKSLKNLIEIVTLLQNGEQPFIS 1010
               NL YI L  K KI      +  D K + SA +L EK+ K+LI ++   QN +Q ++S
Sbjct: 949  TPVNLSYIPLNGKGKIIPQSIFLKKDTKDHQSAMDLGEKAWKHLIALMDYYQNPQQGYLS 1008

Query: 1011 HLRLSEKSNIQSEYDHLARVAEWREEY 1037
            H  +      + +YDHLAR+ EW   +
Sbjct: 1009 H-AVPITKRYEGDYDHLARLWEWSSGF 1034


>gi|240849706|ref|YP_002971094.1| double-strand break repair protein AddB [Bartonella grahamii as4aup]
 gi|240266829|gb|ACS50417.1| double-strand break repair protein AddB [Bartonella grahamii as4aup]
          Length = 1039

 Score =  602 bits (1551), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 371/1047 (35%), Positives = 575/1047 (54%), Gaps = 29/1047 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP VF+I+P + F    + ALL+G+L++NF         LA   IYVPT+RA + LR  F
Sbjct: 4    KPRVFSISPGTAFLPHFVDALLSGSLIDNFASSGDIQTALADSLIYVPTRRAARALRLAF 63

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            +E +  +ST LP I++LGDV E+ F      +  L+PP+   +RLL LARLI  WR  LP
Sbjct: 64   VERSDTQSTFLPTIRALGDVDEDSFLFVENHTSTLDPPIGESERLLLLARLIRPWRENLP 123

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
              ++ ++    + +P   A+AIWLA++LA ++D IETE   W  L  +  +    WW + 
Sbjct: 124  AHLRAMFGTEDVLIPAHSADAIWLAQDLAHLMDEIETEGADWSKLKNIAPDMVAEWWQIT 183

Query: 185  ADFLKIASKYWTERLVELNASSPVGY--QIALMRAEAEHLMKGTKGPIIIAGSTGSIPAT 242
             DFL I ++ W + L E   S+P  +  Q   M AE    M   K P+I AG +GS+PA 
Sbjct: 184  LDFLTIVTQNWPKILTERQRSNPAEWRNQALTMHAETLRRMPPDK-PVIAAGVSGSMPAV 242

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSN-----TTYSTHPQYSLA 297
            + L+  +A+ P GA+VLPGLD H+    WN ++      T+ +         +HPQY L 
Sbjct: 243  SHLLKVIASLPKGAVVLPGLDLHMDEEQWNALSTSHKEKTACDFFDPAENVFSHPQYHLK 302

Query: 298  KLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFS 357
            KLL  ++ +R  V  +G  S     R  ++S++  P  T+D +   I+ +   N+  C +
Sbjct: 303  KLLTLMECQRHHVCEIGQQSITKKRRMAILSEALRPASTTD-KWIQIVRDDYENL--C-A 358

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
            D + IEA NEREEA++IA+ LR +++E +K +ALIT DRNLARRV +EL RFGI  + S+
Sbjct: 359  DWSFIEAINEREEALAIAVTLRKAIEEPQKTAALITNDRNLARRVAVELQRFGIEANDSS 418

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            GIPL+ TL  ++L  +L  + + +D +A  +L+KHPL         L       EL  LR
Sbjct: 419  GIPLAQTLPVTLLRLILENVLQPDDPIAFLSLLKHPLTTLQQNRHRLREMAENFELFILR 478

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT- 536
            GN    ++ +    +   I T  +N+      + L ++  E A  L   + + + PL + 
Sbjct: 479  GNTGRINLCECDQFLEKWIETHFHNSSE---INALDQQKCEEARFLCHLLRKAVEPLTSL 535

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGS 596
             K  K  T    +I+     TV   +N   +E   L +L+  E G+ LS    +++   S
Sbjct: 536  MKKEKECTITEAAIA-----TVEVFENFGRNEDNSLAHLYQHEAGQALSKFLRELVSDQS 590

Query: 597  CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
             +  +  EW  + + +I   +V P       LFI GTLESRL   DT+++GGLNEG WP 
Sbjct: 591  GLTFHLCEWPAMFSAIIATRSVTPSPGGHPRLFIWGTLESRLQTVDTVVIGGLNEGSWPI 650

Query: 657  NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWL 716
            +T  + FLSR M+  L L+  E+ IG +AHDF+ A G   ++ +R+LR N+ P+I SRWL
Sbjct: 651  STRNDAFLSRPMKMMLTLEPPEQRIGLSAHDFQWAMGMDKVVMSRALRVNHTPSIPSRWL 710

Query: 717  QRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIK 776
            QR+    G   +  +++RG+    W + LD+T+     +RP P PPL+ +PR +S +EI+
Sbjct: 711  QRMETAVGKQVWKKIRERGEILRHWAKMLDHTSITSEVERPCPAPPLDIRPRHFSVTEIE 770

Query: 777  QLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMK 836
             L  DPYA+YA++IL+L  +     DP  ++RGTL+H I+     +  N N     +++ 
Sbjct: 771  TLRYDPYAIYAKKILRLKPLKELIHDPSASERGTLYHAILAAFCTQIKNPNAANALNVLL 830

Query: 837  QIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGI 896
             I    F+K N PP I++IW + F  ++   ++ E+ +    E+    +  K+ I + G+
Sbjct: 831  SIGRKEFDKFNFPPDIEVIWWNSFENLAPRLIQWEQSLGLR-ERYSEVVSQKIPIGTTGV 889

Query: 897  HLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRK 956
             L+G ADR+D+L    V+I D+KTG  P  +  ++L+ PQL+LE A L  G F       
Sbjct: 890  TLSGRADRLDVLPDKTVEILDFKTGTPPSSKQVRELLFPQLALETALLIQGGFPDFQDFT 949

Query: 957  VANLFYIRLKQKFKIDCIT------NDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFIS 1010
             +NLFYI L +K +I   +      + K   SA  L E + +NLI ++T  QN +Q ++S
Sbjct: 950  PSNLFYIPLNKKGEIKSQSILLKKKDGKTHLSAVNLGENAWENLIALITYYQNPQQGYLS 1009

Query: 1011 HLRLSEKSNIQSEYDHLARVAEWREEY 1037
            H  +      + +YDHLAR+ EW   +
Sbjct: 1010 HA-VPMSKRYEGDYDHLARLWEWSSGF 1035


>gi|49473711|ref|YP_031753.1| hypothetical protein BQ00260 [Bartonella quintana str. Toulouse]
 gi|49239214|emb|CAF25533.1| hypothetical protein BQ00260 [Bartonella quintana str. Toulouse]
          Length = 1039

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 382/1041 (36%), Positives = 572/1041 (54%), Gaps = 27/1041 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP +F+I+P + F    + +LL+G L++NF  D      LA   IYVPT+RA + LR+ F
Sbjct: 4    KPRIFSISPGTSFLPHFVDSLLSGALLDNFAPDGDIQTALADTLIYVPTRRAARALRTAF 63

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
             E +  KST LP I+ LGDV E+ F         LNPP+  I+RLL LARLI  WR  LP
Sbjct: 64   AERSDTKSTFLPAIRPLGDVDEDSFLFVENHPNTLNPPLGEIERLLLLARLIRPWRENLP 123

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
              ++ ++    + +P   A+AIWLA++LA ++D IETE   W  L  +  +    WW + 
Sbjct: 124  AHLRTMFGTEDVLIPTHTADAIWLAQDLAHLMDEIETEAANWSKLKDIAPDMVAEWWQIT 183

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIPATA 243
             DFL I ++ W + L E   S+P  ++  +++  AE L +   + PI+ AG +GSIPA +
Sbjct: 184  LDFLTIVTQNWPQILKERQRSNPAEWRNQILKMHAETLYRTQPEKPILAAGVSGSIPAVS 243

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT-----EKSTNITSSNTTYSTHPQYSLAK 298
             L+  VA+ P GA+VLPGLD H+    WN +      +K+ +          HPQY L K
Sbjct: 244  DLLKVVASLPKGAVVLPGLDLHMDEDQWNALGTTHEEKKTFDSFDHAANVFGHPQYHLKK 303

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL  +  +R  V+ +G  S     R+ ++S++F P  T+D R   I+ +   N+  C +D
Sbjct: 304  LLSLMKCQRIHVREIGQQSTIKAKRAALLSEAFRPASTTD-RWIQIVRDDYENL--C-AD 359

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
             + IEA NEREEA++I++ALR ++++ +K +ALIT DRNLARRV  EL RFGI  + S G
Sbjct: 360  WSFIEAINEREEALAISVALRNAIEDPQKTAALITNDRNLARRVAAELKRFGIEANDSGG 419

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            IPL+ TL S++L  LL  +F+  D +A  +L+KHPL K       L       EL  LR 
Sbjct: 420  IPLAQTLPSTLLRLLLENVFQ-PDPIAFLSLLKHPLTKLEQNRPRLREMAENFELFVLRK 478

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
            +    ++ +    +   I T  ++T      S L ++  E A LL   + + + PL +  
Sbjct: 479  STGRINLCECDQFLEKWIKTYSHDTFE---NSTLDQQKCEEARLLCYLLKKAVEPLASLI 535

Query: 539  TN-KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSC 597
            T  K  T   ++I+     TV   +N   DE+  L NL+  E G+ LS+   +++   S 
Sbjct: 536  TQRKECTINEVAIA-----TVEVFENFGRDENNSLVNLYQHEAGQALSTFLCELVSDQSG 590

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
            +K    EW  + + LI   +V P       LFI GTLESRL   DT+++GGLNEG WP  
Sbjct: 591  LKFQLREWPAMFSALIATRSVTPSPGGHPRLFIWGTLESRLQTVDTVVIGGLNEGSWPIT 650

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
               + FLSR M+  L L+  E+ IG +AHDF+ A G   ++ +R+LR N++P++ SRWLQ
Sbjct: 651  ARNDAFLSRQMKMMLTLEPPERRIGLSAHDFQWAMGMNKVVMSRALRVNHVPSLPSRWLQ 710

Query: 718  RLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
            RL  + G   +  ++ RG+  L W + +D T       RP P PPL+ +PR +S +EI  
Sbjct: 711  RLETVIGKQVWKQIRTRGEILLHWAKMIDNTNMTACATRPCPIPPLKMRPRHFSVTEIPT 770

Query: 778  LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQ 837
            L  DPYA+YA++IL+L  +     DPD  +RGTL+H I+     +  N NT     ++  
Sbjct: 771  LRYDPYAIYAKKILRLKPLKALIHDPDAAERGTLYHAILAAFCTQVKNPNTANALDVLLN 830

Query: 838  IIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIH 897
            I    F+K NLP  I+ IW + F   +   ++ E+ ++       V +  K+ I + G+ 
Sbjct: 831  IGRKEFDKLNLPADIEAIWWNSFENFAPFLIQWEQSLEPRKRYAEV-VSQKIPIGTTGVT 889

Query: 898  LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKV 957
            L+G ADRID+L    V+I D+KT   P  +  + L+ PQL+LE A    G+F+       
Sbjct: 890  LSGRADRIDVLPGKMVEIFDFKTSTPPSSKQVRDLLFPQLALETALFMQGAFTDFQDLTP 949

Query: 958  ANLFYIRLKQKFKIDCIT-----NDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHL 1012
             NLFYI L  K +I   +       K   SA  L EK+ K+LI ++   QN +Q ++SH 
Sbjct: 950  TNLFYIALNGKGEIAPQSILLKKGKKDIQSAINLGEKAWKHLIALIEYYQNPQQGYLSHA 1009

Query: 1013 RLSEKSNIQSEYDHLARVAEW 1033
             +  K   + +YDHLAR+ EW
Sbjct: 1010 -VPLKKEYEGDYDHLARLWEW 1029


>gi|319407900|emb|CBI81554.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 1050

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 383/1052 (36%), Positives = 575/1052 (54%), Gaps = 35/1052 (3%)

Query: 4    KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
            +KP VF+I+P + F    + ALL+GTL+++F  +      L    IYVPT+RA + LR+ 
Sbjct: 10   RKPRVFSISPGTSFLPHFVDALLSGTLIDDFAPNGDIQAALVDTLIYVPTRRAARALRAA 69

Query: 64   FIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRN 121
            F E +  +S+ LP I+ LGD+ EE   F  +      LNPP+   +RLL LARLI  WR 
Sbjct: 70   FAERSHTRSSFLPTIRPLGDMDEESSFFVENHDSILTLNPPIKESERLLLLARLIRPWRE 129

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
             LP  ++ ++    + +P + A+AIWLA++LA ++D +ETE   W  L  +  +    WW
Sbjct: 130  NLPAHLRAIFGTEDVLIPANTADAIWLAQDLASLMDEVETESADWSKLKDICPDMVAEWW 189

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIP 240
             +  DFL I ++ W + L E   S+PV ++   ++ +A+ L +     PII+AG+TGSIP
Sbjct: 190  QITLDFLTIITQNWPQILKEKQRSNPVEWRNQALKIQADILHRTQPHKPIIVAGATGSIP 249

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNT-----TYSTHPQYS 295
            A A L   VA  P GA+VLPGLD ++  A W+ +   + + T+ +         +HPQY 
Sbjct: 250  AVAHLSKVVAYLPKGAVVLPGLDLYMDEAQWDALGTMNKDTTTLDCFDHALGAFSHPQYH 309

Query: 296  LAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKC 355
            L K L  +  +R  V  +G  S     R+ ++S++  P  T+D +   I+ +   N+  C
Sbjct: 310  LKKFLSLMKCQRIHVSEIGQRSIMQTKRAAIVSEALRPVSTTD-QWAQIVRDDYENV--C 366

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
             +D +LIEA NEREEA++I+IALR +++E +K +ALIT DRNLARRV  EL RFGI  + 
Sbjct: 367  -ADWSLIEASNEREEALAISIALRNAIEEPQKIAALITNDRNLARRVVAELQRFGIEAND 425

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            S GIPL+ T  +++L  LL  +FK  D +A  +L+KHPL   G   + L       EL  
Sbjct: 426  SGGIPLAHTSPATLLRLLLENVFKPGDPIAFLSLLKHPLTILGQNRQRLREIVENFELFV 485

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNT--HVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            LRGN N  ++ +    +   + T   N   + P    + +EE + L  LLV    + + P
Sbjct: 486  LRGNPNHINLCECDQFLETWVQTYSYNMSDNCP-LDLQKTEEARSLCHLLV----KAVEP 540

Query: 534  LVTY-KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII 592
            L +  K +K  T     I++  + TV   +N   D++    +L+  E GK LS    +++
Sbjct: 541  LASLIKQDKECT-----INEVARATVEAFENFGRDDNNSFVHLYQNEAGKALSIFLHELV 595

Query: 593  ETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEG 652
               S +K +  EW  + + LI    V P       LFI GTLESRL   DT++LG LNEG
Sbjct: 596  NDQSGLKFHLYEWPAMFSALIATRCVSPSPGGHPRLFIWGTLESRLQTVDTVVLGSLNEG 655

Query: 653  VWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIA 712
             WP  T  + FLSR M+  L L+  EK IG AAHDF+ A G   ++ +R+ R N+IP++ 
Sbjct: 656  FWPSTTRNDAFLSRPMKMTLTLEPPEKRIGLAAHDFQWAMGMNKVVMSRATRVNHIPSVP 715

Query: 713  SRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSF 772
            SRWLQRL  + G   +  +  RG+ +L W + LD T       RP P PPL+ +PR +S 
Sbjct: 716  SRWLQRLETVVGKQVWKKICSRGETFLHWAKMLDKTDTIGFTPRPCPVPPLDMRPRHFSV 775

Query: 773  SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEIN 832
            +EI+ L  +PYA+YA++IL+L  +      P   DRG L+H I+     +  + N     
Sbjct: 776  TEIETLRYNPYAIYAKKILRLKPLKALIYSPYAADRGILYHAILAAFCTQIKDPNVAHAL 835

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA-KMAI 891
                 I    F+K NLPP I  IW  +F   +  F++ E+ +     K  V + A K  I
Sbjct: 836  ATFLAIGRKEFDKLNLPPDIKAIWWSIFENFAPFFIKWEQNLGP--RKRHVEVAAQKTPI 893

Query: 892  ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQ 951
             + G+ L+G ADRID+L    V+I D+KT   P  +  + L+ PQL+LEAA L  G+F+ 
Sbjct: 894  GTTGVTLSGRADRIDILPDKMVEILDFKTNTPPSSKQVRALLHPQLALEAALLMQGAFTD 953

Query: 952  IDCRKVANLFYIRLKQKFKIDCIT------NDKKKYSADELSEKSLKNLIEIVTLLQNGE 1005
                  +NLFY+ LK K  I   +        K + SA  L +++ K LI ++   QN +
Sbjct: 954  FQDLTPSNLFYVPLKGKGPIKSQSIILYQKKAKDQTSAVLLGQEAWKRLITLIEYYQNPQ 1013

Query: 1006 QPFISHLRLSEKSNIQSEYDHLARVAEWREEY 1037
            Q ++SH  L      + +YDHLAR++EW   +
Sbjct: 1014 QGYLSH-ALPSPHRYEGDYDHLARLSEWSSNF 1044


>gi|121602115|ref|YP_989603.1| double-strand break repair protein AddB [Bartonella bacilliformis
            KC583]
 gi|120614292|gb|ABM44893.1| double-strand break repair protein AddB [Bartonella bacilliformis
            KC583]
          Length = 1047

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 378/1044 (36%), Positives = 577/1044 (55%), Gaps = 25/1044 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P +F+I+P +PF    + ALL+G ++ +F  +      LA   IYVPT+RA + LR+ F
Sbjct: 4    QPRIFSISPGTPFLPHFVDALLSGEIIRDFAPNGNIQAALADTLIYVPTRRAARALRATF 63

Query: 65   IEITGKKSTILPIIKSLGDVVEEKF--TADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +E +  +S+ LP I  LG++ E+ F  T D   +  ++PP+   +RLL LARLI  WR K
Sbjct: 64   VEKSPTQSSFLPKILPLGNMDEDSFLFTDDYTNALTIHPPIKESERLLLLARLIRPWREK 123

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP  ++ ++    + +P + A+AIWLA++LA ++D +ETE   W  L  ++ +    WW 
Sbjct: 124  LPMHLRAIFGTEDVLIPTNTADAIWLAQDLARLMDEVETESADWSKLKEIEPDMVAEWWQ 183

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGSIPA 241
            +  DFL I ++ W   L E   ++PV ++  +++ +A+ L +     PII AG+TGSIP+
Sbjct: 184  ITLDFLTIVTQNWPHILKERQLNNPVEWRNQILKMQADILYRTQPNKPIIAAGATGSIPS 243

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNT---ITEKSTNITSSNTTYS--THPQYSL 296
             A L+  +A+ P GA++LP LD  +    WN    I E++T     N   +  +HPQY L
Sbjct: 244  IANLLKVIASLPKGAVILPNLDLQMDEEQWNALGLINEETTTFDFLNHASAAFSHPQYHL 303

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
             KLL  +  +R  VK +G  S+    R+ ++S++  P  T+D +   I  +   N+  C 
Sbjct: 304  KKLLFLMQCQRAHVKEIGQQSSMKKKRAALLSEALRPASTTD-QWVQITRDDYENL--C- 359

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
            +D++LIEA NE EEA++IAIALR ++++ KK +ALIT DRNLARRV  EL RFGI  + S
Sbjct: 360  ADLSLIEATNEHEEALAIAIALRHAIEDPKKTAALITNDRNLARRVSAELQRFGIEANDS 419

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
             GIPL+ TL +++L  LL  +FK  D +A  +L+KHPL         L       EL  L
Sbjct: 420  GGIPLAQTLPATLLRLLLENLFKPGDPIAFLSLLKHPLTTLEQNRHRLREIVENFELFVL 479

Query: 477  RGNKNSYDIMDLKSLVLDRIATQ--KNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            RG     ++          I T+   +          L  +  E A LL   +++ + PL
Sbjct: 480  RGGTGRINLCTCDQFFETWIKTRTLNSLNANNLNDCSLDPQKSEEARLLCHLLVKAVKPL 539

Query: 535  VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIET 594
            V+    ++  C   +I++    TV  L+N   D++  L +L+ +E G+ LS+   +++  
Sbjct: 540  VSL-IQQDREC---TINETIIATVEVLENFGRDDNHSLAHLYQDEAGEALSTFLRELVND 595

Query: 595  GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVW 654
             S +K +  EW  I + LI   +V P     S LFI GTLESRL   DT+++GGLNEG W
Sbjct: 596  QSGLKFHLYEWPAIFSALIATRSVSPAPGGHSRLFIWGTLESRLQTVDTVVIGGLNEGSW 655

Query: 655  PKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASR 714
            P  T  + FLSR M+  L L+  EK IG +AHDF+ A G   +I +R+ R N++P++ SR
Sbjct: 656  PVTTRNDAFLSRPMKMMLTLEPPEKRIGLSAHDFQWAMGMDKVIMSRATRVNHVPSVPSR 715

Query: 715  WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSE 774
            WLQRL  + G   +  +  RG   L W + LD T      +RP P PPLE +PR +S +E
Sbjct: 716  WLQRLETVIGQQVWKQICARGNTLLYWAKILDTTNMISFVERPCPIPPLEMRPRHFSITE 775

Query: 775  IKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHL 834
            I+ L  DPYA+YA++IL+L  +     DP  T+RGTL+H I++    +  N +  +    
Sbjct: 776  IETLRQDPYAIYAKKILRLKPLKPLIHDPCNTERGTLYHAILSAFCTRIKNPHATDALDT 835

Query: 835  MKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESI 894
            +  I    F+K NLP  I+ IW  +F  ++   ++ E+ +        V    K  I + 
Sbjct: 836  LLTIGREEFDKLNLPSDIEAIWWPMFENLAPLLIQWEQSLGPRKRHAEVEA-QKTPIGTT 894

Query: 895  GIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDC 954
            G+ L+G ADRID+L     +I D+K    P       L+ PQL+LEAA L  G+F     
Sbjct: 895  GVTLSGRADRIDILPGKMAEILDFKISTPPSSTQVLTLLSPQLALEAALLMQGAFVDFQD 954

Query: 955  RKVANLFYIRLKQKFKI---DCITNDK--KKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
                NL YI LK K KI     I N K   + SA +L +++ K LI ++   QN +Q ++
Sbjct: 955  LTPLNLLYIPLKGKNKIKPQSIILNKKVINQKSAADLGKEAWKRLISLMNYYQNPQQGYL 1014

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEW 1033
            S+  L  ++  + +YDHLARV EW
Sbjct: 1015 SY-ALPSQNRYEGDYDHLARVLEW 1037


>gi|90420585|ref|ZP_01228492.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90335313|gb|EAS49066.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 1043

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 359/1042 (34%), Positives = 535/1042 (51%), Gaps = 33/1042 (3%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
            N+F+I P  PF   +   LL+G +V +FRY   +PL LA  TIYVPT+RA + L  EF  
Sbjct: 4    NLFSIPPGRPFLATLAEGLLDGRIVPSFRYTG-DPLALAGATIYVPTRRAARALAGEFAR 62

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDI 126
            + G  S ILP I+ +G+  E    A      +L P +  ++R L+LARL   WR+     
Sbjct: 63   LLGTGSAILPAIRPIGESDEASQFAPEGERPSLEPSMGELERRLQLARLARQWRSVTRGR 122

Query: 127  IKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAAD 186
              +        LP S A+A+WLA +L  ++D +ETE      L  L  +    WW L   
Sbjct: 123  EFEALIGEEAVLPASAADALWLAADLGALLDEVETEGTSLGKLAGLAPDALSDWWQLTVT 182

Query: 187  FLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK-GPIIIAGSTGSIPATARL 245
            FL I ++ W + L E    S    +   +RAEA+ L +    GP+I+AGST + PAT  L
Sbjct: 183  FLSIVTETWPQALAEAGRVSEATAKNVWLRAEAQRLRRDPGIGPVILAGSTATAPATIEL 242

Query: 246  MSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDI 305
            M  +A+  +GA+VLPGLD H+    +  I+ +         +   HPQY L  +L    +
Sbjct: 243  MHAIAHLEHGALVLPGLDRHLDPEAFAAISREGA------ISAPGHPQYGLKTILARFAL 296

Query: 306  KREDVKRLG-NVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
              E V  L  N    +  R   ++ +  P +T+        E    +  +    +AL+EA
Sbjct: 297  PPEAVTHLAPNEEPALTAREAFVADALRPAETTHRWR----ETARDHGAEALDGLALVEA 352

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
            ++EREEA++IA A+R +L +    +ALIT DRNLARRV  EL RFGI  + S G PL+ T
Sbjct: 353  NDEREEALAIACAMRAALADPDATTALITPDRNLARRVVSELARFGIAANDSGGRPLAAT 412

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
               ++LT+L     +  D +A+  L+KHPL + G P     RA  A+E++ALRG+    D
Sbjct: 413  PPGTLLTTLAAVALQPGDPIALIALLKHPLTRLGMPAAEARRAARAIEMLALRGSVGIPD 472

Query: 485  IMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNST 544
               L ++V  R    +  TH+P     L E ++ELA ++ D +   + PL   +      
Sbjct: 473  GARLGAIVAARRRMLETATHMPRPVRILPEAERELAQIMADRLEAALEPLSALRDGTER- 531

Query: 545  CGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII---ETGSCIKAN 601
                 I+ +      CL+ V  D       ++ EE G+ +    S I+   +TG    + 
Sbjct: 532  ----EIAAYATALTRCLEAVAADADEDASEVYAEEAGRAMVEFLSDIVRAPDTGFGFASR 587

Query: 602  AIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKN 661
              E  D+I  LI G TVKP+   S+  F+ GTLE+RL + D  ILGGLNEG WP  T   
Sbjct: 588  --ELGDVIDALIAGVTVKPRGGLSARAFVWGTLEARLQSVDMAILGGLNEGTWPGGTKSG 645

Query: 662  PFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLV 721
             FLSR+M+ ++ L   E+ IG AAHDF MA G R ++ TRS R    P IASRWLQRL  
Sbjct: 646  AFLSRLMRREIALDPPERRIGLAAHDFWMAMGARKVVITRSRRAGGAPAIASRWLQRLTT 705

Query: 722  LGGTDFFDNLKKRGQCYLDWTRKLDYTTKQP----HYKRPKPFPPLEAQPRTYSFSEIKQ 777
            L G D    L+  GQ YLD  R+LD             RP+P PPL+ +P +YS ++++ 
Sbjct: 706  LAGEDGTARLRAAGQTYLDHARRLDDAPADAGQDIRAARPEPRPPLDRRPTSYSITDVET 765

Query: 778  LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQ 837
            LI DPYA++AR+I+ L+ +P   +DP   +RG LFH+I+   +++  + +  +    +  
Sbjct: 766  LIRDPYAIHARKIMNLEPLPELMRDPHAAERGNLFHDILGRFVQRGHDPDAGDAEAEILA 825

Query: 838  IIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIH 897
            I    F++E LPP I+ +W      +  +F+  E +    +      I        +   
Sbjct: 826  IARERFDEEMLPPDIEAVWWPRAESLCANFIAWERERGPRVATRHAEIGGAYDFTDLATT 885

Query: 898  LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID-CRK 956
            L G ADR+D++  G  +I D+KTG  P    A+ L+ PQL LE A  K G+F+       
Sbjct: 886  LRGRADRVDVMADGSTEILDFKTGTTPSVSQARALLAPQLPLEGAMAKLGAFADAGTASA 945

Query: 957  VANLFYIRLKQK-FKIDCITNDKKKYS----ADELSEKSLKNLIEIVTLLQNGEQPFISH 1011
            +++L Y+RL+++    D + +D  +       D LS+++L     +V   +N   PF S 
Sbjct: 946  ISDLVYVRLRERTLYEDHLASDGGRKGEPVDPDALSDEALAKFRGLVANFRNAATPFRSR 1005

Query: 1012 LRLSEKSNIQSEYDHLARVAEW 1033
             R     +    YDHLAR  EW
Sbjct: 1006 TRPFIAGDFSGAYDHLARAQEW 1027


>gi|319898221|ref|YP_004158314.1| hypothetical protein BARCL_0035 [Bartonella clarridgeiae 73]
 gi|319402185|emb|CBI75716.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 1040

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 382/1046 (36%), Positives = 572/1046 (54%), Gaps = 34/1046 (3%)

Query: 4    KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
            +KP VF+I+P +PF    + ALL+GTL++NF  +      LA   IYVPT+RA + LR+ 
Sbjct: 3    RKPRVFSISPGTPFLPYFVDALLSGTLIDNFASNGNIQTALADTLIYVPTRRAARALRTA 62

Query: 64   FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLN-----PPVSNIQRLLELARLILI 118
            F E +  +S+ LP I  LGD+ EE+    L +  N N     PP+  I+RLL LARLI +
Sbjct: 63   FFEKSHTQSSFLPTICPLGDINEERC---LFIENNTNTLINTPPIGEIERLLLLARLIRL 119

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            WR  LP  ++ ++    + +P + A+AIW A++LA ++D +ETE   W  L  +  +   
Sbjct: 120  WRENLPTHLRSMFDTEDVFIPATTADAIWFAQDLARLMDEVETESVDWSKLKEIVPDMVA 179

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGY--QIALMRAEAEHLMKGTKGPIIIAGST 236
             WW +  DFL I ++ W + L E    +PV +  Q   M A+  H  +  K PII AG T
Sbjct: 180  EWWQITLDFLTIVTQSWPQILKERQQCNPVEWLNQTFKMHADILHRTQPNK-PIIAAGVT 238

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT----EKSTNITSSNTTYSTHP 292
             SIP  A L+  +A  P GA++ PGLD  +    WN +     EK     S +T   +HP
Sbjct: 239  SSIPTIANLLKVIAYLPKGAVIFPGLDVQMDETQWNALGALNKEKIIFDPSHHTAVFSHP 298

Query: 293  QYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNI 352
            QY L KLL  +  +R  V+ +G  S     R+ ++S++  P  T+D+    I+ +   +I
Sbjct: 299  QYHLKKLLSLMKCQRIHVREIGQQSAIKIRRAALLSEALRPASTTDLW-AQIVRDDYEDI 357

Query: 353  QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
              C +D +LIEA NEREEA++I+IALR ++++ KK +ALIT DRNLARRV  EL RFGI 
Sbjct: 358  --C-ADWSLIEAPNEREEALAISIALRNAIEDPKKNAALITNDRNLARRVAAELQRFGIE 414

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
             + S  IPL+ TL S++L  LL  IFK  D +A  +L+KHPL    +   YL       E
Sbjct: 415  ANDSGEIPLAQTLPSTLLRLLLENIFKPGDPIAFLSLLKHPLTTLEYNRNYLREMTENFE 474

Query: 473  LVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532
            L+ LRGN +  ++ +        +   K + H       L  +  E A  L   +++ + 
Sbjct: 475  LLVLRGNASPINLCECDQFFKTWM---KTHFHKISNNCALDLQKTEEAGFLCHLLVKAVE 531

Query: 533  PLV-TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI 591
            PLV   K ++  T    +I+     TV   +N   D    L +L+  E G  L++   ++
Sbjct: 532  PLVFLIKQDRECTINEAAIA-----TVKVFENFGRDADNSLRHLYQNEAGTALATFLREL 586

Query: 592  IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
            +   S +K    EW  + + LI   +V P       LFI GTLESRL   +T+++G LNE
Sbjct: 587  VSDQSGLKFRLHEWPALFSALIATRSVSPSPGGHPRLFIWGTLESRLQTVNTVVIGSLNE 646

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTI 711
            G WP  T  + FLSR M+  LNL+  E  IG +AHDF+ A G   +I +R+ R N+ P++
Sbjct: 647  GSWPIKTHNDAFLSRPMKMTLNLEPPEHRIGLSAHDFQWAMGMDQVIMSRATRINHTPSV 706

Query: 712  ASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYS 771
             SRWLQRL  + G   +  ++ RG+  L W + LD T      +RP P PPL+ +PR +S
Sbjct: 707  PSRWLQRLETVVGKQVWKQIRTRGEILLHWAKMLDNTNSIVPAERPCPVPPLDIRPRHFS 766

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEI 831
             +EI+ L +DPYA+YA++IL+L  +     DP  T+RGTL+H I+     +  N+N  ++
Sbjct: 767  VTEIETLRHDPYAIYAKKILRLKPLKALIHDPCSTERGTLYHAILAAFCTQIKNQNATDM 826

Query: 832  NHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAI 891
              ++  I    F+K NLPP I+ +W   F   +   ++ E+ + S  E+    I     I
Sbjct: 827  LDILMTIGRKEFDKLNLPPDIEAVWWLNFENFAPFLIQWEQSLGSR-ERYAEVIAQHTLI 885

Query: 892  ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQ 951
               G+ L+G ADRID+L +  ++I D+KT   P       L  PQL+LEAA L  G+F  
Sbjct: 886  GETGVTLSGRADRIDILPNKTIEIIDFKTSIPPSSTQVINLFSPQLALEAALLMQGAFID 945

Query: 952  IDCRKVANLFYIRLKQKFKID--CITNDKKKYSAD--ELSEKSLKNLIEIVTLLQNGEQP 1007
                  +NL YI LK+K +I    I N K K   +   L +K+ K+LI ++   QN +Q 
Sbjct: 946  FKGLTPSNLLYIPLKRKGEIKPIAIINKKTKDQQNVISLGKKAWKHLISLMNYYQNPQQG 1005

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++S+  +  K + + +YDHLAR+ EW
Sbjct: 1006 YLSN-AIPLKKSYEGDYDHLARLLEW 1030


>gi|319403514|emb|CBI77093.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 1040

 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 382/1052 (36%), Positives = 573/1052 (54%), Gaps = 36/1052 (3%)

Query: 4    KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
            + P +F+I+P +PF    + ALL+GTL++NF  +      LA   IYVPT+RA + LR+ 
Sbjct: 3    RTPRIFSISPGTPFLPHFVDALLSGTLIDNFASNGDIQTALADTLIYVPTRRAARALRTA 62

Query: 64   FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLN-----PPVSNIQRLLELARLILI 118
            F E +  KS+ LP I  LGD+ E+ F   L +  N N     PP+   +RLL LARLI +
Sbjct: 63   FFEKSHTKSSFLPTICPLGDINEKSF---LFVENNENTLLNTPPIGESERLLLLARLIRL 119

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            WR  LP  ++ ++    + +P + A+AIWLA++LA ++D IETE   W  L  +  +   
Sbjct: 120  WRENLPTHLRSMFGTEDVFIPATTADAIWLAQDLAHLMDEIETESVDWSRLKEIVPDMVA 179

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTG 237
             WW +  DFL I ++ W + L E    +P  ++    +  A+ L +      II AG   
Sbjct: 180  EWWQITLDFLTIVTQSWPQILKERQQCNPAEWRNQAFKMHADILYRTQPHKTIIAAGVAS 239

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT----EKSTNITSSNTTYSTHPQ 293
            SIP  A L+  +A  P GA++LPGLD  +    WNT+     EK+T   S +    +HPQ
Sbjct: 240  SIPTIANLLKVIACLPKGAVILPGLDLQMDEIQWNTLGAFNKEKTTFNPSDHIAAFSHPQ 299

Query: 294  YSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ 353
            Y L KLL  +  +R  V+ +G  S     R+ ++S++  P  T+D+    I  N   NI 
Sbjct: 300  YHLKKLLSLMKCQRIHVREIGQQSAIKIQRAALLSEALRPASTTDLW-AQITRNDYENI- 357

Query: 354  KCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINI 413
             C +D +LIEA NEREEA++I++ALR ++++ KK +AL+T DRNLARRV  EL RFGI  
Sbjct: 358  -C-ADWSLIEAPNEREEALAISLALRNAIEDPKKTAALVTNDRNLARRVAAELQRFGIEA 415

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            + S  +PL+ TL +++L  LL  IFK  D +A  +L+KHPL    +   YL       EL
Sbjct: 416  NDSGEMPLAQTLPATLLRLLLENIFKPGDPVAFLSLLKHPLTTLEYNHNYLREMAENFEL 475

Query: 474  VALRGNKNSYDIMDLKSLVLDRIAT---QKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            + LRGN    ++ +        + T   + +  ++P  Q    EE K L  LLV    + 
Sbjct: 476  LVLRGNACRINLCECDQFFKTWMQTHFHKVSKNYMPDLQK--IEEAKFLCHLLV----KA 529

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            + PLVT    +   C   SI++    TV   +N   D    L +L+  E GK L++   +
Sbjct: 530  VDPLVTL-IKQEREC---SINEAAIATVEVFENFGRDADNSLAHLYQNEAGKALATFLRE 585

Query: 591  IIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLN 650
            ++   S +K +  EW  + + L+   +V P     S LFI GTLESRL   +T+++G LN
Sbjct: 586  LVSDQSGLKFHLYEWPALFSALMATRSVSPSPGGHSRLFIWGTLESRLQTVNTVVIGSLN 645

Query: 651  EGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPT 710
            EG WP  T  + FLSR M+  L L+  E+ IG +AHDF+ A G   +I +R+ R N+ P+
Sbjct: 646  EGSWPIKTHNDAFLSRPMKMTLTLEPPEQRIGFSAHDFQWAMGMDQVIMSRATRVNHTPS 705

Query: 711  IASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            + SRWLQRL  + G   +  +  RG+ +L W + LD T      +RP P PPL+ +PR +
Sbjct: 706  VPSRWLQRLETVIGKQVWKQICTRGELFLHWAKMLDNTKSIIPAERPCPVPPLDMRPRHF 765

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            S +EI+ L +DPYA+YA++IL+L  +     DP   +RGTL+H I+     +  N+N+  
Sbjct: 766  SVTEIETLRHDPYAIYAKKILRLKPLKPLIHDPCSAERGTLYHAILAAFCTQIKNQNSTN 825

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
            +  ++  I    F+K NLPP  +IIW   F  ++   ++ E+ + S  E+    I     
Sbjct: 826  MLEILLTIGRKEFDKLNLPPDTEIIWWLNFENLAPFLIQWEQSLGSR-ERYAEVIAQNTL 884

Query: 891  IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
            I   G+ L+G ADR+D+L    ++I D+KT   P       L  PQL+LE A L  G+F 
Sbjct: 885  IGETGVTLSGRADRLDILPDKTIEIIDFKTSTPPSSTQVINLFSPQLALETALLMQGAFV 944

Query: 951  QIDCRKVANLFYIRLKQKFKID--CITNDKKK--YSADELSEKSLKNLIEIVTLLQNGEQ 1006
                   +NL YI LK K  I    I N K K   +A  L +K+ K LI ++   QN +Q
Sbjct: 945  DFKGLTPSNLLYISLKGKGTIKPIAIINKKTKDQENAISLGKKAWKYLISLINYYQNPQQ 1004

Query: 1007 PFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
             ++SH  +  K + + +YDHLAR+ EW   +D
Sbjct: 1005 GYLSH-AVPLKKSYEGDYDHLARLLEWSIGFD 1035


>gi|254470632|ref|ZP_05084035.1| double-strand break repair protein AddB [Pseudovibrio sp. JE062]
 gi|211959774|gb|EEA94971.1| double-strand break repair protein AddB [Pseudovibrio sp. JE062]
          Length = 1040

 Score =  572 bits (1473), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 361/1049 (34%), Positives = 558/1049 (53%), Gaps = 43/1049 (4%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            PN+F+++PS+PF +  + ALL+G L+  F+ D  +PL LA VTIYVPT+RA + L     
Sbjct: 5    PNIFSVSPSTPFLQATVEALLSGQLIPGFQADD-DPLALADVTIYVPTRRAARTLPDVLR 63

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYN----LNPPVSNIQRLLELARLILIWRN 121
            +  G K+ +LP I  LGDV EE+    +L  +     L P +S ++R L + RL+  W+ 
Sbjct: 64   KALGAKAALLPKILPLGDVDEEEH---ILKGHGDGEALPPAMSTMERKLAMTRLVWAWKG 120

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            +L   I  L  + P  +P S A+A WLA NL  ++D ++TEE  W +L +L  E +  +W
Sbjct: 121  QLRRQILQLKEDDPARVPASSADAAWLAGNLLTLMDEVQTEEASWAELGSLVPEDHAEYW 180

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGSIP 240
             +  +FLKI +  W E L  +    P   + AL+RAEA  L     +GP+I+AG+TGS P
Sbjct: 181  KITLEFLKIVTDLWPEHLKAIGMMDPKERRSALIRAEAARLRTTPPRGPVIVAGATGSFP 240

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA LM  V +  NGA+VLP LD  +    W  +        S       HPQYSL +LL
Sbjct: 241  ATAELMKAVLSLENGALVLPALDRGMDAESWEAL-----GSPSEPQRVPGHPQYSLRQLL 295

Query: 301  DFLDIKREDVKRLGNVSNE-MYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDV 359
              L +KREDV +LG   +E +  R  +++++  P +T++            + +  F+  
Sbjct: 296  LALGVKREDVTQLGAPESEALRLRCEIVNEALRPAETTEEWQNFFTSELAEHRETAFAGT 355

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
             LI A NE EEA+SIA+ LR ++ E  K +ALI+ DR LARRV  ELTR+GI +D +AG 
Sbjct: 356  QLITARNEAEEALSIALLLREAV-EAGKTTALISPDRTLARRVASELTRWGIIVDDTAGR 414

Query: 420  PLSTTLHSSILTSLLNAIFKLN--DFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            PL  T    ++ ++L A   L   D + +  L+KHPLA  G   K +  A  ALE   LR
Sbjct: 415  PLEQT--PPMVLAILTAKLALQGLDPVNLLALLKHPLAFLGMKAKEVRSAARALERGVLR 472

Query: 478  GNKNSYDIMDLKSLV--LDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            G      +  L+  V      A +K +  V  W+ +L EED +    L+D + Q + PL 
Sbjct: 473  GPHPRPGLSGLREAVEAAHDQAMEKADRPVARWR-KLVEEDWDAINTLLDRLEQALGPLE 531

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIET- 594
                N N     + + D  K  V  +  +  DE+     L+  E GK L+   + ++E  
Sbjct: 532  ALLQNPN----EIPVEDIIKTHVDAVLLLGADENGSTEELFSGENGKALAETLTSLLEAD 587

Query: 595  --GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEG 652
              G C+ AN  EW  +   LI G  V+ +      + +LG +E+RL  +D ++LGGLNEG
Sbjct: 588  AAGLCVPAN--EWPGVFGALITGGAVRSRTPADPRIHLLGPMEARLQRYDLVVLGGLNEG 645

Query: 653  VWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIA 712
             WP+ T  +P+L+R M+  + L   E+ IG +AHDF    G   ++ +RS R +  PT+A
Sbjct: 646  TWPQRTRNDPWLNRPMKGQIGLDPPERKIGTSAHDFLWNLGAPEVVLSRSERVDGSPTVA 705

Query: 713  SRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYT-TKQPHYKRPKPFPPLEAQPRTYS 771
            SRWLQR++ L G      ++ +G+ Y +    LD + T     KRP+P PP+EA+P   S
Sbjct: 706  SRWLQRIVTLAGQSVEQQMRAKGKRYTEMAHVLDRSETPVRPAKRPEPKPPVEARPVQLS 765

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEI 831
             + I+ LI DPY +YAR +LKLD +     +P   D+G + H+ +   ++   + + P  
Sbjct: 766  VTAIENLIRDPYLIYARHVLKLDEVDPIGGEPGAADKGNIIHDALANFLE---DWDGPFD 822

Query: 832  NHLMKQIIDSH---FEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
               ++ ++      F   +  P I  +W   F +I+  F+ +E ++   I   F+    K
Sbjct: 823  EKAVRALLTEGGRLFRPLDAFPAIRALWWPRFERIAEEFVAYEGEVAPKIYDRFLEEYGK 882

Query: 889  --MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKA 946
              M        LTG ADRID +K   + + DYKTG  P  +  + L+ PQL LE A ++ 
Sbjct: 883  VEMPRPERNFTLTGRADRIDQMKDNTLRVVDYKTGQPPSAKQVEALLSPQLPLEVAMIRR 942

Query: 947  GSFSQIDC-RKVANLFYIRLKQKF-KIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNG 1004
              F  +     ++++ YI+LK     +   +   K+ +A+ELSE++ K L ++V   +N 
Sbjct: 943  KGFEDLPHDMPISDMLYIQLKGGSDAVKLESRVPKESTAEELSEEAWKRLEQLVAAYENP 1002

Query: 1005 EQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             + ++S  R+ ++    + YDHLARV EW
Sbjct: 1003 RKGYLSRARVLKEREWAASYDHLARVQEW 1031


>gi|254500632|ref|ZP_05112783.1| hypothetical protein SADFL11_668 [Labrenzia alexandrii DFL-11]
 gi|222436703|gb|EEE43382.1| hypothetical protein SADFL11_668 [Labrenzia alexandrii DFL-11]
          Length = 1046

 Score =  571 bits (1472), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 359/1049 (34%), Positives = 551/1049 (52%), Gaps = 34/1049 (3%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLN-PLLLASVTIYVPTKRAIQELRSE 63
            +P +FTI P+  F    +  L++G LV  FR  PL+ PLLL+S T+Y+PT+RA + L   
Sbjct: 4    QPRLFTIPPAVSFLETFVDKLVDGQLVPGFR--PLDDPLLLSSATLYLPTRRAARLLPDL 61

Query: 64   FIEITGKKSTILPIIKSLGDVVEE----KFTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            F    G +  +LPII+ +GD  E+        DL     L P +  I R L + RL++ W
Sbjct: 62   FQIALGGRPVLLPIIRPVGDADEDIQSLSSGPDL---EPLPPAMPLIDRHLAMTRLVMAW 118

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            +  L      L  + PL LP S A+A WLA +L  ++D +ETEE  W +L  L  + +  
Sbjct: 119  KGALRREALALRSDEPLGLPASTADAAWLAGDLLTLMDEVETEEADWSELAGLVPDDHAR 178

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGS 238
            +W +  DFLKI  + W   L EL    P   + AL+R EA+ +     KGP+I+AG TGS
Sbjct: 179  YWQITLDFLKIVQEAWPAHLAELGKMDPKARRSALIRREAQRIAATPPKGPVIVAGVTGS 238

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNIT--SSNT----TYSTHP 292
            +PATA L+  VA    G IVLPGLD  +    W  + ++    T   S+T      S+HP
Sbjct: 239  VPATAELLKAVAGLEQGVIVLPGLDLDLDDRSWEALGQRFVTGTRHGSDTKTPPPLSSHP 298

Query: 293  QYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNI 352
            QYSL +LLD L + R DV+ L +  + +  R  ++S++  P DTSD   + +    I   
Sbjct: 299  QYSLKQLLDRLGVTRADVRALDDPGDILSQRQRLVSEALRPADTSDGWTSYLDATPIEVR 358

Query: 353  QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
                ++V+L+ A NE +EA+S+AIALR ++ E  + +ALI+ DR L RRV  EL R+ I 
Sbjct: 359  SAALNNVSLMTARNEADEALSLAIALREAI-ELGETAALISPDRMLTRRVAAELARWNIQ 417

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAI--ATLVKHPLAKFGFPEKYLSRAKNA 470
             D SAG PL  T   +ILT +L A   LN    I    L+KHPLA+ G P K +  A  A
Sbjct: 418  ADDSAGRPLDQT-APAILT-ILAAKLALNGCEPIDLLALLKHPLARLGLPIKDIRAAARA 475

Query: 471  LELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            LE   +RG +      D   + ++       N H P W+ ++ E D ++   L   +   
Sbjct: 476  LERGVIRGERPRPGT-DGLIMAVEACRAAAENAHTPRWK-KVHEGDWDVIADLAARLQSA 533

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            + PL     +++     + +    +  V  +Q +  DE      L+  E G+ L++ +S 
Sbjct: 534  LAPLENMAGDRDP----VPVEHLVQAHVDVMQAISADETGAADELYAAEAGEALAAFWSG 589

Query: 591  IIET-GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            ++E   S +     EW  +++ L+ G+ V+ ++ +   + ILG +E+RL  FD +ILGGL
Sbjct: 590  LLEAEASGLAVPPHEWPSVLSALMSGDAVRRRLPRDPRVQILGPMEARLQAFDFVILGGL 649

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEG WP+ T  +P+L+R M+ D+ L+  E+ +G AAHDF    G + ++ +R+ R +  P
Sbjct: 650  NEGTWPQRTRNDPWLNRPMKRDMGLEPPERRLGAAAHDFAQGMGAKRVLLSRAARADGAP 709

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH-YKRPKPFPPLEAQPR 768
            T+ASRWLQRL  L G +    ++ RG  Y      LD          RP P PPL A+P+
Sbjct: 710  TVASRWLQRLTTLAGPEIAAGMEARGNRYSQLAALLDRQAGDVRPADRPAPKPPLGARPK 769

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
            T S +EI++L+ DPYA++AR  L+L  +     +P   D+G L H+ + E +        
Sbjct: 770  TLSVTEIERLVRDPYAIFARHSLELQPVDPIGGEPGAADKGNLIHDALAEFLSTWTGPFD 829

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
                  + +I +  FE  +  P I  +W   F +I+  F+  E K    +EK F+ I   
Sbjct: 830  ETAVTALLEIGEELFEPLDAFPAIRALWWPRFQRIAEGFVAFEAKRSLHVEKRFLEIGGG 889

Query: 889  MAIESIGI--HLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKA 946
            + ++  G+   L G ADRIDL+ SG + + DYKTG  P ++    L+ PQL LEAA ++ 
Sbjct: 890  VELKLPGLDFRLRGRADRIDLMSSGSLSVIDYKTGQVPSQKQVDALLSPQLPLEAAMIQR 949

Query: 947  GSFSQIDCR-KVANLFYIRLKQKF-KIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNG 1004
            G F  +     V  L Y++LK     +  +  + K  + +EL E + + L +++      
Sbjct: 950  GGFKDVPAGDPVGELLYLQLKGGTDAVLEVGRNPKDAALEELIEDAWQRLEQLIAHYAKE 1009

Query: 1005 EQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            E  ++S  R+ +   I   YDHLAR  EW
Sbjct: 1010 ETGYLSRARVMQGRQIDGPYDHLARAQEW 1038


>gi|114705058|ref|ZP_01437966.1| hypothetical protein FP2506_08976 [Fulvimarina pelagi HTCC2506]
 gi|114539843|gb|EAU42963.1| hypothetical protein FP2506_08976 [Fulvimarina pelagi HTCC2506]
          Length = 1049

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 355/1054 (33%), Positives = 549/1054 (52%), Gaps = 44/1054 (4%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            + N+F+I    PF   +  +LL+G L   +RYD  +PL LA   IYVPT+RA + L   F
Sbjct: 2    RANIFSIPLRCPFLPTLAASLLDGHLDVGYRYDG-DPLSLADTLIYVPTRRAARSLAFAF 60

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
                G  + ILP I+ +G+  E +    +       P +  ++R LELARL+  WR+   
Sbjct: 61   QARLGDGAAILPQIRPIGEGDEAELLHGVDSPMAFEPVIGELERRLELARLVRRWRSMTR 120

Query: 125  DI-IKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
               +K L+      LP S A+A++LA +L  ++D IETE   +  L  L  E+   WW L
Sbjct: 121  QAELKALFGSDDAVLPASAADALYLAADLGTLLDEIETEGVPFSQLGQLAPEELAEWWRL 180

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTGSIPAT 242
               FL I +++W E+L      S    +   ++ EA+ L      GP+I+AGST + P T
Sbjct: 181  TLTFLTIVTQHWPEQLKADGRISEARAKNDWLKNEADRLRDHPPTGPVILAGSTATAPQT 240

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDF 302
              LM  VAN   GA+VLPGLD  +  A ++ I +++  I S       HPQY L ++LD 
Sbjct: 241  IALMRVVANMEKGAVVLPGLDLLLDQAAFSMI-DRTLAIASPG-----HPQYGLKRILDG 294

Query: 303  LDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALI 362
            + I R+ V  L      +  R   +S++  P +T++  +    ++   N +     + LI
Sbjct: 295  ILIDRDSVGVL-ESDKHLIARERFLSEALRPAETTEHWS----KSGSANGEDALDGLTLI 349

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
            EA   REEA++IA A+R +L ++K   ALIT DRNLARRV +EL RFGI  + SAG PL 
Sbjct: 350  EATEPREEALAIACAMRDALSDSKATCALITPDRNLARRVVIELERFGIRANDSAGRPLK 409

Query: 423  TTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNS 482
            +T   +++ +LL+  F   D + +  L+KHPL + G       RA  A+EL+ALRG+   
Sbjct: 410  STAPGTLVLTLLSVAFTPGDPIPLLALLKHPLVRLGMTSAEARRAARAIELIALRGSVEI 469

Query: 483  YDIMDLKSLVLDRI--------------ATQKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
             D   L  +V  R+               T+++   +      +S+ED+ELA        
Sbjct: 470  ADAAKLSEIVDRRLLGSARPVDDEAAAEVTKQDRIRLSRPAQLVSKEDRELARRFAQAFE 529

Query: 529  QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLF 588
              I+PL+  +           ++D+T +    L+ +C DE+     L+ EE G  L    
Sbjct: 530  ASISPLIALRGEATR-----ELADYTAVLTEVLETLCRDENGYPRELYAEEPGHALKDFL 584

Query: 589  SKII---ETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLI 645
            S ++    TG    A  +E  D++  L+   TV+P+   S+  F+ GTLE+RL + DT I
Sbjct: 585  SSLVASPRTGFDFPATELE--DVVDALMASVTVRPRGGLSARAFVWGTLEARLQSVDTAI 642

Query: 646  LGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRE 705
            LGGLNEG WP       FLSR+M+ D+ L   E+ IG AAHDF MA G R +I TRS ++
Sbjct: 643  LGGLNEGTWPAGAKNGAFLSRMMRRDIALDPPERRIGLAAHDFWMAMGARRVILTRSTKQ 702

Query: 706  NNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEA 765
            +  PTIASRWLQR+  L G +   +LK+RG  YL   R+L+ +++     RP+P PP+E 
Sbjct: 703  DGAPTIASRWLQRIAALAGPERTGDLKRRGIVYLHAARRLEESSRTAIAARPEPKPPVEK 762

Query: 766  QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRIN 825
            +PR YS +E++ LI DPYA++A +IL+L+ +    + P   +RG+L+H I+++ ++  ++
Sbjct: 763  RPRRYSVTEVETLIRDPYAIHATKILQLEPLDPLMRSPAAAERGSLYHAILSDFVQNGLD 822

Query: 826  KNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNI 885
                     + +I    F+KE LP  I+  W      I+  +L+ E    + +      I
Sbjct: 823  PMADAALDQLLEIARDRFDKEQLPAEIEAFWWPRMEAIASGYLDWERGRNADVAVRHAEI 882

Query: 886  PAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
               + +  I + L G ADRID+++ G ++I D+KTG  P    A+ L+ PQ+ LE     
Sbjct: 883  KGSITVTGIDVELVGKADRIDVMRDGSIEIIDFKTGTAPSVAQARSLLAPQMPLEGGMAL 942

Query: 946  AGSFSQI-DCRKVANLFYIRLKQ-----KFKIDCITNDKKKYSADELSEKSLKNLIEIVT 999
             G F  + D  ++ +L Y+RL++     +      T   +     +LS K++     +  
Sbjct: 943  RGGFEDVKDADRIHDLTYVRLREHEVYPEGLAKPATKTAEAVDPMDLSVKAITKFESLAA 1002

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              Q  E PF S  R +   +    YDHLAR  EW
Sbjct: 1003 KFQKRETPFTSRFRPAYAGDFSGTYDHLARAREW 1036


>gi|319406428|emb|CBI80068.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 1043

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 380/1055 (36%), Positives = 575/1055 (54%), Gaps = 38/1055 (3%)

Query: 2    HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
            +++ P +F+I+  +PF    + ALL+GTL++NF  +      LA   IYVPT+RA + LR
Sbjct: 4    NDRTPRIFSISLGTPFLPHFVDALLSGTLIDNFASNGDIQTALADTLIYVPTRRAARALR 63

Query: 62   SEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLN-----PPVSNIQRLLELARLI 116
            + F E +  KS+ LP I  LGD+ E+ F   L +  N N     PP+   +RLL LARLI
Sbjct: 64   TAFFEKSHTKSSFLPTICPLGDINEKSF---LFVENNENTLLNTPPIGESERLLLLARLI 120

Query: 117  LIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEK 176
             +WR  LP  ++ ++    + +P   A+AIWLA++LA ++D IETE   W  L  +  + 
Sbjct: 121  RLWRENLPTHLQSMFGTEDVFIPARTADAIWLAQDLAHLMDEIETESVDWSRLKEIVPDM 180

Query: 177  YGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGS 235
               WW +  DFL I ++ W + L E    +P  ++    +   + L +      II AG 
Sbjct: 181  VAEWWQITLDFLTIVTQSWPQILKERQQCNPAEWRNQAFKMHTDILYRTQPHKTIIAAGV 240

Query: 236  TGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT----EKSTNITSSNTTYSTH 291
              SIP  A L+  +A  P GA++LPGLD  +    WN +     EK+T   S +    +H
Sbjct: 241  ASSIPTIANLLKVIACLPKGAVILPGLDLQMDEIQWNALGAFNKEKTTFNPSDHIAAFSH 300

Query: 292  PQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN 351
            PQY L KLL  +  +R  V+ +G  S     R++++S++  P  T+D+    I  +   N
Sbjct: 301  PQYHLKKLLSLMKCQRIHVREIGQQSAIKIQRAVLLSEALRPASTTDLW-AQITRDDYEN 359

Query: 352  IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGI 411
            I  C +D +LIEA NEREEA++I++ALR ++++ KK +AL+T DRNLARRV  EL RFGI
Sbjct: 360  I--C-ADWSLIEAPNEREEALAISLALRNTIEDPKKTAALVTNDRNLARRVAAELQRFGI 416

Query: 412  NIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
              + S  IPL+ TL +++L  LL  IFK  D +A  +L+KHPL    +   YL       
Sbjct: 417  EANDSGEIPLAQTLPATLLRLLLENIFKPGDPVAFLSLLKHPLTTLEYNHNYLREMAENF 476

Query: 472  ELVALRGNKNSYDIMDLKSLVLDRIAT---QKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
            EL+ LRGN    ++ +        + T   + + +++P  Q    EE K L  LLV    
Sbjct: 477  ELLVLRGNSCRINLCECDQFFKTWMQTHFHKISKSYMPDLQK--IEEAKFLCHLLV---- 530

Query: 529  QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLF 588
            + + PLVT    +   C   SI++    TV   +N   D    L +L+  E GK L++  
Sbjct: 531  RAVEPLVTL-IKQEREC---SINEAAIATVEVFENFGRDADNSLAHLYQNEAGKALATFL 586

Query: 589  SKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
             +++   S +K +  EW  + + L+   +V P +     LFI GTLESRL   +T+++G 
Sbjct: 587  RELVSDQSGLKFHLYEWPALFSALMATRSVSPSLGGHPRLFIWGTLESRLQTVNTVVIGS 646

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            LNEG WP  T  + FLSR M+  L L+  E+ IG +AHDF+ A G   +I +R+ R N+ 
Sbjct: 647  LNEGSWPIKTHNDAFLSRPMKMTLTLEPPEQRIGLSAHDFQWAMGMDQVIMSRATRVNHT 706

Query: 709  PTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
            P++ SRWLQRL  + G   +  +  RG+ +L W + LD T      +RP P PPL+ +PR
Sbjct: 707  PSVPSRWLQRLETVIGKQVWKQICTRGELFLHWAKMLDNTKSIIPAERPCPVPPLDMRPR 766

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
             +S +EI+ L +DPYA+YA++IL+L  +     DP   +RGTL+H I+     +  N+N 
Sbjct: 767  HFSVTEIETLRHDPYAIYAKKILRLKPLKPLIHDPCSAERGTLYHAILAAFCTQIKNQNA 826

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
              +  ++  I    F+K NLPP I+IIW   F  ++   ++ E+ + S   K +  + A+
Sbjct: 827  TNMLEILLTIGRKEFDKLNLPPDIEIIWWLNFENLAPFLIQWEQSLGS--RKRYAEVIAQ 884

Query: 889  -MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
               I   G+ L+G ADR+D+L    V+I D+KT   P       L  PQL+LE A L  G
Sbjct: 885  NTLIGETGVTLSGRADRLDILPDKTVEIIDFKTSTPPSSTQVINLFSPQLALETALLMQG 944

Query: 948  SFSQIDCRKVANLFYIRLKQKFKID--CITNDKKK--YSADELSEKSLKNLIEIVTLLQN 1003
            +F        +NL YI LK K  I    I N K K   +A  L +K+ K LI ++   QN
Sbjct: 945  AFVDFKGLTPSNLLYISLKGKGTIKPIAIINKKTKDQENAISLGKKAWKYLISLINYYQN 1004

Query: 1004 GEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
             +Q ++SH  +  K + + +YDHLAR+ EW   +D
Sbjct: 1005 PQQGYLSH-AVPLKKSYEGDYDHLARLLEWSIGFD 1038


>gi|319404940|emb|CBI78542.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 1040

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 375/1047 (35%), Positives = 567/1047 (54%), Gaps = 28/1047 (2%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP VF+I+P +PF    + ALL+GTL++NF  +    + L    IYVPT+RA + LR+ F
Sbjct: 4    KPRVFSISPGTPFLPHFVDALLSGTLIDNFAPNGNIQIALTDTLIYVPTRRAARALRTAF 63

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             E +  +S+ LP I  LGD+ EE   FT +   +     P+   +RLL LARLI +WR  
Sbjct: 64   FEKSHTQSSFLPTICPLGDINEESYFFTENNTNTLVNTSPIGESERLLLLARLIRLWREN 123

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            LP  ++ ++    + +P + A+A+WLA++LA ++D +ETE+  W  L  +  +    WW 
Sbjct: 124  LPTHLRSMFGTEDIFIPATTADAVWLAQDLARLMDEVETEDVDWLRLKEIVPDMVAEWWQ 183

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIPA 241
            +  DFL I ++ W + L E    +PV ++    +   + L +      II AG T SIP 
Sbjct: 184  ITLDFLTIVTQSWPQILKERQQCNPVEWRNQAFKIHTDILYRTQPHKTIIAAGVTSSIPT 243

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT----EKSTNITSSNTTYSTHPQYSLA 297
             A L+  +A  P GA++LPGLD  +    WN +     EK+    S +    +HPQY L 
Sbjct: 244  IANLLKVIACLPKGAVILPGLDLQMDETQWNALGALNKEKTIFDPSHHIAAFSHPQYHLK 303

Query: 298  KLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFS 357
            KLL  ++ +R  V+ +G  +     R+ ++S++  P  T+D+    I+ +   NI  C +
Sbjct: 304  KLLSLMECQRIHVREIGQQNTIKTQRAALLSEALRPASTTDLW-AKIIRDDYENI--C-A 359

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
            D +LIEA NEREEA++I+IALR ++++ KK +ALIT DRNLARRV  EL RFGI  + S 
Sbjct: 360  DWSLIEAPNEREEALAISIALRNAIEDPKKTAALITNDRNLARRVAAELQRFGIEANDSG 419

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
             IPL+ TL S++L  LL  IFK  D +A  +L+KHPL    +   YL       EL+ LR
Sbjct: 420  EIPLAQTLPSTLLRLLLENIFKPGDPIAFLSLLKHPLTTLEYNRNYLREMAENFELLVLR 479

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDK-ELAVLLVDHILQCITPLVT 536
            GN    ++ +       R   Q ++  + +  + +S+  K E A  L   +++ + PLV+
Sbjct: 480  GNACRINLCECDQFF--RTWKQTHSHEISN--NCISDLQKIEEADFLCHLLVKAVEPLVS 535

Query: 537  Y-KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
              K  +  T    +I+     TV   +N   D    L +L+  E GK L +   +++   
Sbjct: 536  LIKQERECTINEAAIA-----TVEVFENFGRDVDNSLAHLYQNEAGKALVTFLRELVSDQ 590

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
            S +K    EW  + + L+   +V P       LFI GTLESRL   +T+++G LNEG WP
Sbjct: 591  SGLKFCLHEWPALFSALMATRSVSPSPGGHPRLFIWGTLESRLQTVNTVVIGSLNEGSWP 650

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
              T  + FLSR M+  L L+  E+ IG +AHDF+ A G   +I +R+ R N+ P++ SRW
Sbjct: 651  IKTHNDAFLSRPMKITLTLEPPEQRIGLSAHDFQWAMGMDKVIMSRATRVNHTPSVPSRW 710

Query: 716  LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
            LQRL  + G   +  +  RG+  L W + LD T      +RP P PPL+ +PR +S +EI
Sbjct: 711  LQRLETVVGKQVWKQICTRGELLLHWAKMLDNTNSITPAERPCPVPPLDIRPRHFSITEI 770

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            + L +DPYA+YA++IL+L  +     DP   +RGTL+H I+     +  N N  ++  ++
Sbjct: 771  ETLRHDPYAIYAKKILRLKPLKALIHDPCSAERGTLYHTILAAFCTQIKNHNATDMLDIL 830

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG 895
              I    F+K NLPP I+ +W   F   +  FL   EK     ++    I     I   G
Sbjct: 831  LTIGRKEFDKLNLPPDIEAVWWPNFENFA-PFLIQWEKSLGPRKRYAEVIAQNTLIGETG 889

Query: 896  IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCR 955
            + L+G ADR+D+L    V+I D+KT   P       L  PQL+LE A L  G+F      
Sbjct: 890  VTLSGRADRLDILPDKTVEIIDFKTSIPPSATQVINLFSPQLALETALLMQGAFIDFKGL 949

Query: 956  KVANLFYIRLKQKFKIDCITNDKKKYSADE----LSEKSLKNLIEIVTLLQNGEQPFISH 1011
              +NL YI LK+K +I  IT   KK    E    L +K+ K LI ++   QN +Q ++SH
Sbjct: 950  IPSNLLYIPLKRKGEIKPITVINKKTKDQENAISLGKKAWKYLISLINYYQNPQQGYLSH 1009

Query: 1012 LRLSEKSNIQSEYDHLARVAEWREEYD 1038
              +  K + + +YDHLAR+ EW   +D
Sbjct: 1010 -AVPLKKSYEGDYDHLARLLEWSIGFD 1035


>gi|328545811|ref|YP_004305920.1| Double-strand break repair protein AddB [polymorphum gilvum
            SL003B-26A1]
 gi|326415551|gb|ADZ72614.1| Double-strand break repair protein AddB [Polymorphum gilvum
            SL003B-26A1]
          Length = 1053

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 366/1056 (34%), Positives = 556/1056 (52%), Gaps = 40/1056 (3%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPL-NPLLLASVTIYVPTKRAIQELR 61
             +K  +F+I PS+PF   ++ AL++GTL+E+FR  P+ +PL L++ T+Y+PT+RA + L 
Sbjct: 5    GRKGCLFSIPPSAPFAHTLVRALVDGTLIESFR--PIEDPLSLSTATLYLPTRRAARTLP 62

Query: 62   SEFIEITGKKSTILPIIKSLGDVVE-EKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            + F E+ G +  +LP I+ LGDV E E+F         L PP+  ++R L L RL++ W+
Sbjct: 63   AVFQEVFGGRPVLLPAIRPLGDVDEIEQFLRAEPDGEPLPPPLPALERRLALTRLVMAWK 122

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              L   +  L P+ PL LP S A+A WLA +L  ++D +ETEE  W  L  L  + Y  +
Sbjct: 123  GALRRDVLRLKPDDPLGLPASAADAAWLAADLLALMDEVETEEVDWSQLVGLVPDDYARY 182

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSI 239
            W +  DFL I    W   L E  A  P   + AL+R EAE L +    GP+I+AGSTGS+
Sbjct: 183  WQITLDFLSIVRDAWPAYLAERGAMDPKARRSALIRREAERLRRAPPAGPVIVAGSTGSV 242

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITE---------KSTNITSSNTTYST 290
            PATA L+  VA  PNGAIVLP LD  +  A W  +                 +   +   
Sbjct: 243  PATAELLQVVAGLPNGAIVLPALDMELDDASWTALGGPLPSRIGAIGRPAGVAETPSVPG 302

Query: 291  HPQYSLAKLLDFLDIKREDVKRLGNV-SNEMYGRSMVISKSFLPPDTSDMRNTDILENKI 349
            HPQY L  LLD L + R+ V  LG   + ++  R  ++S++  P +TSD     +    +
Sbjct: 303  HPQYGLKLLLDRLGLGRDRVAPLGGPETADLALRDRIVSEALRPAETSDAWTGFLERTPL 362

Query: 350  PNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRF 409
               +   SDVAL+ A NE EEA+++A+ LR ++ E  + +AL++ DR LARRV  +L R+
Sbjct: 363  AARRAALSDVALLSARNEVEEALAVAVVLREAV-ERGETAALVSPDRMLARRVAEDLGRW 421

Query: 410  GINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKN 469
            GI +D SAG PL  T  + +         +    + + +L+KHPLA+ G   + +  A  
Sbjct: 422  GIAVDDSAGRPLDQTPPAILAGLAARLALEGCAPIDLLSLLKHPLARLGLTAREIRAAAR 481

Query: 470  ALELVALRGNKNSYDIMDLKSLVLDRIATQ--KNNTHVPHWQSRLSEEDKELAVLLVDHI 527
            ALE   LRG +    +   K LVL  +A +    + H P W+ +L + D      LVD +
Sbjct: 482  ALERGVLRGPRP---LPGTKGLVLAVVAARDAAESDHTPRWR-KLYDADWVAVADLVDRL 537

Query: 528  LQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSL 587
               + PL      K++    L +          L  + +DE      L+  E G  L+  
Sbjct: 538  AHALEPLEALAEAKDA----LPVETLAAAHAEVLYRLAVDEAGTDAELYSGETGDALALF 593

Query: 588  FSKIIETGS---CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTL 644
             + ++E G    CI     EW  +   L+ G  V+ ++     + ILG +E+RLL  D +
Sbjct: 594  LAGLLEAGGAGLCIVPA--EWPSVFAALMSGTAVRRRLPGDPRIQILGPMEARLLRPDLV 651

Query: 645  ILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLR 704
            +LGGLNEGVWP+ T  +P+L+R M+ DL L   E+ IG AAHDF    G R ++  R+ R
Sbjct: 652  VLGGLNEGVWPQRTRNDPWLNRPMKRDLGLDPPERRIGAAAHDFAQGLGARRVVLARAER 711

Query: 705  ENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH-YKRPKPFPPL 763
             +  PT+ASRWLQRL+ L G +    +  RG+ YL     LD          RP+P P L
Sbjct: 712  ADGAPTVASRWLQRLVTLVGPEIEAEMTARGRTYLRLAGLLDRPEGPVRPASRPEPRPAL 771

Query: 764  EAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKR 823
             A+P+  S +EI++L+ DPYA++ARRIL L+ +      P   D+GTL H+ +   +   
Sbjct: 772  PARPKRLSVTEIERLVRDPYAIFARRILGLEPVDPVGGVPGAADKGTLIHDALARFLTDW 831

Query: 824  INKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFV 883
                       + +I ++ F   +  P I  +W   F +I+  F+  E    + + + F+
Sbjct: 832  DGPYDDSAVRRLVEIGETMFSPLDAFPAIRALWWPRFERIARGFVAFEAARAAGLRERFL 891

Query: 884  NIPAK--MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEA 941
             I     +A+  I   LTG ADRIDLL  G   + DYKTG  P       L+ PQL LEA
Sbjct: 892  EIGGGVDLALPGIEFRLTGRADRIDLLDDGTYAVIDYKTGQVPSGNQVATLLAPQLPLEA 951

Query: 942  AALKAGSFSQIDC-RKVANLFYIRLK---QKFKIDCITNDKKKYSADELSEKSLKNLIEI 997
            A ++ G F+ +   R V++L YI+LK   +  K++  T   +  S ++L+E++ K L  +
Sbjct: 952  AMIRRGGFADVPAGRPVSDLLYIQLKGAREALKVE--TRAPRDGSVEDLAEEAWKRLEAL 1009

Query: 998  VTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            V    +  + ++S  R+ ++  +   YDHLARV EW
Sbjct: 1010 VAAYADPARGYLSRARVLQERAMDGPYDHLARVREW 1045


>gi|304392406|ref|ZP_07374347.1| double-strand break repair protein AddB [Ahrensia sp. R2A130]
 gi|303295510|gb|EFL89869.1| double-strand break repair protein AddB [Ahrensia sp. R2A130]
          Length = 1070

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 345/1073 (32%), Positives = 546/1073 (50%), Gaps = 55/1073 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPL------NPLLLASVTIYVPTKRAIQEL 60
            N+ +I P + F + ++  L+ G LVE F   P       +PL LA VTI+VPT+RA + L
Sbjct: 9    NIVSIPPGAAFLQTLVEKLVCGELVEGFA--PFADGAESDPLALAGVTIWVPTRRAARSL 66

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEE-----KFTA--DLLLSYNLNPPVSNIQRLLELA 113
             ++F+   G ++ +LP I +LGD  EE     +F A  DLL+       +      L L+
Sbjct: 67   ATQFVTRLGNRAAVLPRIVTLGDGDEEGLEFQRFVAGNDLLVPSEAQA-IDPFIHTLTLS 125

Query: 114  RLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALK 173
            RL+  W + L +  + +     + +P S A+AI  A  L  +++ I TE+ +W  L+ L 
Sbjct: 126  RLVHSWASALRENERAMMGGGDIIMPSSLADAIGFAGELGSLMESIATEDIEWSQLNLLD 185

Query: 174  NEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIII 232
               +  WW L   FL IAS      L E     P   +  L+R +A+   + G+ GP+I 
Sbjct: 186  VADHADWWQLTLKFLTIASDAMPAFLHERGLEEPARLRGRLIREQAQQYREHGSTGPVIA 245

Query: 233  AGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHP 292
            AGSTGSIPATA L+  +A  PNGA+VLPGLD  +    W+ + +   N  + + T   HP
Sbjct: 246  AGSTGSIPATADLLQAIAALPNGALVLPGLDRDLDDESWSKV-DLPDNAKNEDGTAPGHP 304

Query: 293  QYSLAKLLDFLDIKR--EDVKRLGNVSNEMYG----RSMVISKSFLPPDTSDMRNTDILE 346
            QY L KLL  + + R  ++++ +   +    G    R  ++S++  P  T+D        
Sbjct: 305  QYGLKKLLTSMKLSRGHDEIEHITLSAEPDSGPLRVREHIVSEALRPSATTDKWQD--FA 362

Query: 347  NKIPNIQKC--FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKL 404
             K  + QK    + V+++EA  ER+EA++IA+ALR +++     +AL+T DRNLARRV +
Sbjct: 363  TKYDDAQKAEALAGVSIVEARGERQEALAIALALRETIETEGATAALVTPDRNLARRVAV 422

Query: 405  ELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYL 464
            E+ RF I +D SAG PL      +     L   F   D +A+  L+KHP  + G P    
Sbjct: 423  EMRRFDIVVDDSAGQPLRNRPAGTFARLALATAFGPIDPVALTGLLKHPDLRLGLPRAKA 482

Query: 465  SRAKNALELVALRG-----NKNSYD--IMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDK 517
                  LEL  LRG      +  ++     L+  +L  IA +K     P   S +     
Sbjct: 483  RHGARLLELAILRGAIMPPERGFFEDAAQTLRRTLLQVIADEKT----PRAHSTIVRMSD 538

Query: 518  ELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWF 577
            +  +LL+D   +    ++  + +  +T     +  W + T   ++ + +DEH +L   + 
Sbjct: 539  DEWLLLIDFCQRLDEAVLLIEDDVLNT--KQPLDRWGQCTTAFIEALAIDEHGELAPFYN 596

Query: 578  EEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESR 637
              +G  L    ++++++G  +   A  W D+   L+   TV+ +      + ILG LE+R
Sbjct: 597  TTDGAALHGFLAQLLDSGEELDTTADHWPDVFDALMGQRTVRAQGGTDPRIAILGPLEAR 656

Query: 638  LLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHL 697
            L  FD ++LGGLNEG WP     +PFLSR M++ L L + E+  G AAHDF+M  G   +
Sbjct: 657  LQTFDRVVLGGLNEGTWPAAARNDPFLSRPMKAQLGLPSPERRTGLAAHDFQMMMGMADV 716

Query: 698  IYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDY--TTKQPHYK 755
            + TR+ R +N PT+ASRW+QRL+++ G+     +++RG+ + DW   +D    T++P  +
Sbjct: 717  VLTRAARADNAPTVASRWVQRLMLVAGSHATTAMQERGRKFTDWVTAIDAPKETEKP-AQ 775

Query: 756  RPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNI 815
            RP P PP++ +P   S + +   I DPYA+YA+ IL L  +    +D D  +RG L+H +
Sbjct: 776  RPAPKPPVDVRPNRLSVTAVATWIEDPYAIYAKHILGLQPLQPLIRDADARERGELYHQV 835

Query: 816  ITELIKKRINKNTPEINHLMKQIIDSH---FEKENLPPHIDIIWRHLFHKISHSFLEHEE 872
              E ++  IN   PE +H M Q++ S    F +  +P      W   F +I+  FL    
Sbjct: 836  FEEFVRSGIN---PEADHAMDQLLLSAKAVFGEAEIPQEFIAQWLPRFTEIAEEFLSWHA 892

Query: 873  KIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKL 932
            +  +   K+ V    +      G  LT  ADR+D    G   I DYKTG +P    A+ +
Sbjct: 893  RQIAGGHKVTVERSGRTEKGLNGFTLTARADRMDRDVDGRFIIYDYKTGASPTAARARDM 952

Query: 933  IDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFKIDCITNDKKKYS-ADELSE 988
              PQL LEAA    G+F      +VA   Y+RL     KF    +  D      A +++E
Sbjct: 953  KAPQLPLEAAMTIRGAFGDDLQGEVAGFGYLRLIPGTPKFADMAVQPDHGDPDMATQIAE 1012

Query: 989  KSLKNLIEIVTLLQNGEQPFISHLR-LSEKSNIQSEYDHLARVAEWREEYDIS 1040
            ++ K L  ++   ++  QP+ S+ R   E+ +  S+YDHLAR+ EW    D S
Sbjct: 1013 EAWKRLGAMIKKYRDKSQPYRSYNRPPKERRSYSSDYDHLARLGEWSNGADDS 1065


>gi|307942841|ref|ZP_07658186.1| double-strand break repair protein AddB [Roseibium sp. TrichSKD4]
 gi|307773637|gb|EFO32853.1| double-strand break repair protein AddB [Roseibium sp. TrichSKD4]
          Length = 1058

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 355/1062 (33%), Positives = 547/1062 (51%), Gaps = 41/1062 (3%)

Query: 1    MHNKKP-NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLN-PLLLASVTIYVPTKRAIQ 58
            M    P +V++I  S PF + +  AL++GTLV  FR  PL+ PLLL + T+Y+PT+RA +
Sbjct: 1    MQASAPASVYSIPSSVPFLKTLATALVDGTLVPGFR--PLDDPLLLPTATLYLPTRRAAR 58

Query: 59   ELRSEFIEITGKKSTILPIIKSLGDVVEE-KFTADLLLSYNLNPPVSNIQRLLELARLIL 117
             L   F ++ G K  +LP+I+ +GD  E+ +  +       L P +  ++R L + RL++
Sbjct: 59   LLPEIFQDLFGGKPVLLPVIRPVGDTEEDLQLLSAEADGEALPPSMPVLERHLAMTRLVM 118

Query: 118  IWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKY 177
             W+  L   + +L    PL +P S A+A WLA +L  ++D IETEE  W D+  L  + +
Sbjct: 119  AWKGALRREVLNLGLNEPLGVPASAADAAWLAADLLSLMDEIETEEADWSDIAKLVPDDH 178

Query: 178  GMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGST 236
              +W +  DFLKI  + W   L E     P   + AL+R EAE L+    KGP+I+AG T
Sbjct: 179  ARYWQITLDFLKIVQEAWPAHLAERGLMDPKARRSALIRKEAERLLTNPPKGPVIVAGVT 238

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS-------SNTTYS 289
            GS+PATA L+  V+     AIVLPGLD  + T+ W  +   S    +       S    S
Sbjct: 239  GSVPATAALLKAVSRLDRSAIVLPGLDLTMDTSSWEALEGPSPKAGTIIKPGGKSMPGLS 298

Query: 290  THPQYSLAKLLDFLDIKREDVKRLGNVSN-EMYGRSMVISKSFLPPDTSDMRNTDILENK 348
             HPQYSL K+L  L + R  V  LG      +  R  ++S++  P +TSD     +   +
Sbjct: 299  AHPQYSLKKILSELQVDRSAVSCLGEKPEPALQARERLLSEAMRPAETSDGWMAYLGRVR 358

Query: 349  IPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTR 408
                     +V+LI A NE +EA+SIAIALR +L E  + +ALI+ DR L RRV  EL R
Sbjct: 359  EKERAAALENVSLIAARNEADEALSIAIALREAL-EVGETAALISPDRFLTRRVASELAR 417

Query: 409  FGINIDISAGIPLSTTLHS--SILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSR 466
            + I +D SAG PL  T  +  +ILT+ L A++   D + +  L+KHPL + G P K    
Sbjct: 418  WKIQVDDSAGRPLDQTPPAILAILTAKL-ALYGC-DPLDLLALLKHPLCRLGLPAKDNRS 475

Query: 467  AKNALELVALRGNKNSYDIMDLKSLV-------LDRIATQKNNTHVPHWQSRLSEEDKEL 519
            A  ALE   LRG + +     LK  V         R+A +  +  +P W+ ++ E D  +
Sbjct: 476  AARALERGVLRGPRAAPGTAGLKDAVDAARLEAEKRMAEEGTSRELPRWK-KIHEADWTV 534

Query: 520  AVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEE 579
               LV  +   + PL             + I D  +     +  +  DE      L+ EE
Sbjct: 535  LSDLVTQLGNALAPLEAIA----DLTAPMPILDLAEAHARAVAAIAEDETGSPDELYAEE 590

Query: 580  EGKTLSSLFSKIIET-GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRL 638
             G   ++   +++    + ++    +W  ++T L+ G  V+ ++     + ILG LE+RL
Sbjct: 591  AGDVFAAFMVELLSAKDTGLELKPADWPAVLTALMSGHAVRRRLPGDPRVQILGPLEARL 650

Query: 639  LNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLI 698
              FD +ILG LNEG WP+ T  +P+L+R M+ DL L+  E+ IG +AHDF M  G + +I
Sbjct: 651  QQFDRVILGSLNEGTWPQKTRNDPWLNRPMKRDLGLEPPERRIGASAHDFCMGFGAKTVI 710

Query: 699  YTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTK-QPHYKRP 757
              R+ R +  PT+ASRWLQRL  L G D   ++  RG  Y D    +D          RP
Sbjct: 711  LARAARADGAPTVASRWLQRLTTLAGPDITKDMSGRGAVYSDLAEAIDRADGLVTPAPRP 770

Query: 758  KPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIIT 817
             P PP+  +P+  S +EI++LI DPYA++AR +L L  +     +P+  D+G + H+ + 
Sbjct: 771  NPAPPVAIRPKQLSVTEIERLIRDPYAIFARHVLDLQPVDPIGGEPNAADKGNIIHDALA 830

Query: 818  ELIKKRINK-NTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQS 876
            + +       N   + HL+  I +  F   +  P +  +W   F +I+  F+  E +   
Sbjct: 831  KFLSDWDGPFNETAVAHLV-SIGEKLFAPLDAFPSVRALWWPRFLRIADGFVAFEARRAP 889

Query: 877  SIEKIFVNIPAK--MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLID 934
             +E  ++ +     + + S+   L G ADRID++++G + I DYKTG  P  +  + L+ 
Sbjct: 890  KVEHRYLEVGGGVDLKLPSLDFLLKGRADRIDVMENGSIAILDYKTGQVPSLKQVEALLA 949

Query: 935  PQLSLEAAALKAGSFSQIDC-RKVANLFYIRLKQKFK--IDCITNDKKKYSADELSEKSL 991
            PQL LEAA +    F+ I   R  +   Y++LK      I+   N  K     EL E + 
Sbjct: 950  PQLPLEAAMITRAGFNDIPADRSFSEFLYLQLKGGTDPVIEAPRN-PKDCDLKELGEDAF 1008

Query: 992  KNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              L  +V      E  ++S  R+ ++ +I   +DHLARVAEW
Sbjct: 1009 ARLETLVVHYSKPETGYLSRARVMKERDIAGPFDHLARVAEW 1050


>gi|158422337|ref|YP_001523629.1| hypothetical protein AZC_0713 [Azorhizobium caulinodans ORS 571]
 gi|158329226|dbj|BAF86711.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 1015

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 327/1052 (31%), Positives = 525/1052 (49%), Gaps = 73/1052 (6%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENF--RYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
             VFTI  S+PF + +  A+L+G LV  F  R DPL    LAS TIY+PT+RA +      
Sbjct: 3    RVFTIPSSAPFLKTLAHAMLDGHLVPGFAPRGDPLA---LASATIYLPTRRAGRLFADAM 59

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPP--VSNIQRLLELARLILIWR 120
            +E  G ++ +LP I  LGDV E+   F+ +  L   L PP  V+ + R + LA L+  WR
Sbjct: 60   LEAVGGEAVLLPRIVPLGDVDEDALAFSEEAAL---LAPPQAVAGVHRRIALAGLVARWR 116

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
            + L +       E    +   PA  + LA  L  + D + T    W  L  L  E++  +
Sbjct: 117  DALAEG------EGQAMVAAGPAATMALADELGRLFDQMTTAGIAWSRLDDLVPEEHDAY 170

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL--MKGTKGPIIIAGSTGS 238
            + ++  FL+IA + W   L E+    P   + AL+ AE   L  +    GP+I AGSTGS
Sbjct: 171  FEISLQFLRIARQAWGAHLEEMGLVDPAERRDALVGAEERRLAALGAGAGPVIAAGSTGS 230

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +P TARL+  +A+ P GA+VLPGLD H+    +  +T ++T+          HPQ+ LAK
Sbjct: 231  LPTTARLLKAIASLPQGAVVLPGLDLHMEETAFQLLTAEATSAPD-------HPQFGLAK 283

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKC--F 356
            LL  L ++R DV  L   +   +GR  ++S++    +T++   +  L  ++P+ ++    
Sbjct: 284  LLGTLGLERRDVTALATPAP--WGREALLSEALRQSETAEQWAS--LSERLPDAKRAQAL 339

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
            ++V +++A + REEA+++A+ LR +L +   ++AL+T DR+LARRV  EL RFGI ID S
Sbjct: 340  AEVRVVKALDPREEALAVALELRDALTKPDMRAALVTHDRDLARRVAAELERFGIAIDDS 399

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            AG+PL+ T  + +   +   + +    + +  L+  P        + L+ A  ALEL+AL
Sbjct: 400  AGVPLAETQPARLARLVAKTVAEGCAPVPLFALLSQPGLSLDLAPEILAEAVAALELIAL 459

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
            RG +       L + V    A      H    + R+ E+ + LA  LV  ++  + PL  
Sbjct: 460  RGPRPRSGAAGLAAAV---AAFDAAKVHERDPRRRVGEDRQALAADLVARLVPALEPLSA 516

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVC--LDEHRKLPNLWFEEEGKTLSSLFSKIIET 594
                  +  G + ++D     +  ++++   LD     P  W        +SL   +I+ 
Sbjct: 517  L-----AEAGKVPLADLVAAHIATIESLTAPLDPDANDPA-W--------ASLAEALIDI 562

Query: 595  GSCIKANAI----EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLN 650
                 A        + D I+ L+    V+P+      + ILG LE+RL+  D ++LGGL 
Sbjct: 563  RDGAPAGPAMTLAAYADAISALLADRVVRPRQRGEERIRILGPLEARLVAVDRVVLGGLV 622

Query: 651  EGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPT 710
            EG WP  T  +P+LSR M+++L L   E+ IG AAHDF  A G R ++ T   +     +
Sbjct: 623  EGSWPPETRTDPWLSRPMRAELGLDQPERRIGLAAHDFAQAFGAREVVLTYPDKVGGTQS 682

Query: 711  IASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            + SR+LQRL  + G D +     RG+ +     +LD   + P   +P P PP E +P+  
Sbjct: 683  VPSRFLQRLSTVAGEDLWQAAIARGEAWRQAAARLDDGPRVPRAAQPAPKPPRELRPKKL 742

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            S +E++  + DPY+++AR +L L  +      P   +RG+  H+ +    K       P+
Sbjct: 743  SVTEVETFLRDPYSIFARHVLALQPLEALDAAPGGAERGSALHDALGAFAKDYPEDLPPD 802

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
             +  +       FEK  + P    IW   F +++   +E E + ++S++++       + 
Sbjct: 803  AHAQLLAYGRRAFEKLEVFPAEHAIWWARFERVAAFVVEFERERRASLKRVVAETGGGLP 862

Query: 891  IESI--GIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGS 948
            I  +     LTG ADRI++   G ++I DYKTG  P  +       PQL LEAA    G 
Sbjct: 863  IRLLHSDFQLTGRADRIEIRTDGELNILDYKTGTAPSAKQGATF-SPQLPLEAAMAVRGG 921

Query: 949  FSQIDCRKVANLFYIRLK-------QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLL 1001
            F  +    VAN  Y+ LK       +K  +D      +K SA  ++E +L+ L E++   
Sbjct: 922  FRDVPAANVANFLYVELKGGAVAGREKPGVD------EKSSAMAMAEDALERLRELLLAF 975

Query: 1002 QNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +N EQ + + L   +       YDHLARV EW
Sbjct: 976  ENEEQGYRA-LAAPQWRGRFGPYDHLARVREW 1006


>gi|298290317|ref|YP_003692256.1| double-strand break repair protein AddB [Starkeya novella DSM 506]
 gi|296926828|gb|ADH87637.1| double-strand break repair protein AddB [Starkeya novella DSM 506]
          Length = 1013

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 320/1042 (30%), Positives = 506/1042 (48%), Gaps = 46/1042 (4%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENF--RYDPLNPLLLASVTIYVPTKRAIQ 58
            M    PN+ TI  S+PF   +  ALL+G LVE F  R+DP     LAS T+++PT+RA +
Sbjct: 1    MSRPDPNLLTIPASAPFLAVLADALLDGRLVEGFAPRHDPFA---LASATVFLPTRRAGR 57

Query: 59   ELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPP--VSNIQRLLELARLI 116
             L            T+LP I  LGDV E+        S+  +PP  V  + R L LA L+
Sbjct: 58   LLAEALRARMESGVTLLPRIVPLGDVDEDSLA--FAESFT-DPPRAVPGMTRRLALASLV 114

Query: 117  LIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEK 176
              WR  L         +  +++   P     LA  LA +ID +  ++  WE L  L   +
Sbjct: 115  RRWRRLLAGD------DGRVAVAAGPGAEFALADALAHLIDEMAAQQVPWEKLDTLVPGQ 168

Query: 177  YGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGST 236
            + ++W +A DFLKIA ++W   L EL A      +  L+ AEAE L     GP+I AGST
Sbjct: 169  HDLYWDMALDFLKIAREFWPALLDELGAVDASVRRDRLIAAEAERLRAAPAGPVIAAGST 228

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSL 296
            GS+PATARL++ VA+  +G +VLPGLD  +    W+       ++T       +HPQY L
Sbjct: 229  GSMPATARLLAAVAHLTDGCVVLPGLDTDLDARSWD-------HLTDDEAPAPSHPQYGL 281

Query: 297  AKLLD-FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKC 355
            A LL   + + R+ V+ L   +   +GR  ++S++  P  +++   +         I   
Sbjct: 282  ALLLKAHMRVGRDAVRSLAPPAP--HGRERLLSEALRPVASTEAWASLAERLGAAEIDAA 339

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
             ++V++IEAD+ REEA++IA+ALR +L+E  + +AL+T DR+LARRV  EL RF + ID 
Sbjct: 340  LAEVSVIEADDAREEALAIAVALREALEEPGRSAALVTPDRDLARRVAAELLRFEVAIDD 399

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            SAG PLS +        + +A       + ++ L++HPLA+FG     L +A +ALEL+ 
Sbjct: 400  SAGEPLSESAPGRFARLVADACDAELAPVPLSALLRHPLARFGLERGALDQAADALELMV 459

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            LRG +          LV           H    ++ +  + + LA  L + I +   PL+
Sbjct: 460  LRGPRPEAGA---DGLVRAVAGFSPGLHHSSDPRAAIDTDRQALAAGLAERIARAFGPLL 516

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
                 ++     L             ++    E      +   E  KT  ++     E  
Sbjct: 517  ALGAGEHPFATLLEAHRAAVAAAWSAEDGGAAED----AIALAELSKTFEAMAEGASE-- 570

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
            + +   A     +   L D   V+P +   + L ILG LE+RL++ D ++L GL EG WP
Sbjct: 571  APVMRLADYAAALPLLLAD-RPVRPPLLPGARLRILGPLEARLVSVDRMVLAGLVEGTWP 629

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
                 +P+LSR M++ L L+  E+ IG +AHDF    G   LI +   +    PT+ SR+
Sbjct: 630  SAVRTDPWLSRPMRAALGLEAPERRIGLSAHDFAQGCGAPELILSHPRKLGGAPTVPSRF 689

Query: 716  LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
            LQRL  + G   +   K RG  +      ++         RP+P PP+E +P+  S +EI
Sbjct: 690  LQRLEAVSGEARWKMAKLRGDRFRRLAALIEEAPAASRIARPEPAPPVELRPKRLSVTEI 749

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKK--RINKNTPEINH 833
            +  + DPY +YAR +L+L  +    + P   +RG+  H+ +    +         PE   
Sbjct: 750  ETWLRDPYTIYARHVLRLRPLDMLDEAPGAAERGSAIHDALGAFAQAFPEALPAEPEAG- 808

Query: 834  LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIES 893
            L+    ++  E E  P    + W   F ++   ++  E   ++   ++F  +  +MA+  
Sbjct: 809  LLAFGREAFRELEAFPAEYALWWAR-FERLVPRYIGWERARRADTRRVFAELGGRMALAG 867

Query: 894  IGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
                LTG ADRI+ L+ G + I D+KTG  P  +       PQL LEAA   AG F  + 
Sbjct: 868  GRFALTGRADRIEQLREGGLAIIDFKTGAVPTAKQTAAHYSPQLPLEAAMAAAGGFRDLP 927

Query: 954  CRKVANLFYIRL--KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISH 1011
                A L Y+RL   +  ++  +  D+  +    L+  +L+ L +++   ++  + + S 
Sbjct: 928  AEGAAALTYVRLGTSELKEVGAVDRDETAFG---LAASTLERLEQLIATFEDPSRGYASL 984

Query: 1012 LRLSEKSNIQSEYDHLARVAEW 1033
             R   +     +YDHLARV EW
Sbjct: 985  ARPMFRGRF-GDYDHLARVKEW 1005


>gi|218682570|ref|ZP_03530171.1| double-strand break repair protein AddB [Rhizobium etli CIAT 894]
          Length = 898

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/522 (43%), Positives = 323/522 (61%), Gaps = 11/522 (2%)

Query: 523  LVDHILQCITPLVT----YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFE 578
            L   + +   PL +    ++        + ++S+W + T   L+ V  D    L +LW  
Sbjct: 365  LARRVTRATEPLASALLRHRPEDRGRTVSFTLSEWAERTGRSLEAVAADSRGNLADLWSG 424

Query: 579  EEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRL 638
            E G  L++L  ++I+T   I+A+  +WIDI+  L  G  VKP+      LFI GTLE+RL
Sbjct: 425  EAGDALAALLGEVIDTDGQIEADGPQWIDIMAALAAGHAVKPRALSHPRLFIFGTLEARL 484

Query: 639  LNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLI 698
             + DTLILGGLNEG WP  TA NPF+ R+M++++ L+  E+ IGQ AHDFEMANGTRHLI
Sbjct: 485  QSVDTLILGGLNEGTWPGQTANNPFIPRMMKTEIGLEPPERRIGQLAHDFEMANGTRHLI 544

Query: 699  YTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPK 758
            Y+RSLR+ + PT+ASRWLQRLL L G  F   LK RG  +L W   +D    Q   +RP 
Sbjct: 545  YSRSLRQGSTPTVASRWLQRLLALAGEAFESELKGRGNRFLRWAALIDRDEAQAPAQRPS 604

Query: 759  PFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITE 818
            P PP+  QP +YSFSE+ +L  DPYA+YARRIL+LD +  F +DP   +RGTL+H II  
Sbjct: 605  PKPPVALQPTSYSFSEVGRLRRDPYAIYARRILRLDPVDAFNRDPGAAERGTLYHKIIDR 664

Query: 819  LIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSI 878
             I++     TP+    M++I+   F+ E+LPPHID +WR  F  ++ +FLE E + +  I
Sbjct: 665  FIREAHVAGTPDAAAAMERILSELFDMEHLPPHIDAVWRPRFRAVARAFLEWEAERRPGI 724

Query: 879  EKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLS 938
             K    +   + +E+I I LTG ADRID+      DI DYKTG NP    A+ L+DPQL+
Sbjct: 725  RKTLTEVRGGVELEAINIRLTGVADRIDVTGPNAADIIDYKTGYNPSPAQARVLLDPQLA 784

Query: 939  LEAAALKAGSFSQIDCRKVANLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSL 991
            LEAAAL AG+F         +L Y+RL+  ++F++D + N+      K  SA +L+E+SL
Sbjct: 785  LEAAALSAGAFRDAGSLVPQDLLYVRLRPGRRFQVDTVNNESAARSDKTKSAMDLAEESL 844

Query: 992  KNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              L++ V LLQ+GE+ F S L  +++ +   +YDHLARV+EW
Sbjct: 845  DQLVKFVGLLQSGEKGFTSRLIPAQQFDFGGDYDHLARVSEW 886



 Score =  191 bits (484), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 146/244 (59%), Gaps = 7/244 (2%)

Query: 121 NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
           NKLPDI++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L  L    Y  W
Sbjct: 1   NKLPDIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSELTKLDTGDYAAW 60

Query: 181 WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK--GPIIIAGSTGS 238
           W L A+FL+IAS +W ERL EL  SSP  ++ A++RAEA  L   TK  GPIIIAGSTGS
Sbjct: 61  WQLTAEFLQIASAFWPERLSELGKSSPARHRNAILRAEASRL-SATKPAGPIIIAGSTGS 119

Query: 239 IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
           +PATA L++ VAN P G IVLPGLD  +P   W  +  +      +N    +HPQY L+ 
Sbjct: 120 VPATADLIAAVANMPEGVIVLPGLDLSMPEKDWQMVAPEPAPGQHANPASRSHPQYGLSS 179

Query: 299 LLDFLDIKREDVKRLGNVSNEMYGRSMVI--SKSFLPPDT--SDMRNTDILENKIPNIQK 354
           LL  L + R DV  L     ++  R+ V+      +  D     M         + ++++
Sbjct: 180 LLKRLKLTRADVTLLDRPEADLERRAEVLLSGAHAIGGDQRLGGMEERAAWAGSVFSLRR 239

Query: 355 CFSD 358
           CF+D
Sbjct: 240 CFAD 243


>gi|148251711|ref|YP_001236296.1| DNA helicase/exodeoxyribonuclease V subunit B [Bradyrhizobium sp.
            BTAi1]
 gi|146403884|gb|ABQ32390.1| DNA helicase/exodeoxyribonuclease V, subunit B [Bradyrhizobium sp.
            BTAi1]
          Length = 1048

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 324/1066 (30%), Positives = 510/1066 (47%), Gaps = 69/1066 (6%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENF--RYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
             VFT+  S+PF R +I AL++G LV+ F  R DP     LA+ T+Y+PT+R+++  R  F
Sbjct: 2    RVFTVPISAPFLRSVIAALVDGRLVDGFEARSDPAR---LATATLYLPTRRSLRVAREMF 58

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTAD---LLLSYNLNPP--VSNIQRLLELARLIL 117
            ++     + +LP + +LGD+ E++  F  D    L    L  P  ++++QR L LARL+ 
Sbjct: 59   LDELKTDAAVLPRLVALGDIDEDELAFAEDRDAFLGPAPLEIPERLADLQRRLTLARLVA 118

Query: 118  IWRNKLPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKN 174
             W             ++P+S P+    PA+ + LA +LA +ID + T    WE L AL  
Sbjct: 119  AWA------------KTPVSAPLVIGGPASTLALAGDLARLIDDMVTRGVSWEALDALVP 166

Query: 175  EKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAG 234
            ++   +W  + +FL+IA   W   L E+    P   +  L+ AEA  L     GP+I AG
Sbjct: 167  DQLDKYWQYSLEFLRIARTAWPAYLQEIERIEPAARRDLLIAAEAARLSAHPDGPVIAAG 226

Query: 235  STGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYST-HPQ 293
            STGS+PATA+ +  VA  P+GA+VLPGLD  +  A WN+I           T  +  HPQ
Sbjct: 227  STGSMPATAKFLLAVAKLPHGAVVLPGLDTDLDEAAWNSIGGAKDRAGRVITPPAVNHPQ 286

Query: 294  YSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD-----MRNTDILENK 348
            Y++  LL    ++R DV RL +      GR ++IS++  P + +      +R  D+  N 
Sbjct: 287  YAMHLLLKRFGLERRDVIRLAHPGRG--GREVLISEAMRPSEATAVWHERLRQLDVAAN- 343

Query: 349  IPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTR 408
               I +   ++A++ A N   EA++IAIA+R +     K +AL+T DR LARRV   LTR
Sbjct: 344  ---IAEAMDNLAVVAAPNPEMEALAIAIAMREA-RHLGKSAALVTPDRTLARRVMAALTR 399

Query: 409  FGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAK 468
            + +  D S G  L  T           A  +  +   +  L+KHPL + G   K  + A 
Sbjct: 400  WHLTFDDSGGDALLETPAGIFARLAAEAAARSLEPPTLLALLKHPLCRLGRAAKGWTSAI 459

Query: 469  NALELVALRGNKN-------SYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAV 521
              LEL  LRG +        + D    +         + ++ H    ++RLS E  + A 
Sbjct: 460  ETLELAMLRGTRPQAGTSGLARDFARFRDEHTRLHQGEASSLHRAEPRARLSPEQLDRAG 519

Query: 522  LLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG 581
             L+  +   + PL    + +      L+      L      +V L         + + +G
Sbjct: 520  ALIAQLQTALAPLENLASPRPQDFAELAARHREVLIALSTDDVGLS------TAFTDRDG 573

Query: 582  KTLSSLFSKIIETGS-C-IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLL 639
              L+  F  ++ +G  C + A   ++ D+         V+      + L I G LE+RL+
Sbjct: 574  AALARCFDDLLASGERCGLMAPLSDYPDLFHTAFSDRAVRRPERHGAQLQIYGPLEARLM 633

Query: 640  NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIY 699
              D +I+GGL EGVWP     +P+LSR M+  L L   E+ IG +AHDF    G   +I 
Sbjct: 634  QADRMIIGGLIEGVWPPAPRIDPWLSRPMRHQLGLDLPERRIGLSAHDFAQLLGAPEVIL 693

Query: 700  TRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKP 759
            T + +    P +ASR+L RL  + G D +     RG+ Y+ +   LD   +    ++P P
Sbjct: 694  THAAKSGGAPAVASRFLHRLEAVAGADRWKAATARGETYVRYAEVLDQPPEVKPVEQPAP 753

Query: 760  FPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITEL 819
             PPL A+P   S + I+  + DPY ++AR ILKLD +          DRG+  H  I E 
Sbjct: 754  KPPLAARPLRMSVTAIEDWLRDPYTIFARYILKLDPLDPVDMPLSAADRGSAIHEAIGEF 813

Query: 820  IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
             +   +   P+   +++QI + HF      P    +W   F +I+  F   E   +  I 
Sbjct: 814  TQTYADALPPDPAPVLRQIGEKHFAPLMERPEARALWWPRFQRIAGWFAAWESARREQIG 873

Query: 880  KIFVNIPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQ 936
             I   I  ++ I         L+  ADRI+    G   I DYKTG  P  +  +  + PQ
Sbjct: 874  AITAEIRGEIGIPLSPDRTFILSARADRIERRAEGTYAILDYKTGQPPTAKQVRMGLSPQ 933

Query: 937  LSLEAAALKAGSFSQIDCRK-VANLFYIRL--------KQKFKIDCITNDKKKYSADELS 987
            L+LEAA L+ G F  I     ++ L YIRL        ++  ++    +D  ++  D+ +
Sbjct: 934  LTLEAAILREGGFDGIPAGSLISQLVYIRLSGNNPPGEERILELKINKSDPPQHP-DQAA 992

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +++   L  ++   ++  Q + S L LS  +N    YD LAR+ EW
Sbjct: 993  QEARAKLEALIRSFEDINQGYTS-LNLSMWANRYGAYDDLARIKEW 1037


>gi|254563797|ref|YP_003070892.1| hypothetical protein METDI5474 [Methylobacterium extorquens DM4]
 gi|254271075|emb|CAX27082.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 1047

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 337/1069 (31%), Positives = 519/1069 (48%), Gaps = 72/1069 (6%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VFTI P +PF   +  AL++G LV     DP     LASVT+Y+PT+RA++ L +
Sbjct: 4    SAAPRVFTIPPGAPFLPTLADALVSGRLVGAVGGDPFA---LASVTLYLPTQRAVRALST 60

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN---------LNPPVSNIQRLLELA 113
               +  G  + +LP +  LG+  E    A+L LS N         L P +  ++R L LA
Sbjct: 61   VLAQRLGG-AALLPRMIPLGEADE----AELDLSSNTLLETPEDLLYPSIPALERRLILA 115

Query: 114  RLILIWRNKLPDIIKDLYP---ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLH 170
            RL+  W      + ++L P   E P  +P SPA+A+ LA +L  ++D +  E   W ++ 
Sbjct: 116  RLVQKWAET---VDRELLPIDDEVPFLVPSSPADAVALAADLEGLMDALTVEGLPWSEIA 172

Query: 171  ALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-P 229
            A    ++  ++ L  DFLKIA+++W + L   + + P      L+ AEA+ L +   G P
Sbjct: 173  AAVEAEHSRYFRLTLDFLKIAAEHWPDILAARSLADPTARARRLVLAEADRLFRERPGDP 232

Query: 230  IIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS 289
            +I+AGSTGS+PATARL++ VA  P GA+VLPGLD H+    W  I          +    
Sbjct: 233  VIVAGSTGSVPATARLIAAVARLPRGAVVLPGLDLHLDAEGWEAIDGAGGK---HDEIAH 289

Query: 290  THPQYSLAKLLD--FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN 347
             HPQ  L  L       ++R DV+ LG++S E   R  ++S++  P +T+D         
Sbjct: 290  GHPQAILRALTGPRGFAVERRDVETLGDLSPEAVAREKLLSQALRPAETTDAWAGLDAAE 349

Query: 348  KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            ++   ++  + +A++EA +EREEA+  A+ALR +L+     +AL+T DR LA RV  EL 
Sbjct: 350  RMTLAREGMAGLAVVEAADEREEALVAALALRETLETPGATAALVTPDRGLALRVSAELA 409

Query: 408  RFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
            R+GI  + SAG+ L+ +        +     ++     IA L+ HP  + G     + RA
Sbjct: 410  RWGIAAEDSAGLSLARSQAGRFARLVAELAAEVAPARVIA-LLAHPFVRLGLTRSEVVRA 468

Query: 468  KNALELVALRG----NKNSYDIMDLKSLVLDRIATQKNNT-HVPHWQSRLSEEDKELAVL 522
              ALE+  LRG     KNS+D M         +A Q+N T  VP  + RL   D +LA  
Sbjct: 469  AAALEIGGLRGPAPIPKNSFDGMRAA------VALQRNATERVPRAKKRLKPVDWDLAED 522

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL-----PNLWF 577
            ++D +      L  ++T+     GNL ++        C + +   E         P+L  
Sbjct: 523  ILDRLEIA---LDAFRTDLQPEIGNL-VALAAGHREACERMMGGAEEGDADETDDPSL-- 576

Query: 578  EEEGKTLSSLFSKIIETGSC--IKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTL 634
                 TL  LF   +E+     +     ++    T L    TV   +      L ILG L
Sbjct: 577  ----DTLDGLFDD-LESAEQEELPGRFSDYAAFFTALARDRTVACAQRSAHPRLRILGPL 631

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            E+RLL+ D ++LGGL+E VWP     + FLSR M+ D+ L   E+ IGQAAHDF    GT
Sbjct: 632  EARLLSVDRIVLGGLDETVWPVRQTTDAFLSRPMRGDVGLSPPERRIGQAAHDFVQGLGT 691

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ--P 752
               + TR+ +    PT+ SR+LQRL   GG   + +   RGQ       +LD   +   P
Sbjct: 692  HDAVVTRAAKREGSPTVPSRFLQRLRAFGGDAVWADAIARGQRLRGLAARLDRGQEAPPP 751

Query: 753  HYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF 812
              KRP P P     P   S +EI+ L+ DPY++YAR IL L+ +      P   +RG+L 
Sbjct: 752  RLKRPAPKPDPALFPERLSVTEIETLVRDPYSIYARHILGLEALEPIAVVPGAAERGSLI 811

Query: 813  HNIITELIKKRINKNTPEINHLMKQI-IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
            H ++ +  +        +   L+  I  D+    ++  P +   W   + +++ +FLE E
Sbjct: 812  HKVLGDFSQAHPGALPADAETLLYAIAFDAFGPLQDQYPELYAEWFPRYERMAVAFLEWE 871

Query: 872  EKIQSSIEKIFVNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928
               +  +  I      K+ I  +G     L+  ADRI++   G   I D+KTG  P   T
Sbjct: 872  ASQRQGLHTIHAERSGKVTI-PLGERTFTLSARADRIEVRADGSYCIVDFKTGTPPSNRT 930

Query: 929  AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFK-IDCITNDKKKYSAD 984
                  PQL+LEAA L  G+F  +      +L YI     ++ F+ I          + +
Sbjct: 931  VFAGFSPQLTLEAAMLMHGAFEGLKAAAPPDLLYIYASGGREPFRPIPVKPPPGDARAVE 990

Query: 985  ELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             + E+  + L  ++     GE  ++S     +     +EYDHLARV EW
Sbjct: 991  AVVEEHWQRLRGLIARYMTGEAAYLSR-PYPQYERAYNEYDHLARVLEW 1038


>gi|163853835|ref|YP_001641878.1| double-strand break repair protein AddB [Methylobacterium extorquens
            PA1]
 gi|163665440|gb|ABY32807.1| double-strand break repair protein AddB [Methylobacterium extorquens
            PA1]
          Length = 1047

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 334/1069 (31%), Positives = 519/1069 (48%), Gaps = 72/1069 (6%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VFTI P +PF   +  AL++G LV     DP     LASVT+Y+PT+RA++ L +
Sbjct: 4    SAAPRVFTIPPGAPFLPTLADALVSGRLVGAVGGDPFA---LASVTLYLPTQRAVRALST 60

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN---------LNPPVSNIQRLLELA 113
               +  G  + +LP +  LG+  E    A+L LS N         L P +  ++R L LA
Sbjct: 61   VLAQRLGG-AALLPRMIPLGEADE----AELDLSSNTLLETPEDLLYPSIPALERRLILA 115

Query: 114  RLILIWRNKLPDIIKDLYP---ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLH 170
            RL+  W      + ++L P   E P  +P SPA+A+ LA +L  ++D +  E   W ++ 
Sbjct: 116  RLVQKWAET---VDRELLPIDDEVPFLVPSSPADAVALAADLEGLMDALTVEGLPWSEIA 172

Query: 171  ALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-P 229
            A    ++  ++ L  DFLKIA+++W + L   + + P      L+ AEA+ L +   G P
Sbjct: 173  AAVEAEHSRYFRLTLDFLKIAAEHWPDILAARSLADPTARARRLVLAEADRLFRERPGDP 232

Query: 230  IIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS 289
            +I+AGSTGS+PATARL++ VA  P GA+VLPGLD H+    W+ I          +    
Sbjct: 233  VIVAGSTGSVPATARLIAAVARLPRGAVVLPGLDLHLDAEGWDAIDGAGGK---HDEIAH 289

Query: 290  THPQYSLAKLLD--FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN 347
             HPQ  L  L       ++R DV+ LG++S E   R  ++S++  P +T+D         
Sbjct: 290  GHPQAILRALTGPRGFAVERRDVETLGDLSPEAVAREKLLSQALRPAETTDAWAGLDAAE 349

Query: 348  KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            ++   ++  + +A++EA +EREEA+  A+ALR +L+     +AL+T DR LA RV  EL 
Sbjct: 350  RMTLAREGMAGLAVVEAADEREEALVAALALRETLETPGATAALVTPDRGLALRVSAELA 409

Query: 408  RFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
            R+GI  + SAG+ L+ +        +     ++     IA L+ HP  + G     + RA
Sbjct: 410  RWGIAAEDSAGLSLARSQAGRFARLVAELAAEVAPARVIA-LLAHPFVRLGLTRSEVVRA 468

Query: 468  KNALELVALRG----NKNSYDIMDLKSLVLDRIATQKNNT-HVPHWQSRLSEEDKELAVL 522
              ALE+  LRG     KNS+D M         +A Q+N T  VP  + RL   D +LA  
Sbjct: 469  AAALEIGGLRGPAPIPKNSFDGMRAA------VALQRNATERVPRAKKRLKPVDWDLAED 522

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL-----PNLWF 577
            ++D +   +     ++T+     GNL ++        C + +   E         P+L  
Sbjct: 523  ILDRLEIALD---AFRTDLQPEIGNL-VALAAGHREACERMMGGAEEGDADESDDPSL-- 576

Query: 578  EEEGKTLSSLFSKIIETGSC--IKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTL 634
                 TL  LF   +E+     +     ++    T L    TV   +      L ILG L
Sbjct: 577  ----DTLDGLFDD-LESAEQEELPGRFSDYAAFFTALARDRTVACAQRSAHPRLRILGPL 631

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            E+RLL+ D ++LGGL+E VWP     + FL+R M+ D+ L   E+ IGQAAHDF    GT
Sbjct: 632  EARLLSVDRIVLGGLDETVWPVRQTTDAFLNRPMRGDVGLSPPERRIGQAAHDFVQGLGT 691

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLD--YTTKQP 752
               + TR+ +    PT+ SR+LQRL   GG   + +   RGQ       +LD       P
Sbjct: 692  HDAVVTRAAKREGSPTVPSRFLQRLRAFGGDAVWADAIARGQRLRGLAARLDRGQAAPPP 751

Query: 753  HYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF 812
              KRP P P     P   S +EI+ L+ DPY++YAR IL L+ +      P   +RG+L 
Sbjct: 752  RLKRPAPKPDPALFPERLSVTEIETLVRDPYSIYARHILGLEALEPIAVVPGAAERGSLI 811

Query: 813  HNIITELIKKRINKNTPEINHLMKQI-IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
            H ++ +  +        +   L+  I  D+    ++  P +   W   + +++ +FLE E
Sbjct: 812  HKVLGDFSQAHPGALPADAETLLYAIAFDAFGPLQDQYPELYAEWFPRYERMAVAFLEWE 871

Query: 872  EKIQSSIEKIFVNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928
             + +  +  I      K+ I  +G     L+  ADRI+    G   I D+KTG  P   T
Sbjct: 872  ARQRQGLHTIHAERSGKVTI-PLGERTFTLSARADRIEARADGSYCIVDFKTGTPPSNRT 930

Query: 929  AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFK-IDCITNDKKKYSAD 984
                  PQL+LEAA L  G+F  +      +L Y+     ++ F+ I          + +
Sbjct: 931  VFAGFSPQLTLEAAMLMHGAFEGLKAASPPDLLYVYASGGREPFRPIPVKPPPGDARAVE 990

Query: 985  ELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             + E+  + L  ++     GE  ++S     +     +EYDHLARV EW
Sbjct: 991  AVVEEHWQRLRGLIARYMTGEAAYLSR-PYPQYERAYNEYDHLARVLEW 1038


>gi|218532780|ref|YP_002423596.1| double-strand break repair protein AddB [Methylobacterium
            chloromethanicum CM4]
 gi|218525083|gb|ACK85668.1| double-strand break repair protein AddB [Methylobacterium
            chloromethanicum CM4]
          Length = 1047

 Score =  446 bits (1146), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 334/1069 (31%), Positives = 518/1069 (48%), Gaps = 72/1069 (6%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VFTI P +PF   +  AL++G LV     DP     LASVT+Y+PT+RA++ L +
Sbjct: 4    SAAPRVFTIPPGAPFLPTLADALVSGRLVGAVGGDPFA---LASVTLYLPTQRAVRALST 60

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN---------LNPPVSNIQRLLELA 113
               +  G  + +LP +  LG+  E    A+L LS N         L P +  ++R L LA
Sbjct: 61   VLAQRLGG-AALLPRMIPLGEADE----AELDLSSNTLLETPEDLLYPSIPALERRLILA 115

Query: 114  RLILIWRNKLPDIIKDLYP---ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLH 170
            RL+  W      + ++L P   E P  +P SPA+A+ LA +L  ++D +  E   W ++ 
Sbjct: 116  RLVQKWAET---VDRELLPIDDEVPFLVPSSPADAVALAADLEGLMDALTVEGLPWSEIA 172

Query: 171  ALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-P 229
            A    ++  ++ L  DFLKIA+++W + L   + + P      L+ AEA+ L +   G P
Sbjct: 173  AAVEAEHSRYFRLTLDFLKIAAEHWPDILAARSLADPTARARRLVLAEADRLFRERPGDP 232

Query: 230  IIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS 289
            +I+AGSTGS+PATARL++ VA  P GA+VLPGLD H+    W  I          +    
Sbjct: 233  VIVAGSTGSVPATARLIAAVARLPRGAVVLPGLDLHLDAEGWEAIDGAGGK---HDEIAH 289

Query: 290  THPQYSLAKLLD--FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN 347
             HPQ  L  L       ++R DV+ LG++S E   R  ++S++  P +T+D         
Sbjct: 290  GHPQAILRALTGPRGFAVERRDVETLGDLSPEAVAREKLLSQALRPAETTDAWAGLDAAE 349

Query: 348  KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            ++   ++  + +A++EA +EREEA+  A+ALR +L+     +AL+T DR LA RV  EL 
Sbjct: 350  RMTLAREGMAGLAVVEAADEREEALVAALALRETLETPGATAALVTPDRGLALRVSAELA 409

Query: 408  RFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
            R+GI  + SAG+ L+ +        +     ++     IA L+ HP  + G     + RA
Sbjct: 410  RWGIAAEDSAGLSLARSQAGRFARLVAELAAEVAPARVIA-LLAHPFVRLGLTRSEVVRA 468

Query: 468  KNALELVALRG----NKNSYDIMDLKSLVLDRIATQKNNT-HVPHWQSRLSEEDKELAVL 522
              ALE+  LRG     KNS+D M         +A Q+N T  VP  + RL   D +LA  
Sbjct: 469  AAALEIGGLRGPAPIPKNSFDGMRAA------VALQRNATERVPRAKKRLKPVDWDLAED 522

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL-----PNLWF 577
            ++D +   +     ++T+     GNL ++        C + +   E         P+L  
Sbjct: 523  ILDRLEIALD---AFRTDLQPEIGNL-VALAAGHREACERMMGGAEESDADEADDPSL-- 576

Query: 578  EEEGKTLSSLFSKIIETGSC--IKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTL 634
                 TL  LF   +E+     +     ++    T L    TV   +      L ILG L
Sbjct: 577  ----DTLDGLFDD-LESAEQEELPGRFSDYAAFFTALARDRTVACAQRSAHPRLRILGPL 631

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            E+RLL+ D ++LGGL+E VWP     + FL+R M+ D+ L   E+ IGQAAHDF    GT
Sbjct: 632  EARLLSVDRIVLGGLDETVWPVRQTTDAFLNRPMRGDVGLSPPERRIGQAAHDFVQGLGT 691

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ--P 752
               + TR+ +    PT+ SR+LQRL   GG   + +   RGQ       +LD   +   P
Sbjct: 692  HDAVVTRAAKREGSPTVPSRFLQRLRAFGGDAVWADAIARGQRLRGLAARLDRGQEAPPP 751

Query: 753  HYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF 812
              KRP P P     P   S +EI+ L+ DPY++YAR IL L+ +      P   +RG+L 
Sbjct: 752  RLKRPAPKPDPALFPERLSVTEIETLVRDPYSIYARHILGLEALEPIAVVPGAAERGSLI 811

Query: 813  HNIITELIKKRINKNTPEINHLMKQI-IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
            H ++ +  +        +   L+  I  D+    ++  P +   W   + +++ +FLE E
Sbjct: 812  HKVLGDFSQAHPGALPADAETLLYAIAFDAFGPLQDQYPELYAEWFPRYERMAVAFLEWE 871

Query: 872  EKIQSSIEKIFVNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928
               +  +  I      K+ I  +G     L+  ADRI+    G   I D+KTG  P   T
Sbjct: 872  ASQRQGLHTIHAERSGKVTI-PLGERTFTLSARADRIEARADGSYCIVDFKTGTPPSNRT 930

Query: 929  AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFK-IDCITNDKKKYSAD 984
                  PQL+LEAA L  G+F  +      +L Y+     ++ F+ I          + +
Sbjct: 931  VFAGFSPQLTLEAAMLMHGAFEGLKAASPPDLLYVYASGGREPFRPIPVKPPPGDARAVE 990

Query: 985  ELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             + E+  + L  ++     GE  ++S     +     +EYDHLARV EW
Sbjct: 991  AVVEEHWQRLRGLIARYMTGEAAYLSR-PYPQYERAYNEYDHLARVLEW 1038


>gi|240141288|ref|YP_002965768.1| hypothetical protein MexAM1_META1p4882 [Methylobacterium extorquens
            AM1]
 gi|240011265|gb|ACS42491.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 1047

 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 334/1069 (31%), Positives = 517/1069 (48%), Gaps = 72/1069 (6%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VFTI P +PF   +  AL++G LV     DP     LASVT+Y+PT+RA++ L +
Sbjct: 4    SAAPRVFTIPPGAPFLPTLADALVSGRLVGAVGGDPFA---LASVTLYLPTQRAVRALST 60

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN---------LNPPVSNIQRLLELA 113
               +  G  + +LP +  LG+  E    A+L LS N         L P +  ++R L LA
Sbjct: 61   VLAQRLGG-AALLPRMIPLGEADE----AELDLSSNTLLETPEDLLYPSIPALERRLILA 115

Query: 114  RLILIWRNKLPDIIKDLYP---ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLH 170
            RL+  W      + ++L P   E P  +P SPA+A+ LA +L  ++D +  E   W ++ 
Sbjct: 116  RLVQKWAET---VDRELLPIDDEVPFLVPSSPADAVALAADLEGLMDALTVEGLPWSEIA 172

Query: 171  ALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-P 229
            A    ++  ++ L  DFLKIA+++W + L   + + P      L+ AEA+ L +   G P
Sbjct: 173  AAVEAEHSRYFRLTLDFLKIAAEHWPDILAARSLADPTARARRLVLAEADRLFRERPGDP 232

Query: 230  IIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS 289
            +I+AGSTGS+PATARL++ VA  P GA+VLPGLD H+    W  I          +    
Sbjct: 233  VIVAGSTGSVPATARLIAAVARLPRGAVVLPGLDLHLDAEGWEAIDGAGGK---HDEIAH 289

Query: 290  THPQYSLAKLLD--FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN 347
             HPQ  L  L       ++R DV+ LG++S E   R  ++S++  P +T+D         
Sbjct: 290  GHPQAILRALTGPRGFAVERRDVETLGDLSPEAVAREKLLSQALRPAETTDAWAGLDAAE 349

Query: 348  KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            ++   ++  + +A++EA +EREEA+  A+ALR +L+     +AL+T DR LA RV  EL 
Sbjct: 350  RMTLAREGMAGLAVVEAADEREEALVAALALRETLETPGATAALVTPDRGLALRVSAELA 409

Query: 408  RFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
            R+GI  + SAG+ L+ +        +     ++     IA L+ HP  + G     + RA
Sbjct: 410  RWGIAAEDSAGLSLARSQAGRFARLVAELAAEVAPARVIA-LLAHPFVRLGLTRSEVVRA 468

Query: 468  KNALELVALRG----NKNSYDIMDLKSLVLDRIATQKNNT-HVPHWQSRLSEEDKELAVL 522
              ALE+  LRG     KNS+D M         +A Q+N T  VP  + RL   D +LA  
Sbjct: 469  AAALEIGGLRGPAPIPKNSFDGMRAA------VALQRNATERVPRAKKRLKPVDWDLAED 522

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL-----PNLWF 577
            ++D +      L  ++T+     GNL ++        C + +   +         P+L  
Sbjct: 523  ILDRLEIA---LDAFRTDLQPEIGNL-VALAAGHREACERMMGEADEGDADETDDPSL-- 576

Query: 578  EEEGKTLSSLFSKIIETGSC--IKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTL 634
                 TL  LF   +E+     +     ++    T L    TV   +      L ILG L
Sbjct: 577  ----DTLDGLFDD-LESAEQEELPGRFSDYAAFFTALSRDRTVACAQRSAHPRLRILGPL 631

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            E+RLL+ D ++LGGL+E VWP     + FL+R M+ D+ L   E+ IGQAAHDF    GT
Sbjct: 632  EARLLSVDRIVLGGLDETVWPVRQTTDAFLNRPMRGDVGLSPPERRIGQAAHDFVQGLGT 691

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ--P 752
               + TR+ +    PT+ SR+LQRL   GG   + +   RGQ       +LD   +   P
Sbjct: 692  HDAVVTRAAKREGSPTVPSRFLQRLRAFGGDAVWADAIARGQRLRGLAARLDRGQEAPPP 751

Query: 753  HYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF 812
              KRP P P     P   S +EI+ L+ DPY++YAR IL L+ +      P   +RG+L 
Sbjct: 752  RLKRPAPKPDPALFPERLSVTEIETLVRDPYSIYARHILGLEALEPIAVVPGAAERGSLI 811

Query: 813  HNIITELIKKRINKNTPEINHLMKQI-IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
            H ++ +           +   L+  I  D+    ++  P +   W   + +++ +FLE E
Sbjct: 812  HKVLGDFSAAHPGALPADAETLLYAIAFDAFGPLQDQYPELYAEWFPRYERMAVAFLEWE 871

Query: 872  EKIQSSIEKIFVNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928
               +  +  I      K+ I  +G     L+  ADRI+    G   I D+KTG  P   T
Sbjct: 872  ASQRQGLHTIHAERSGKVTI-PLGERTFTLSARADRIEARADGSYCIVDFKTGTPPSNRT 930

Query: 929  AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFK-IDCITNDKKKYSAD 984
                  PQL+LEAA L  G+F  +      +L Y+     ++ F+ I          + +
Sbjct: 931  VFAGFSPQLTLEAAMLMHGAFEGLKAASPPDLLYVYASGGREPFRPIPVKPPPGDARAVE 990

Query: 985  ELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             + E+  + L  ++     GE  ++S     +     +EYDHLARV EW
Sbjct: 991  AVVEEHWQRLRGLIARYMTGEAAYLSR-PYPQYERAYNEYDHLARVLEW 1038


>gi|27375864|ref|NP_767393.1| hypothetical protein bll0753 [Bradyrhizobium japonicum USDA 110]
 gi|27349002|dbj|BAC46018.1| bll0753 [Bradyrhizobium japonicum USDA 110]
          Length = 1048

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 320/1061 (30%), Positives = 511/1061 (48%), Gaps = 59/1061 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF++  S PF R ++ ALL+G LV  F      P  LA  T+Y+PT+RA++ +R  F++
Sbjct: 2    RVFSVPISVPFLRTVVTALLDGRLVAGFEAR-REPARLADTTLYLPTRRAMRIVREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVE---------EKFTADLLLSYNLNPPVSNIQRLLELARLIL 117
                 + +LP I +LGD+ E         E+F+    L  ++ P +  ++R L LA+L+ 
Sbjct: 61   EMKADAVVLPRIVALGDIDEDELAFADEGEQFSGATPL--DIPPRLGELERRLTLAQLVA 118

Query: 118  IWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKY 177
             W  K P +       SPL +   PA+ + LA +LA +ID + T    W  L  L  ++ 
Sbjct: 119  AW-AKGPVL-------SPLVVG-GPASTLALAGDLARLIDDMVTRGVDWSALDGLVPDQL 169

Query: 178  GMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTG 237
              +W  + +FL+IA   W   L E+N   P   +  L+ AEA+ L     GP+I AGSTG
Sbjct: 170  DRYWQHSLEFLRIARIAWPGHLAEINRIEPAARRDLLIAAEAKRLTAHPHGPVIAAGSTG 229

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS-SNTTYSTHPQYSL 296
            S+PATA+ +  VA+ P+GA+VLPGLD  +    W TI      +   +    S HPQY++
Sbjct: 230  SMPATAKFLHAVASLPHGAVVLPGLDTDLDEDAWRTIGGVRDALGKFAEHPASNHPQYAM 289

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIP-NIQKC 355
              LL+   IKR DV+ L   +    GR ++ S+S  P   +++ +  + +  +   I   
Sbjct: 290  HALLERFGIKRGDVELLQAPAEG--GRDLLASESMRPSAKTEVWHDRLKQPDVAAKIAGG 347

Query: 356  FSDVALIEADNEREEAISIAIALRMS--LDENKKKSALITADRNLARRVKLELTRFGINI 413
             +++A++EA N   EA++IAIA+R +  LD   K +AL+T DR LARRV   LTR+ +  
Sbjct: 348  MTNLAVVEAPNPEMEALAIAIAMREARHLD---KSAALVTPDRALARRVMAALTRWDLAF 404

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D S G  L  T           A  K  +   +  ++KHPL + G        A   LEL
Sbjct: 405  DDSGGDVLMETSAGVFARLAAEAATKGLEPPTLLAMLKHPLCRLGRAPDTWKAAIEGLEL 464

Query: 474  VALRGNKNSYDIMDL-------KSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDH 526
              LRG +       L       +  +     ++ +  H    ++RL  ED +    L+D 
Sbjct: 465  AVLRGTRPPAGTAGLLREFNRFREELAKLWRSEVSALHKAEPRARLKAEDLDRVQALIDA 524

Query: 527  ILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSS 586
            + Q + P+ +   +K      L+           +  +  DE   +P  + E EG  L+ 
Sbjct: 525  LRQALAPIESLAPSKPYDFAELA-----HRHREIMIELSRDEQ-GIPLAFEEREGLALAG 578

Query: 587  LFSKIIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTL 644
             F  ++  G  S +     ++ D+         V+ + +  + L I G LESRL+  D +
Sbjct: 579  AFDDLLRGGTTSGLIVPLPDYPDVFQTAFGDRAVRRRDKPGARLQIYGPLESRLMQADRI 638

Query: 645  ILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLR 704
            I+GGL EGVWP     +P+LSR M+ +L L   E+ IG +AHDF    G   +I T S +
Sbjct: 639  IVGGLIEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQLLGGDEVILTHSAK 698

Query: 705  ENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLE 764
                P +ASR+L RL  + G D +    + G+ Y+ +  +LD   +    K+P+P PP  
Sbjct: 699  AGGAPAVASRFLHRLEAVAGDDRWKAAIRAGEKYVRFADRLDQPDEVRPIKQPEPRPPRA 758

Query: 765  AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
             +P   S + I+  + DPY +YA+ IL+LD +          DRG+  H+ I E  ++  
Sbjct: 759  TRPLKMSVTAIEDWLRDPYTIYAKHILRLDALDPVDMPLSAADRGSAIHDAIGEFTERYA 818

Query: 825  NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
             +   +   +++ I + HF      P    +W   F +I+  F E E   +  +E I   
Sbjct: 819  TRLPDDPARVLRAIGEKHFAPLMERPEARALWWPRFQRIARWFSEWETARRDVVEAITAE 878

Query: 885  IPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEA 941
               +++I         L+  ADRI+  + G   I DYKTG  P  +  +  + PQL+LEA
Sbjct: 879  TRGEISITLDNERSFRLSARADRIERRQGGGYAILDYKTGQPPTGKQVRMGLSPQLTLEA 938

Query: 942  AALKAGSFSQIDC-RKVANLFYIRL--------KQKFKIDCITNDKKKYSADELSEKSLK 992
            A L+ G F  ID    V+ L Y+RL        ++  ++     D+ +   D  + ++  
Sbjct: 939  AILREGGFPDIDAGSSVSQLVYVRLSGNNPPGEERILELKYKQGDEPQ-PPDIAAAEARA 997

Query: 993  NLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             L  ++   ++  Q + S L L   SN    YD LAR+ EW
Sbjct: 998  KLEALIRAFEDENQAYTS-LNLPMWSNRYGTYDDLARIKEW 1037


>gi|170751474|ref|YP_001757734.1| double-strand break repair protein AddB [Methylobacterium
            radiotolerans JCM 2831]
 gi|170657996|gb|ACB27051.1| double-strand break repair protein AddB [Methylobacterium
            radiotolerans JCM 2831]
          Length = 1054

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 338/1074 (31%), Positives = 513/1074 (47%), Gaps = 83/1074 (7%)

Query: 8    VFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEI 67
            VFTI+   PF   +  ALL+G LV     DPL    LA+VTIY+PT+RA + L +   E 
Sbjct: 7    VFTISRGVPFLPTLAEALLSGRLVGPVAGDPLA---LAAVTIYLPTRRAARALGAILAER 63

Query: 68   TGK----KSTILPIIKSLG--DVVEEKFTADLLLSYNLNP---PVSNIQRLLELARLILI 118
             G+    ++T+LP +  LG  D  E    A+ LL  N +P   P+  ++R L LARL+  
Sbjct: 64   LGRDAPGQATLLPRMIPLGEADEAELDLAAEPLLEENADPLSIPMPPLERRLILARLVQA 123

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            W   +   +  L  E P  +P SPA+A+ LA +L  ++D +  E   W ++ A    +Y 
Sbjct: 124  WAKTVDRTLLPLDAEVPFLVPSSPADAVGLAGDLERLMDALTVEGLPWSEIGAAVEAEYS 183

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-GTKGPIIIAGSTG 237
             ++ L  DF+KIA++ W + L E   + PV     L+ AE   L +  T+ P+I+AGS G
Sbjct: 184  RYFGLTLDFVKIAAENWPKLLAERGLADPVARARGLVLAEERRLSRSATQDPVIVAGSLG 243

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            S+PATARL++ VA  P+GA+VLPGLD  +  A W+ I    T    S      HPQ  L 
Sbjct: 244  SVPATARLIAAVAKLPHGAVVLPGLDLDLDAAGWDGI---DTGEGFSRVIAHGHPQAVLH 300

Query: 298  KLL--DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKC 355
            +LL  + L+I R +V  LG        R+ ++S++  P DT+D         +    +  
Sbjct: 301  RLLGPENLNIGRAEVVALGEPDAGQAARAALLSQALRPADTTDAWAALDPAERDTVARLG 360

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
               +AL EA +EREEA+  A+ALR +L      +ALIT DR LA RV +EL R+GI  + 
Sbjct: 361  LDGLALAEAADEREEALVAALALRETLQTPGATAALITPDRGLAGRVAVELLRWGIVAED 420

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIA------TLVKHPLAKFGFPEKYLSRAKN 469
            SAG+ L+ +    +          L    A A       L+ HP+   G P   + R   
Sbjct: 421  SAGLSLAGSAAGRLARLAAELAADLARDQADAIPARLIALLSHPMVHLGLPRPDVVRGAA 480

Query: 470  ALELVALRGNKNSYDIMDL-KSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
            ALE+  LRG   +     L K+L  +R    +   H P  + RL + D ELA  L+D + 
Sbjct: 481  ALEIGLLRGPVPAPGFDGLRKALAAERAGPPE---HRPRAKRRLKDVDWELAADLLDRLD 537

Query: 529  QCI-----------TPLVTYKTNKNSTCGNL------SISDWTKLTVTCLQNVCLDEHRK 571
                            LVT  T     C  L      +    T  +++CL  +  D    
Sbjct: 538  LVFRDFPGPDGAGDCDLVTTATGHREACDRLIAGPEDASPAETDGSLSCLDALFDDLEMA 597

Query: 572  LPNLW---FEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTL 628
             P L    F++     +SL  +     +C                 GE   P+      L
Sbjct: 598  EPGLMPGRFDDYATFFTSLARE--RKVAC----------------SGEAPHPR------L 633

Query: 629  FILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF 688
             ILG LE+RLL+ D ++LGGL+EGVWP  T  + FL+R M+  + L   E+ IGQ AHDF
Sbjct: 634  RILGLLEARLLSVDRVVLGGLDEGVWPVRTLTDSFLNRPMRERVGLNPPERRIGQMAHDF 693

Query: 689  EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYT 748
              A G R  + TR+L+    PT+ SR +QRL  L G   +D++ + G+       +LD  
Sbjct: 694  VQALGCRDAVITRALKREGAPTVPSRLIQRLRALSGDARWDDVLRAGRRITGLAARLDAA 753

Query: 749  TKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR 808
              +P  KRP P P     PR+ S +EI+ L+ DPY+++AR +L LD +      P    R
Sbjct: 754  PPEPRLKRPAPKPDPALFPRSLSVTEIETLVRDPYSIFARHVLGLDPLDPLAAAPGVATR 813

Query: 809  GTLFHNIITELIKKRINKNTPE-INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSF 867
            G+L H++  E   +      P+    L+   +++  E E   P++   W   + +++ ++
Sbjct: 814  GSLVHDVFAEFAARHPADLPPDAAERLLNLAVNAFGEIEAEYPNLYAEWWPRYERMASAY 873

Query: 868  LEHEEKIQSSIEKIFVNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNP 924
            L+ E + +  + +++  +  +  I  +G     L   ADRI+L   G   I DYKTG  P
Sbjct: 874  LDWEAQRRPGLTRVYPEVSGRWVI-PMGRETFTLRARADRIELRPDGTACIVDYKTGTPP 932

Query: 925  KKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVA-NLFYIRLKQKFK----IDCITNDKK 979
              +       PQL+LEAA L  G+F+ +   K   +L Y+      K    I       +
Sbjct: 933  SAKMIFTGFSPQLTLEAAMLMHGAFADLPAAKTTPDLLYVHASGGRKPFVPIPVKPPRGE 992

Query: 980  KYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +   + +  +    L  +V     GE  + +     + ++    YDHLARV EW
Sbjct: 993  ERGVEAIVAEHAARLKGLVARFMTGEAAYTAR-PYPQYASKYGAYDHLARVLEW 1045


>gi|316931472|ref|YP_004106454.1| double-strand break repair protein AddB [Rhodopseudomonas palustris
            DX-1]
 gi|315599186|gb|ADU41721.1| double-strand break repair protein AddB [Rhodopseudomonas palustris
            DX-1]
          Length = 1049

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 321/1057 (30%), Positives = 507/1057 (47%), Gaps = 50/1057 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
            +VF++  S+PF R +I AL++G LV+ F      P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    HVFSVPSSAPFLRTVIAALVDGRLVDGFEARS-APERLADATLYLPTRRAGRMAREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFT----ADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            + G  + +LP I +LGD+ E++      A  L    + P +  + R L LA+LI  W  +
Sbjct: 61   VLGADAVLLPRIVALGDIDEDELAFAQAASGLADLEIPPALDGLPRRLLLAQLIASWAAR 120

Query: 123  LPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            L        P+ P   P+    PA+A+ LA +LA +ID + T    W  L  L  + +  
Sbjct: 121  L-------KPDDPTQAPLVVGGPASALALADDLARLIDDMSTRGVDWSALETLVPDAFDR 173

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L  DFLKIA   W E L E +   P   +  L+ AEA+ L     GP+I AGSTGS+
Sbjct: 174  YWSLTLDFLKIAGHAWPEYLKETDRIEPAARRDRLIDAEAQRLATQRSGPVIAAGSTGSM 233

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS-THPQYSLAK 298
            PATA+L++ +A  P+GA+VLPGLD  +  A W+ I           T  S  HPQY++  
Sbjct: 234  PATAKLLTAIARLPHGAVVLPGLDVDLDDAAWDLIGGSRDRQGKLVTPPSPNHPQYAMHG 293

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKCFS 357
            LLD + + R DV++LG  +   +GR ++ S++  P   + + +  + +  +   I +   
Sbjct: 294  LLDRMGVTRRDVQQLGTPAR--HGRELLASEALRPSSATAVWHDRLKDADVDRLIGEGIG 351

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
             + LIEA N   EA++IA+ LR +  E  K +AL+T DR LARRV   L R+ + +D S 
Sbjct: 352  GLTLIEAPNSEAEALAIAVVLREAR-EQGKTAALVTPDRALARRVVAALGRWHLPVDDSG 410

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G  L  T           A  +  +   +  L+KHPL + G  +    RA   LEL  LR
Sbjct: 411  GDSLMETQPGIFARLAAEAALEGCEPATLLALLKHPLLRLGRADHGWRRAIETLELALLR 470

Query: 478  GNKNSYDIMDL-KSLVLDRIATQK------NNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            G +       L K   + RI   K      +  H    ++RLSE   + A  L+  +   
Sbjct: 471  GPRPPAGCHGLAKEFAIFRIELAKLKRGEASALHPSEPRTRLSEPSLDDAQALIAQLEAA 530

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            + PL T+  +    C    I    +  +  L      +H  +   +   +G  L   F  
Sbjct: 531  LAPLETFGPSPLDLC---EIGARHRDVLKALTT----DHEGIAEAFEGPQGSALLRAFDD 583

Query: 591  IIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
            +   G  S +   A ++ ++         V+      + + I G LE+RL   D ++LGG
Sbjct: 584  LAAVGPASGVLVAARDYGEVFETAFGDRVVRRPELAEAPIRIYGPLEARLTQQDRVVLGG 643

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            L EGVWP     +P+LSR M+ +L L   E+ IG +AHDF  A G   +    + +    
Sbjct: 644  LVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQALGADEVFIAHAAKVGGA 703

Query: 709  PTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
            P +ASR+L RL  + G D +  +K RGQ YLD+T +LD         +P P PP  A+P 
Sbjct: 704  PAVASRFLHRLEAVAGEDRWKAMKARGQIYLDYTHELDRPESVTPIAQPAPRPPRIARPL 763

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
                + I+  + DPY +YA+ IL+L  +          DRG+  H  + E  ++  +   
Sbjct: 764  KLPVTAIEDWLRDPYTIYAKYILRLSPLDPVDMPLSGADRGSAIHAALGEFTERYQDAMP 823

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
             +    ++QI   HF           +W   F +I+  F   E++ ++ + ++       
Sbjct: 824  DDPAAALRQIGQKHFAPLMDHAEARALWWPRFLRIATWFGAWEQQRRTGVVQVQAERRGT 883

Query: 889  MAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
            + I   G     L+  ADRI+    G   I DYKTG  P  +  +  + PQL+LEAA L+
Sbjct: 884  LMIPLGGERNFELSARADRIERRDDGSYAILDYKTGHPPTGKQVRMGLSPQLTLEAAILR 943

Query: 946  AGSFSQID-CRKVANLFYIRL--------KQKFKIDCITNDKKKYSADELSEKSLKNLIE 996
             G F  I     V+ L Y++L        ++  ++     D+ ++  D+ ++++   L  
Sbjct: 944  DGGFEGIPAAASVSELTYVKLSGNTPPGDERVLELKIERKDEPQHP-DDAADEARAKLEG 1002

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +V   ++ +Q + S L LS  S     YD LAR+ EW
Sbjct: 1003 LVRRFEDEKQSYRS-LVLSMWSQRYGTYDDLARIKEW 1038


>gi|188584139|ref|YP_001927584.1| double-strand break repair protein AddB [Methylobacterium populi
            BJ001]
 gi|179347637|gb|ACB83049.1| double-strand break repair protein AddB [Methylobacterium populi
            BJ001]
          Length = 1045

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 331/1072 (30%), Positives = 515/1072 (48%), Gaps = 80/1072 (7%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
               P VFTI P +PF   +  AL++G LV    +DP     LASVT+Y+PT+RA++ L +
Sbjct: 4    TAAPRVFTIPPGAPFLPTLADALVSGRLVGAVGHDPFA---LASVTLYLPTQRAVRALST 60

Query: 63   EFIEITGKKSTILPIIKSLG--DVVEEKFTADLLLSYN---LNPPVSNIQRLLELARLIL 117
               +  G  + +LP +  LG  D  E   +A  LL      L+P +  ++R L LARL+ 
Sbjct: 61   VLAQRLGG-AALLPRMIPLGEADEAELDLSASTLLDTPEDLLHPSIPALERRLILARLVQ 119

Query: 118  IWRNKLPDIIKDLYP---ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKN 174
             W      + ++L P   E P  +P SPA+A+ LA +L  ++D +  E   W ++ +   
Sbjct: 120  KWAET---VDRELLPIDDEVPFLVPSSPADAVALAADLEGLMDALTVEGLPWSEIASAVE 176

Query: 175  EKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKGPIIIA 233
             ++  ++ L  DFL+IA+++W E L   + + P      L+ AEA+ L +     P+I+A
Sbjct: 177  AEHSRYFRLTLDFLRIAAEHWPEILAARSLADPTARARRLVLAEADRLTRDRPDDPMIVA 236

Query: 234  GSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQ 293
            GSTGS+PATARL++ VA  P GA+VLPGLD H+    W  I        + +     HPQ
Sbjct: 237  GSTGSVPATARLIAAVARLPRGAVVLPGLDLHLDEEGWEAIDGAG---GTRDEIAHGHPQ 293

Query: 294  YSLAKLLD--FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN 351
              L  L     L + R +V+ LG +S E   R  ++S++  P +T+D         ++  
Sbjct: 294  AILRALTGRTGLAVARGEVETLGTLSPEAVARERLLSQALRPAETTDAWARLDGAERLAL 353

Query: 352  IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGI 411
              +    +A++EA +EREEA+  A+ALR +L+     +AL+T DR LA RV  EL R+GI
Sbjct: 354  AHEGMEGLAVVEAADEREEALVAALALRETLETPGATAALVTPDRGLALRVSAELARWGI 413

Query: 412  NIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
              + SAG+ L+ +        +     ++     IA L+ HP  + G     + RA  AL
Sbjct: 414  AAEDSAGLSLARSQAGRFARLVAELAAEVAPARVIA-LLAHPFVRLGLTRSEVVRAAAAL 472

Query: 472  ELVALRG----NKNSYDIMDLKSLVLDRIATQKNNT-HVPHWQSRLSEEDKELAVLLVDH 526
            E+  LRG     KNS+D M         +A Q+N T  VP  + RL   D +L+  ++D 
Sbjct: 473  EIGGLRGPAPIPKNSFDGMRAA------VALQRNATERVPRAKKRLKAIDWDLSENILDR 526

Query: 527  ILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCL-QNVCLDEHRKLPNLWFEEE----- 580
            +   +     ++T+     GNL       + +  L +  C    R +     EEE     
Sbjct: 527  LEIALD---RFRTDLQPAIGNL-------VALAALHREAC---ERMMGGAETEEEIDDPS 573

Query: 581  GKTLSSLFSKIIET-GSCIKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTLESRL 638
              TL  LF  +       +     ++    T L    TV   +      L ILG LE+RL
Sbjct: 574  LDTLDGLFDDLESAEQEALPGRFSDYAAFFTALARDRTVACAQGNAHPRLRILGPLEARL 633

Query: 639  LNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLI 698
            L+ D ++LGGL+E VWP     + FL+R M+  + L   E+ IGQAAHDF    G    +
Sbjct: 634  LSVDRIVLGGLDEAVWPVRQTTDAFLNRPMRGQVGLSPPERRIGQAAHDFVQGLGIHDAV 693

Query: 699  YTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ--PHYKR 756
             TR+ +    PT+ SR+LQRL   GG   +     RGQ        LD   +   P   R
Sbjct: 694  VTRAAKREGSPTVPSRFLQRLRAFGGDAVWAGAIARGQRLRGLAAILDRGREAPPPRLTR 753

Query: 757  PKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNII 816
            P P P     P   S +EI+ L+ DPY+++AR IL L+ +      P   +RG+L H I+
Sbjct: 754  PAPKPDPALFPSRLSVTEIETLVRDPYSIFARHILGLEALEPMAVVPGAAERGSLIHKIL 813

Query: 817  TELIKKRINKNTPEINHLMKQI-IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQ 875
             +  +        +   L+  I +D+    ++  P +   W   + +++ +FLE E   +
Sbjct: 814  GDFSQAHPGPLPADAETLLYAIALDAFGPLQDQYPELYAEWFPRYERMAVAFLEWEASQR 873

Query: 876  SSIEKIFVNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKL 932
              +  I      K+ I  +G     L+  ADRI++   G   I D+KTG  P   T    
Sbjct: 874  QGLRAIHAERSGKLTI-PLGERTFTLSARADRIEVRADGGYCIVDFKTGTPPSNRTVFAG 932

Query: 933  IDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFK---IDCITNDKKKYSADEL 986
              PQL+LEAA L  G+F  +      +L Y+     ++ F+   +     D +  +A  +
Sbjct: 933  FSPQLTLEAAMLMHGAFEGLKAASAPDLLYVHASGGREPFRPIPVKAPPGDARAVAA--I 990

Query: 987  SEKSLKNLIEIVTLLQNGE-----QPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             E+ L+ L  ++     GE     +P+  ++R        +EYDHLARV EW
Sbjct: 991  VEEHLERLRGLIARYMTGEAAYPSRPYPQYVR------AYNEYDHLARVLEW 1036


>gi|92115689|ref|YP_575418.1| hypothetical protein Nham_0057 [Nitrobacter hamburgensis X14]
 gi|91798583|gb|ABE60958.1| DNA helicase/exodeoxyribonuclease V, subunit B [Nitrobacter
            hamburgensis X14]
          Length = 1049

 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 322/1061 (30%), Positives = 504/1061 (47%), Gaps = 58/1061 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             V  +  S PF R +I AL++G L+E FR     P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    RVRNVPTSVPFLRTVITALVDGALIEGFRPR-AQPERLAEATLYLPTRRAGRMARDIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFT----ADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            +    + ILP I +LGD+ E++      A    +  L P +  + R L LA+LI  W   
Sbjct: 61   VLNVDAVILPRIVALGDIDEDELAFAQAASSAEALQLPPALDGLARRLALAQLIEAW--- 117

Query: 123  LPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
                 + L P  P   P+    PA+ + LA +LA ++D + T    W  L AL  +    
Sbjct: 118  ----ARQLKPGDPAQAPLVLGGPASTLALADDLARLMDDMATRGVDWRALDALVPDALDK 173

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L  DFLKIA  YW   L E     P   +  L+ AEA  L     GP+I AGSTGS+
Sbjct: 174  YWQLTLDFLKIARDYWPAHLEEAGRIEPAVRRDRLIDAEAARLAAHHGGPVIAAGSTGSM 233

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITE-KSTNITSSNTTYSTHPQYSLAK 298
            P+TA+L+  +A  P+GA+VLPGLD  +    W  I   +  N   +    + HPQ++L  
Sbjct: 234  PSTAKLLHVIARLPHGAVVLPGLDTDLDDEAWQLIGGMRDGNGAFTAPPAAGHPQFALHG 293

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKCFS 357
            LL    I R DV+ LG  +   YGR M+ S++  P + +   +T + E ++   I     
Sbjct: 294  LLRRFGIARRDVETLGVPAP--YGREMLTSEAMRPSEATARWHTRLAEPEVAEKIAAGMK 351

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
            ++A+I A N   EA+SIA A+R + + N K +AL+T DR LARRV   L R+ +  D S 
Sbjct: 352  NLAVIAAANPEVEALSIAAAMREARELN-KTAALVTFDRALARRVMAALGRWNLAFDDSG 410

Query: 418  GIPLSTTLHSSILTSLL--NAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            G  L  T  + I   L+   A   L     +A L+KHPL + G      SRA   LEL  
Sbjct: 411  GDALMDT-PAGIFARLVAGTACNGLEPPTLLA-LLKHPLCRLGRVAGGWSRAVATLELAI 468

Query: 476  LRGNK---NSYDIMDLKSLV------LDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDH 526
            LRG +    S  + D  +        LDR  +   +   P    +L   D+  A  L+  
Sbjct: 469  LRGTRPPPGSKGLADEFARFCGELDKLDRGESSSLHRTEPRAALKLHRLDESRA--LIAA 526

Query: 527  ILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQ--NVCLDEHRKLPNLWFEEEGKTL 584
            +   + PL     +++        +D+T       +  +V   + + +   +  + G  L
Sbjct: 527  LRDALAPLEGDGASRS--------ADFTAFAAQHREAIDVLSRDDQGVAAAFEGQHGLAL 578

Query: 585  SSLFSKIIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFD 642
            ++ F  + + G  S +     ++ ++         V+     +++L I G LE+RL   D
Sbjct: 579  AAAFDDLRKAGERSGLTVKIADYPEVFETAFGDRIVRRPQATAASLRIYGPLEARLTQCD 638

Query: 643  TLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRS 702
             +ILGGLNE VWP     +P+LSR M+ +L L   E+ IG +AHDF    G   +I + +
Sbjct: 639  RVILGGLNESVWPPAPPSDPWLSRPMRHELGLDLPERRIGLSAHDFAQLLGADDVILSHA 698

Query: 703  LRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPP 762
             +    P +ASR+L RL  + G + +    + G  Y+ +   +D   +     +P+P PP
Sbjct: 699  AKAGGSPAVASRFLHRLKAVAGPERWATALQAGTRYVQYAEAIDRPEQVTPVAQPEPKPP 758

Query: 763  LEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKK 822
              A+P   S + I+  + DPY +YA+ ILKL  +          DRG+  HN + +  K+
Sbjct: 759  RAARPTRLSVTAIEDWLRDPYTIYAKHILKLLPLEAVDMPLSAADRGSAIHNSLGDFTKQ 818

Query: 823  RINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
                       +++ I +S F      P    +W   F +I+  F E E+  +  +E I 
Sbjct: 819  YPAALPENPADVLRAIGESRFAPLMQRPEARALWWPRFQRIAAWFAEWEQSRRPQLETID 878

Query: 883  VNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
              I  +++I        HL+  ADRI+ L  G   I DYKTG  P  +  +  + PQL+L
Sbjct: 879  AEIRGEISIPVASDRTFHLSARADRIEHLGDGRFTILDYKTGSPPSSKQVRLGLSPQLTL 938

Query: 940  EAAALKAGSFSQIDC-RKVANLFYIRLK------QKFKIDCITNDKKKYSADELSEKSLK 992
            E+A L+ G F  I     V+ L Y+RL       +  +++         S D+ ++++L+
Sbjct: 939  ESAILREGGFEGIPAGASVSELVYVRLSGNNPPGEPLQVNLDNGKTDMQSPDQAADRALE 998

Query: 993  NLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             L  ++    N +Q + S L L         YD LAR+ EW
Sbjct: 999  ELNALIRAFDNEQQGYPS-LDLPMWKTRYGAYDDLARIKEW 1038


>gi|39933155|ref|NP_945431.1| hypothetical protein RPA0075 [Rhodopseudomonas palustris CGA009]
 gi|39652780|emb|CAE25519.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 1049

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 317/1057 (29%), Positives = 505/1057 (47%), Gaps = 50/1057 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
            ++F++  S+PF R  I AL++G LVE F      P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    HLFSVPSSAPFLRTTIAALVDGRLVEGFEAR-AAPERLADATLYLPTRRAGRMAREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFT----ADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            + G  + +LP I +LGD+ E++      A  L    + P +  + R L LA+LI  W  +
Sbjct: 61   VLGADAVLLPRIVALGDIDEDELAFAQAASGLADLEIPPALDGLPRRLLLAQLIASWAAR 120

Query: 123  LPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            L        P+ P   P+    PA+A+ LA +LA +ID + T    W  L  L  + +  
Sbjct: 121  L-------KPDDPAQAPLVVGGPASALALADDLARLIDDMSTRGVDWSALGTLVPDAFDR 173

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L  DFLKIA   W + L E +   P   +  L+ AEA+ L     GP+I AGSTGS+
Sbjct: 174  YWSLTLDFLKIAGHAWPQYLKETDRIEPAARRDRLIDAEAQRLATQRSGPVIAAGSTGSM 233

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS-THPQYSLAK 298
            PATA+L++ +   P+GA+VLPGLD  +  A W+ I           T  S  HPQY++  
Sbjct: 234  PATAKLLTAIVRLPHGAVVLPGLDIDLDNAAWDLIGGSRDRQGKLVTPPSPNHPQYAMHG 293

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKCFS 357
            LLD + + R DV++LG  +   +GR ++ S++  P   + + +  + + ++   I +   
Sbjct: 294  LLDRMGVTRRDVQQLGTPAR--HGRELLSSEALRPSSATAVWHDRLKDAEVDRLIGEGTD 351

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
             + LIEA N   EA++IA+ LR +  E  K +AL+T DR LARRV   L R+ + +D S 
Sbjct: 352  GLTLIEAPNSEAEALAIAVVLREA-REQGKTAALVTPDRALARRVVAALGRWHLPVDDSG 410

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G  L  T            + +  +   +  L+KHPL + G        A   LEL  LR
Sbjct: 411  GDSLMETQPGIFARLAAETVLEGCEPTTLLALLKHPLLRLGRAGYGWRGAIETLELALLR 470

Query: 478  GNKNSYDIMDLK---SLVLDRIATQKNNT----HVPHWQSRLSEEDKELAVLLVDHILQC 530
            G +       L    ++    +A  K       H    ++RLSE   + A  L+  +   
Sbjct: 471  GPRPPAGCDGLAKEFAIFRGELAKLKRGEASALHPSEPRTRLSEPSLDEAQQLIAQLKAA 530

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            + PL T   N    C      +        L+ +  D+   +  ++   +G  L   F  
Sbjct: 531  LAPLETVGPNPLDLC------EIGAQHCAALKALTTDDD-GIAEVFEGPQGSALLRAFDD 583

Query: 591  IIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
            +   G  S +   A ++ ++         V+      + + I G LE+RL   D ++LGG
Sbjct: 584  LAAVGPASGVLVAARDYGEVFETAFGDRVVRRPELAEAPIRIYGPLEARLTQQDRVVLGG 643

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            L EGVWP     +P+LSR M+ +L L   E+ IG +AHDF  A G   +  T + +    
Sbjct: 644  LVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQALGADEVFITHAAKVGGA 703

Query: 709  PTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
            P +ASR+L RL  + G D +  +K RGQ YLD+T +LD         +P P PP  A+P 
Sbjct: 704  PAVASRFLHRLEAVAGEDRWKAMKARGQTYLDYTHELDRPESVTPIAQPAPRPPRIARPL 763

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
                + I+  + DPY +YA+ IL+L  +          DRG+  H  + E  ++  +   
Sbjct: 764  KLPVTAIEDWLRDPYTIYAKYILRLSPLDPVDMSLSGADRGSAIHAALGEFTERYQDALP 823

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
             +    ++QI   HF           +W   F +I+  F   E++ ++ + ++       
Sbjct: 824  DDPVTALRQIGQKHFAPLMDHAEARALWWPRFLRIATWFAAWEQQRRTGVVQVQAERRGT 883

Query: 889  MAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
            + I   G     L+  ADRI+    G   I DYKTG  P  +  +  + PQL+LEAA L+
Sbjct: 884  LMIPLGGERNFELSARADRIERRDDGSYAILDYKTGHPPTGKQVRMGLSPQLTLEAAILR 943

Query: 946  AGSFSQID-CRKVANLFYIRL--------KQKFKIDCITNDKKKYSADELSEKSLKNLIE 996
             G F  I     V+ L Y++L        ++  ++     D+ ++  D+ ++++   L  
Sbjct: 944  DGGFEDIPAAASVSELTYVKLSGNTPPGDERVLELKIERKDEPQHP-DDAADEARAKLEG 1002

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +V   ++ +QP+ S L LS  S     YD LAR+ EW
Sbjct: 1003 LVRRFEDEKQPYRS-LVLSMWSQRYGTYDDLARIKEW 1038


>gi|91974685|ref|YP_567344.1| hypothetical protein RPD_0203 [Rhodopseudomonas palustris BisB5]
 gi|91681141|gb|ABE37443.1| DNA helicase/exodeoxyribonuclease V, subunit B [Rhodopseudomonas
            palustris BisB5]
          Length = 1049

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 315/1058 (29%), Positives = 503/1058 (47%), Gaps = 52/1058 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF++ PS+PF R  I AL++G L+  F      P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    RVFSVPPSAPFLRTTIKALVDGELIAGFDAR-AKPERLAEATLYLPTRRAGRLARDIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLL----SYNLNPPVSNIQRLLELARLILIWRNK 122
            + G  + +LP I  LGDV E++             ++ P +  + R L+LA+LI +W   
Sbjct: 61   VLGADAVLLPRIVPLGDVDEDELAFAQAATGAADLDIPPALEGLPRRLQLAQLIAVW--- 117

Query: 123  LPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
                 K L    P   P+    PA+ + LA +LA +ID + T    W  L +L  + +  
Sbjct: 118  ----AKGLRSGDPQQSPLVVGGPASTLALADDLARLIDDMATRGVDWAALDSLVPDAFDR 173

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L  DFLKIA ++W + L E +   P   +  L+ AEA  L     GP+I AGSTGS+
Sbjct: 174  YWRLTLDFLKIAGQWWPQHLRESDQIEPAARRDLLIEAEAARLAAHRGGPVIAAGSTGSM 233

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIW---NTITEKSTNITSSNTTYSTHPQYSL 296
            PATA+L+  +A  PNGA++LPGLD  +    W     + +K   + S  +    HPQ+++
Sbjct: 234  PATAKLLHAIARLPNGAVILPGLDTELDEQAWRLIGAVRDKQGQLISPPSP--NHPQFAM 291

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKC 355
              LL  + ++R ++ RLG      +GR ++ S++  P   +   +  + + ++   I++ 
Sbjct: 292  HGLLTRMGLERREIVRLGEAVR--HGREVLASEAMRPSAATASWHERLADPEVDRLIEQG 349

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
             + + +IEA N   EA++IA+ALR +  E  + +AL+T DR LARRV   L R+ + +D 
Sbjct: 350  VNGLTVIEAPNSEIEALAIAVALREA-RERGQSAALVTPDRALARRVVAALGRWNLPVDD 408

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            S G  L  T           A     +   +  L+KHPL + G        A   LEL  
Sbjct: 409  SGGDSLMETQAGIFARLAAEAALHGCEPATLLALLKHPLLRLGRAAGGWRHAIETLELAL 468

Query: 476  LRGNKNSYDIMDL-KSLVLDRIATQK------NNTHVPHWQSRLSEEDKELAVLLVDHIL 528
            LRG + +     L K     R    +      +  H    ++RL +E  + A  L++ + 
Sbjct: 469  LRGTRPAAGSEGLVKEFAKYRAELTRLKRGELSALHPSEPRARLGDESLDAAQELIEALR 528

Query: 529  QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLF 588
              + PL T        C       + +     L  + +D H ++   +   +G  L   F
Sbjct: 529  AALAPLETVGAEPLDLCA------FGRRHRDVLIALSID-HDEIAVAFEGSQGSALLKAF 581

Query: 589  SKI--IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLIL 646
              +  +E  S +     ++ D+         V+      + L I G LE+RL   D +IL
Sbjct: 582  DDLAAVEPLSGVLVPPHDYADVFETAFSDRIVRRPELAGAALRIYGPLEARLTQHDRVIL 641

Query: 647  GGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLREN 706
            GGL EGVWP     +P+LSR M+ DL L   E+ IG +AHDF    G   +I T + +  
Sbjct: 642  GGLVEGVWPPAPRIDPWLSRPMRHDLGLDLPERRIGLSAHDFAQLLGADEVILTYANKVG 701

Query: 707  NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ 766
              P + SR+L RL  + G   +  +K RGQ YLD+ + LD   +     +P P PP EA+
Sbjct: 702  GAPAVVSRFLHRLEAVTGKARWSAVKARGQSYLDYAQALDRPEQVTPIAQPAPRPPREAR 761

Query: 767  PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK 826
            P   S + I+  + DPY +YA+ IL L  I          DRG+  H  + E  +   ++
Sbjct: 762  PLKLSVTAIEDWLRDPYTIYAKFILGLSAIDPVDMPLSAADRGSAIHEALGEFTELFPDE 821

Query: 827  NTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIP 886
               +   ++++I + HF      P    +W   F +I+  F   E+  ++   ++F    
Sbjct: 822  LPDDPAQVLREIGEKHFAPLMAHPEARALWWPRFARIAAWFGNWEQARRADGLRVFAERD 881

Query: 887  AKMAIESIGIH---LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
              ++I   G     L+  ADRI+    G   I DYKTG+ P  +  +  + PQL+LEAA 
Sbjct: 882  GSLSIPLDGGRNFILSARADRIEHRADGSFAILDYKTGNPPTGKQVRMGLSPQLTLEAAI 941

Query: 944  LKAGSFSQIDC-RKVANLFYIRLKQKFKI--DC-----ITNDKKKYSADELSEKSLKNLI 995
            L+ G F  ID    V+ L Y++L        +C     I    ++ S D+ + ++   L 
Sbjct: 942  LRDGGFEGIDAGSSVSELTYVKLSGNSPPGDECVLELRIERKDERQSPDDAAAEARSKLE 1001

Query: 996  EIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             ++    +  QP+ + L LS  S     YD LAR+ EW
Sbjct: 1002 TLIRRFDDEAQPYHA-LVLSMWSRRYGRYDDLARIKEW 1038


>gi|288959561|ref|YP_003449902.1| double-strand break repair protein [Azospirillum sp. B510]
 gi|288911869|dbj|BAI73358.1| double-strand break repair protein [Azospirillum sp. B510]
          Length = 988

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 310/1049 (29%), Positives = 499/1049 (47%), Gaps = 94/1049 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +++I   +PF        L   ++E    DP+    LA VT+ +PT+RA + L++ F+
Sbjct: 4    PKLYSIPAGAPFVDR-----LAAGIMERVGGDPMA---LAGVTVLLPTRRACRSLQAAFL 55

Query: 66   EITGKKSTILPIIKSLG--DVVEEKFTADLLLSYNLNPP--VSNIQRLLELARLILIWRN 121
              +G + T+LP +  LG  D  +   T + L    L+ P  +S + R + LARLIL    
Sbjct: 56   RRSGGQPTLLPRMAPLGELDAGDLSLTEEELPDVPLDLPEAISPLNRQMTLARLIL---- 111

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
                            L  + A A+ L  +L  +ID + TE   ++ L +L  E Y   W
Sbjct: 112  ------------GADGLSATTAQAVRLGADLGRLIDAVWTERAGFDKLESLVPEDYAEHW 159

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQ-IALMRAEAEHLMKGTKGPIIIAGSTGSIP 240
             +   FL+I ++ W   L     + P   + +AL    A        G +I AGSTGSI 
Sbjct: 160  QVTLKFLRIITEVWPAILESTGETDPAKRRNLALETQAALWQAAPPPGMVIAAGSTGSIA 219

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            AT  L++ +A  P GA+VLPGLD     AIW+ I    +           HPQ+ L++L+
Sbjct: 220  ATTELLAVIARLPQGAVVLPGLDTGADDAIWDAIAADES-----------HPQHGLSQLI 268

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD-MRNTDILENKIPNIQKCFSDV 359
              L + R++V    +       R+ +I+++  P  T++  R    L+            +
Sbjct: 269  RLLGVTRDEVWPWTDAPEPRGARARLIAEAMRPAATTEGWRELSGLD------ASALDGL 322

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
              I+A    EEA  IA+ +R +L+   + +ALIT DRNL RRV + L R+GI ++ S G 
Sbjct: 323  TRIDAATSEEEAQVIALLMRHALETPARTAALITPDRNLGRRVAMALARWGILVNDSGGQ 382

Query: 420  PLSTTLHSSILTSL-LNAIFKLNDF--MAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            PL+   H+++ T L L A    +    +A+  L KHP+A  G        A  ALE + L
Sbjct: 383  PLA---HTAVGTYLRLTAELAASRVHPLALLALAKHPMAAGGRDSGDFRAAARALERIVL 439

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
            RG + +     +       +A  +      H      E+ + L   LVD + Q   P + 
Sbjct: 440  RGPRPAEGFDGI-------LAALERADRFDH-----EEQQEVLRGWLVD-LGQRAAPFL- 485

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN-LWFEEEGKTLSSLFSKIIETG 595
                  +  G   ++D  +  V   +++  D+  +  + LW +++G+  +     +++  
Sbjct: 486  -----EALAGETPLADLVRAHVAFCESLAADDGLEGKDRLWRQDDGEEAARFIHDLLDAA 540

Query: 596  SCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVW 654
            +   A  A ++  ++  L+    V+P+      LFILG +E+RL + D  ILGGLNEG W
Sbjct: 541  AGFPAIPAKDYPALLDALMSARAVRPRYGLHPRLFILGPMEARLQHLDLTILGGLNEGTW 600

Query: 655  PKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASR 714
            P   A +P++SR M+ +  L + E+ +G +AHDF  A G   ++ TR+ R    PT+ SR
Sbjct: 601  PPAAAADPWMSRPMRREFGLPSPERLVGMSAHDFAHACGAPEVVLTRAARVEGTPTVPSR 660

Query: 715  WLQRL-LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            WL RL  VL   D    +++RG C+L W R LD   +      P+P PPL A+PR  S +
Sbjct: 661  WLLRLETVLKALDLDGVIEERGACWLGWARGLDEPDRVRPVSAPEPRPPLSARPRKLSVT 720

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI+  + DPYA+YAR  L+L  +     DP  +DRG + H+ +   ++   +   P  + 
Sbjct: 721  EIETWMRDPYAIYARHALRLRALDPIAADPGASDRGQIIHDTLDAFVR---DHPGPLPHD 777

Query: 834  LMKQIIDSHFEKENLPP----HIDI--IWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA 887
             + ++I     +E   P    H D+   W   F +++  F++ E + +  +  +   +P 
Sbjct: 778  ALDRLI--ALGRERFGPLLRSHPDVWAFWWPRFERVAGWFVDLERERRPRLRPLATEVPG 835

Query: 888  KMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
            ++ +   G    LT  ADRID    G V + DYKTG  P     +    PQL LEAA   
Sbjct: 836  RLELSGPGGPFALTAKADRIDRGPDGLV-VIDYKTGTPPSAREIELGFAPQLPLEAAIAA 894

Query: 946  AGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKK-KYSADELSEKSLKNLIEIVTLLQNG 1004
            AG FS +D   VA L + RL      D    +K  K     L+E++   L  ++    + 
Sbjct: 895  AGGFSGVDKGAVAELAFWRLSGG---DPAGEEKPVKGDPAALAEEARAGLEALIARFDDP 951

Query: 1005 EQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            + P+ S  R +      ++Y HLARV EW
Sbjct: 952  QTPYRSRPRPAMAPRY-TDYAHLARVQEW 979


>gi|75674248|ref|YP_316669.1| hypothetical protein Nwi_0049 [Nitrobacter winogradskyi Nb-255]
 gi|74419118|gb|ABA03317.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 1053

 Score =  426 bits (1095), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 328/1057 (31%), Positives = 504/1057 (47%), Gaps = 46/1057 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             V  +  S PF R +I AL++G L+E FR     P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    RVRNVPSSVPFLRAVITALVDGELIEGFRPR-AQPERLAEATLYLPTRRAGRMARDIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSY-----NLNPPVSNIQRLLELARLILIWRN 121
            +    + ILP I +LG + E++      +S       L P +  + R L LA+LI  W  
Sbjct: 61   VLDTDAVILPRIVALGGIDEDELAFAQAVSLPPETLELPPALDGLARRLALAQLIDAWAR 120

Query: 122  KLPDIIKDLYP-ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
            +L   + D  P  +PL L   PA+ + LA +LA ++D + T    W  L  L  E    +
Sbjct: 121  RL--NLGDGEPARAPLVL-GGPASTLTLAADLARLMDDMATRGVDWRALDGLVPEALDRY 177

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIP 240
            W +  DFLKIA  YW   L E     P   +  L+ AEA  L     GP+I AGSTGS+P
Sbjct: 178  WQITLDFLKIARDYWPAHLQETGRIEPAARRDRLIEAEAARLAAHHVGPVIAAGSTGSMP 237

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTT--YSTHPQYSLAK 298
            +TA+L+  +A  P GA+VLPGLD  +    W  I       + +  T   + HPQ++L  
Sbjct: 238  STAKLLHAIATLPQGAVVLPGLDTDLDEEAWRLIGGVRDKASGAFITPPAAGHPQFALHG 297

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKCFS 357
            LL    IKR +VK LG  +   YGR M+ S++  P + +   +T + E ++ + I     
Sbjct: 298  LLARFGIKRSEVKALGFPAP--YGREMLASEAMRPAEATAQWHTRLAEPEVADKIAAGLQ 355

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
            ++A+I A N   EA+ IA+A+R + D N K +AL+T DR LARRV   L R+ +  D S 
Sbjct: 356  NLAVIAAANPEMEALGIAVAMREARDLN-KTAALVTFDRALARRVMAALGRWNLAFDDSG 414

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFM--AIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            G PL  T   + + + L A    N      +  L+KHPL + G      SRA  ALEL  
Sbjct: 415  GDPLMDT--PAGIFARLAAETACNGLEPPTLLALLKHPLCRLGRAAGGWSRAIIALELAI 472

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            LRG +       L      R   +++        S    E +  A L  DH L  I+ L+
Sbjct: 473  LRGPRPPPGGKGLAD-EFARFCDERDQLDRGESSSLHRSEPR--AALKPDH-LDDISALI 528

Query: 536  TYKTNKNSTC---GNLSISDWTKLTVTCLQNV----CLDEHRKLPNLWFEEEGKTLSSLF 588
                +  +     G    +D+T L +   Q +    C DE   +   +    G+ L+  F
Sbjct: 529  AALRDALAPLEGDGASRSADFTLLALQHRQTIESLSCDDEGVAV--AFDGRHGRALADAF 586

Query: 589  SKIIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLIL 646
              +++ G  S +     ++ +          V+     S++L I G LE+RL   D +IL
Sbjct: 587  DDLVDAGERSGLTVRIADYPETFEAAFGDRVVRRPQATSASLRIYGPLEARLTQCDRVIL 646

Query: 647  GGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLREN 706
            GGL EGVWP     +P+LSR M+ +L L   E+ IG +AHDF    G   +I + + +  
Sbjct: 647  GGLTEGVWPPAPPTDPWLSRPMRHELGLDLPERRIGLSAHDFTQLFGAEEVILSHAAKAA 706

Query: 707  NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ 766
              P +ASR+L RL  + G   + + K+ G  Y+ +   LD  ++     +P P PP  A+
Sbjct: 707  GAPAVASRFLHRLEAVAGATRWTSAKQAGARYIQYAEALDRPSEVTPIAQPAPKPPRTAR 766

Query: 767  PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK 826
            P   S + I+  + DPY +YAR ILKL  +          DRG+  H+ + +  K+    
Sbjct: 767  PTRLSVTAIEDWLRDPYTIYARYILKLLPLEAVDMPLSAADRGSAIHDALGDFTKRYPAS 826

Query: 827  NTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIP 886
               +   +++ I +S F      P    +W   F +I+  F E E   ++ + +I   + 
Sbjct: 827  LPDDPEDVLRAIGESRFAPLMQRPEARALWWPRFQRIAAWFAEWEPTRRAHLVRIDAEVS 886

Query: 887  AKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
             K+ I   G     L+  ADRI+ L  G   + DYKTG  P  +  +  + PQL+LE+A 
Sbjct: 887  GKIEIPIDGDRRFTLSARADRIEHLGGGRFAVLDYKTGSPPSSKQVRLGLSPQLTLESAI 946

Query: 944  LKAGSFSQI-DCRKVANLFYIRLK------QKFKIDCITNDKKKYSADELSEKSLKNLIE 996
            L+ G F+ I     V+ L Y+RL       +   +D         S D+ ++ +L+ L  
Sbjct: 947  LRNGGFAGIPPGASVSELVYVRLSGNNPAGEPRPVDLDNGKTATRSPDQAADVALEELTA 1006

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++    + +Q + S L L         YD LAR+ EW
Sbjct: 1007 LIRAFDDEQQGYAS-LDLPMWKARYGVYDDLARIKEW 1042


>gi|192288511|ref|YP_001989116.1| double-strand break repair protein AddB [Rhodopseudomonas palustris
            TIE-1]
 gi|192282260|gb|ACE98640.1| double-strand break repair protein AddB [Rhodopseudomonas palustris
            TIE-1]
          Length = 1049

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 317/1057 (29%), Positives = 503/1057 (47%), Gaps = 50/1057 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
            ++F++  S+PF R  I AL++G LVE F      P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    HLFSVPSSAPFLRTTIAALVDGRLVEGFDVR-TAPERLADATLYLPTRRAGRMAREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFT----ADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            + G  + +LP I +LGD+ E++      A  L    + P +  + R L L +LI  W  +
Sbjct: 61   VLGADAVLLPRIVALGDIDEDELAFAQAASGLADLEIPPALDGLPRRLLLTQLIASWAAR 120

Query: 123  LPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            L        P+ P   P+    PA+A+ LA +LA +ID + T    W  L  L  + +  
Sbjct: 121  L-------KPDDPTQAPLVVGGPASALALADDLARLIDDMSTRGVDWSALETLVPDAFDR 173

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L  DFLKIA   W + L E +   P   +  L+ AEA+ L     GP+I AGSTGS+
Sbjct: 174  YWSLTLDFLKIAGHAWPQYLKETDRIEPAARRDRLIDAEAQRLATQRSGPVIAAGSTGSM 233

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS-THPQYSLAK 298
            PATA+L++ +A  P+GA+VLPGLD  +  A W+ I           T  S  HPQY++  
Sbjct: 234  PATAKLLTAIARLPHGAVVLPGLDIDLDDAAWDLIGGSRDRQGKLVTPPSPNHPQYAMHG 293

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKCFS 357
            LLD + + R DV++LG  +   +GR ++ S++  P   + + +  + + ++   I +   
Sbjct: 294  LLDRMGVTRRDVQQLGTPAR--HGRELLSSEALRPSSATAVWHDRLKDAEVDRLIGEGTD 351

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
             + LIEA N   EA++IA+ LR +  E  K +AL+T DR LARRV   L R+ + +D S 
Sbjct: 352  GLTLIEAPNSEAEALAIAVVLREAR-EQGKTAALVTPDRALARRVVAALGRWHLPVDDSG 410

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G  L  T                 +   +  L+KHPL + G        A   LEL  LR
Sbjct: 411  GDSLMETQPGIFARLAAETALDGCEPATLLALLKHPLLRLGRTGYGWRGAIETLELALLR 470

Query: 478  GNKNSYDIMDLK---SLVLDRIATQKNNT----HVPHWQSRLSEEDKELAVLLVDHILQC 530
            G + S     L    ++    +A  K       H    ++RLSE   + A  L+  +   
Sbjct: 471  GPRPSAGCDGLAKEFAIFRGELAKLKRGEASALHPSEPRTRLSEPSLDEAQDLIAQLKAA 530

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            + PL T   N    C      +        L+ +  D+   +  ++   +G  L   F  
Sbjct: 531  LAPLETVGPNPLDLC------EIGARHCAALKALTTDDE-GIAEVFEGPQGSALLRAFDD 583

Query: 591  IIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
            +   G  S +   A ++ ++         V+      + + I G LE+RL   D ++LGG
Sbjct: 584  LAAVGPASGVLVAARDYGEVFETAFGDRVVRRPELAEAPIRIYGPLEARLTQQDRVVLGG 643

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            L EGVWP     +P+LSR M+ +L L   E+ IG +AHDF  A G   +  T + +    
Sbjct: 644  LVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQALGADEVFITHAAKVGGA 703

Query: 709  PTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
            P +ASR+L RL  + G D +  +K RGQ YLD+T +LD         +P P PP  A+P 
Sbjct: 704  PAVASRFLHRLEAVAGEDRWKAMKARGQIYLDYTHELDRPESVTPIAQPAPRPPRIARPL 763

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
                + I+  + DPY +YA+ IL+L  +          DRG+  H  + E  ++  +   
Sbjct: 764  KLPVTAIEDWLRDPYTIYAKYILRLSPLDPVDMPLSGADRGSAIHAALGEFTERYQDALP 823

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
             +    ++QI   HF           +W   F +I+  F   E++ ++ + ++       
Sbjct: 824  DDPVTALRQIGQKHFAPLMDHAEARALWWPRFLRIATWFAAWEQQRRTGVVQVQAERRGT 883

Query: 889  MAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
            + I   G     L+  ADRI+    G   I DYKTG  P  +  +  + PQL+LEAA L+
Sbjct: 884  LMIPLGGERNFELSARADRIERRDDGSYAILDYKTGHPPTGKQVRMGLSPQLTLEAAILR 943

Query: 946  AGSFSQID-CRKVANLFYIRL--------KQKFKIDCITNDKKKYSADELSEKSLKNLIE 996
             G F  I     V+ L Y++L        ++  ++     D+ ++  D+ ++++   L  
Sbjct: 944  DGGFEDIPAAASVSELTYVKLSGNTPPGDERVLELKIERKDEPQHP-DDAADEARAKLEG 1002

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +V   ++ +Q + S L LS  S     YD LAR+ EW
Sbjct: 1003 LVRRFEDEKQSYRS-LVLSMWSQRYGTYDDLARIKEW 1038


>gi|86747754|ref|YP_484250.1| hypothetical protein RPB_0628 [Rhodopseudomonas palustris HaA2]
 gi|86570782|gb|ABD05339.1| DNA helicase/exodeoxyribonuclease V, subunit B [Rhodopseudomonas
            palustris HaA2]
          Length = 1048

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 321/1062 (30%), Positives = 496/1062 (46%), Gaps = 61/1062 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF++ PS+PF R  I AL++G L+E F      P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    RVFSVPPSAPFLRTTIEALVDGRLIEGFDAR-AKPERLAEATLYLPTRRAGRLARDIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLL----SYNLNPPVSNIQRLLELARLILIWRNK 122
            + G  + +LP I  LGDV E++             ++ P +  + R L LA+LI  W   
Sbjct: 61   VLGTDAVLLPRIVPLGDVDEDELAFAQAATGAADLDIPPALDGLPRRLLLAQLIAAW--- 117

Query: 123  LPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
                 K L P  P   P+    PA+ + LA +LA +ID + T    W  L  L  + +  
Sbjct: 118  ----AKGLRPGDPQQSPLVVGGPASTLALADDLARLIDDMATRGVDWAALDMLVPDAFDR 173

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L  DFLKIA ++W   L E +   P   +  L+ AEA  L     GP+I AGSTGS+
Sbjct: 174  YWRLTLDFLKIAGQWWPLHLRETDRIEPAARRDLLIEAEAARLAAHRGGPVIAAGSTGSM 233

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT---EKSTNITSSNTTYSTHPQYSL 296
            PATARL+  +A  P+GA+VLPGLD  +  A W  I    +K   + S  +    HPQ+++
Sbjct: 234  PATARLLHAIAQLPHGAVVLPGLDTELDEAAWQMIGAVHDKQGKLISPPSP--NHPQFAM 291

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
              LL  + ++R DV RLG    E +GR  V++   + P ++     D L +  P I +  
Sbjct: 292  HGLLARMGLERRDVLRLGE--GERHGRE-VLASEMMRPSSATAAWHDRLAD--PAIDQLI 346

Query: 357  SD----VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
             D    + LIEA N   EA++IA+ LR +  E  + +AL+T DR LARRV   L R+ + 
Sbjct: 347  GDGTHGLTLIEAPNSEIEALTIAVVLREA-RERGQSAALVTPDRALARRVVAALGRWKLP 405

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
            +D S G  L  T                 +   +  L+KHPL + G        A   LE
Sbjct: 406  VDDSGGDSLMDTQAGIFARLAAETALHGCEPATLLALLKHPLLRLGRAAYGWRSAIETLE 465

Query: 473  LVALRGNKNSYDIMDL-KSLVLDRIATQKNNT------HVPHWQSRLSEEDKELAVLLVD 525
            L  LRG + +     L K     R    K N+      H    ++RL +E  + A  L+ 
Sbjct: 466  LALLRGTRPAAGTEGLAKEFARYRAELTKLNSGELSALHRAEPRARLGDEALDEAHALIV 525

Query: 526  HILQCITPLVTYKTNKNSTC--GNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT 583
             +   + PL +        C  G    +    L++    N    E           +G  
Sbjct: 526  ALRAALAPLESVGVEPIDLCAFGQRHRAVLIALSIDHDDNAVAFEG---------PQGSA 576

Query: 584  LSSLFSKI--IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
            L   F  +  +E  S +     ++ ++         V+      + L I G LE+RL   
Sbjct: 577  LLKAFDDLAEVEPLSGVMVPPHDYPELFETAFSDRIVRRPELAGAALRIYGPLEARLTQH 636

Query: 642  DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
            D ++LGGL EGVWP     +P+LSR M+ +L L   E+ IG +AHDF    G   +I + 
Sbjct: 637  DRVVLGGLVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQLLGANEVILSH 696

Query: 702  SLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFP 761
            + +    P +ASR+L RL  + G   + ++K RG  YLD+   LD   +     +P P P
Sbjct: 697  AAKVGGAPAVASRFLHRLEAVAGKARWSDIKARGATYLDYALALDRPDQVTPIAQPAPKP 756

Query: 762  PLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK 821
            P EA+P   S + I+  + DPY +YA+ IL L  +          +RG+  H  + +  +
Sbjct: 757  PREARPLKLSVTAIEDWLRDPYTIYAKFILGLSALDPVDMPLSAANRGSAIHEALGDFTE 816

Query: 822  KRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKI 881
            +  +    +   L+++I + HF      P    +W   F +I+  F   E+  ++   ++
Sbjct: 817  RFPDALPDDPAGLLREIGEKHFAPLMDHPEARALWWPRFARIAAWFGNWEQGRRADGRRV 876

Query: 882  FVNIPAKMAIESIGIH---LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLS 938
            F      ++I   G     LT  ADRI+    G   I DYKTG+ P  +  +  + PQL+
Sbjct: 877  FAERDGSLSIPLDGGRNFVLTARADRIEHRPDGSYAILDYKTGNPPSSKQVRLGLSPQLT 936

Query: 939  LEAAALKAGSFSQIDC-RKVANLFYIRLK------QKFKIDCITNDKKKYSADELSEKSL 991
            LEAA L+ G F  ID    V+ L Y++L       ++  +     ++   S D+ + ++ 
Sbjct: 937  LEAAILRDGGFQDIDAGASVSELMYVKLSGNSPPGRELPVKLAVGNETPQSPDDAAIEAR 996

Query: 992  KNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              L  +V    +  QP+ + L LS  +     YD LAR+ EW
Sbjct: 997  AKLAALVRQFDDEAQPYHA-LVLSMWTQRYGRYDDLARIKEW 1037


>gi|154247227|ref|YP_001418185.1| double-strand break repair protein AddB [Xanthobacter autotrophicus
            Py2]
 gi|154161312|gb|ABS68528.1| Double-strand break repair protein AddB [Xanthobacter autotrophicus
            Py2]
          Length = 1015

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 324/1057 (30%), Positives = 507/1057 (47%), Gaps = 80/1057 (7%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENF--RYDPLNPLLLASVTIYVPTKRAIQELRSE 63
            P V TI  S+PF   +  ALL+GTLVE F  R DPL    LA  T+++PT+RA +     
Sbjct: 2    PRVLTIPSSAPFLPTLATALLDGTLVEGFAPRADPLA---LAGATVFLPTRRAGRLFAEA 58

Query: 64   FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV-------SNIQRLLELARLI 116
             ++ +G    +LP I  LGDV E+       L+++ + PV       + + R L LARL+
Sbjct: 59   LLQASGGAVLLLPKIVPLGDVDEDA------LAFSEDAPVLAAPHAIAPVHRRLVLARLV 112

Query: 117  LIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEK 176
              WR+ L    K    E+   +    A    LA  L  + D + T     + L  L  E+
Sbjct: 113  AHWRDTL---AKAAGREA---VAAGTAATFALADALGALFDDLTTAGLTVDGLDGLVPEE 166

Query: 177  YGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL--MKGTKGPIIIAG 234
               ++ +  DF++IA + +T+ L       P   + AL+ AEA  L  +    GP+I AG
Sbjct: 167  LDRYFRVGLDFVRIARRAFTDYLDIAGLVEPAARRDALVDAEARRLAALGSDAGPVIAAG 226

Query: 235  STGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQY 294
            STGS+PATARL++ +A  P GA+VLPGLD  +  A +         IT        HPQY
Sbjct: 227  STGSMPATARLLAAIAALPKGAVVLPGLDQDLDAASF-------ARITDGRDAAPDHPQY 279

Query: 295  SLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIP--NI 352
             LA+LL  L + R DV  L   +   +GR  ++S+     +TSD+  +  + +++P   +
Sbjct: 280  GLARLLPRLGVARGDVLSL--AAPTAFGRERLMSEVMRQAETSDLWAS--VSDRLPPAAL 335

Query: 353  QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
                + ++++EAD+ R EA++IA+ LR SL+   + +AL+T DR+LARRV  E+ RFG+ 
Sbjct: 336  GTAMAGISVVEADDPRAEALAIALLLRDSLEREGETAALVTPDRDLARRVAAEMARFGVA 395

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
            +D SAG PL+ +    +   L+ A  +    + +  L+ HPLA+FG   +  + A  ALE
Sbjct: 396  LDDSAGTPLADSPAGRLAGLLVMAAAEDLAPVPLFALLTHPLAQFGLAPEAKADAVAALE 455

Query: 473  LVALRGNKNSYDIMDLKSLVLDRIATQKNNTH-VPHWQSRLSEEDKELAVLLVDHILQCI 531
            LVALRG +    I  L    +D IA    + H     + R+ E     A  LVD + + +
Sbjct: 456  LVALRGPRPRAGIGGL----MDAIAAFDRDDHRGADPRRRMGEGALNRARDLVDRLDRAL 511

Query: 532  TPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG-------KTL 584
             P++T    + +                   +  +  HR     W    G          
Sbjct: 512  GPMLTLGAQRGAAP----------------LSALVAAHRA---AWVGTAGPLDIDAEDAA 552

Query: 585  SSLFSKIIET--GSCIKANAIE---WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLL 639
             +  ++  ET  G+     A++   + D    L     V+P+ E  + + ILG LE+RL+
Sbjct: 553  EAALARTFETLDGAAGDGPALDLSAYADAAGALFADAMVRPRAEPHARIRILGPLEARLI 612

Query: 640  NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIY 699
            + D ++LG L EG WP+    +P+LSR M+ DL L   E+ IG +AHDF    G   ++ 
Sbjct: 613  HVDRMVLGALIEGSWPRIAETDPWLSRPMRGDLGLDLPERRIGLSAHDFVQGFGAAEVVL 672

Query: 700  TRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKP 759
            T + +     ++ SR++QRL  + G   +   + RG  ++   R+LD     P   RP P
Sbjct: 673  TFAAKVGGTQSVPSRFVQRLKTVAGEAEWTAARTRGARWVQAARRLDDAPAVPRATRPAP 732

Query: 760  FPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITEL 819
             PPL  +PR  S +E++  + DPY++YAR +L L  +          +RG+  H  I   
Sbjct: 733  APPLALRPRRLSVTEVETFLRDPYSIYARHVLGLLPLDPLDAALGGAERGSALHEAIGRF 792

Query: 820  IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
             +    K  P+    + +     F      P    +W   F + +   +  E + +  ++
Sbjct: 793  TQDHPCKLPPDALERLLEEGRRAFAPLKAFPAEHALWWARFERAAGFLVAFERERRGHLD 852

Query: 880  KIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQL 937
             +       + I   G    LTG ADRI++ + G ++I DYKTG  P       L  PQL
Sbjct: 853  HVVAEASGSLEIPLGGGAFRLTGRADRIEVRRDGLLNILDYKTGTAPSARQVASL-SPQL 911

Query: 938  SLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSAD-ELSEKSLKNLIE 996
             LEAA  + G+F  +    VA+L Y+ LK           + K S   +L+E +L  L  
Sbjct: 912  PLEAAMARRGAFPDVPAVDVADLLYVELKGGAAGGEEKPIRLKDSDTMDLAETALAGLES 971

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++   +N  Q + S L   + S     YDHLARV EW
Sbjct: 972  LLMAFENEAQGYRS-LAAPQWSGTFGTYDHLARVREW 1007


>gi|220921600|ref|YP_002496901.1| double-strand break repair protein AddB [Methylobacterium nodulans
            ORS 2060]
 gi|219946206|gb|ACL56598.1| double-strand break repair protein AddB [Methylobacterium nodulans
            ORS 2060]
          Length = 1037

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 325/1054 (30%), Positives = 513/1054 (48%), Gaps = 56/1054 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             +FTI P  PF   +  ALL+GTL  +   DPL    LA+VT+Y+PT+RA + L +   E
Sbjct: 5    RIFTIPPGVPFLATLAEALLDGTLAGDVGRDPLG---LATVTLYLPTRRATRALAAILAE 61

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLS-------YNLNPPVSNIQRLLELARLILIW 119
              G  + +LP +  LG+  E +   DL  +         L+PP+  ++R L LARL+  W
Sbjct: 62   RCGP-AALLPRMVPLGEADEAEL--DLAAAPFGERQEAVLHPPIPPLERRLILARLVQAW 118

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
               +   +  +  E P  +P SPA+A+ LA +L  ++D +  E   W+ +      +Y  
Sbjct: 119  AASIDRQLLPMDAEVPFRVPSSPADAVGLAADLEGLMDALTVEGLPWDQIGQAVEAEYSR 178

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGS 238
            ++ L  DF++IA+++W   L E   S PV    AL+ AEA  L +     PI++AGSTGS
Sbjct: 179  YFSLTLDFVRIAAEHWPAILAERGVSDPVARGRALVLAEAARLRRERPADPIVVAGSTGS 238

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +PATA L++ +A  P GA+VLPGLD  +  A W         I +       HPQ  + +
Sbjct: 239  VPATAALIAAIAAMPRGAVVLPGLDLALDEAGW-------AAIDTGEAIAHGHPQAVMHR 291

Query: 299  LL--DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
            LL    LD  R  V+ LG  S E   R+ ++S++  P +T+D        +++   +   
Sbjct: 292  LLGPGALDCGRAAVRPLGRPSPEAEARAALLSQALRPAETTDAWADLDPGHRVSLARAGG 351

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
            + + ++EA +EREEA+++A ALR +L+   + +ALIT DR LARRV  EL R+ I  D +
Sbjct: 352  AGLGIVEAADEREEALAVAAALRETLERPGRTAALITPDRTLARRVAAELKRWNIVADDT 411

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            AG PL+ +    +     +    +     +  L+ HPLA+ G     + RA +ALE+  L
Sbjct: 412  AGQPLALSPAGRLARLAADVAALVAKPDRVLALLAHPLARLGCSRAEVVRAASALEIGVL 471

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
            RG         L   +  R+A  +   H P  + RL+E D + A  LVD +         
Sbjct: 472  RGPAPGKGFAGLAEAL--RVARTEERPHDPRARRRLTEADWDAAADLVDRLSVAFRDFFA 529

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS--KIIET 594
             + +       L+ +  T    TC  ++ LD    + +   E     L  LF    + ET
Sbjct: 530  DEDDAVRDLVGLARAHRT----TC--DLLLDGPDAVED---EASVAVLDGLFDDLALAET 580

Query: 595  GSCIKANAIEWIDIITRLIDGETVKPKIE-KSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            G  +     ++    T L     V  +       L ILG LE+RLL+ D +++ GL+EGV
Sbjct: 581  G-LLAGRFSDYPAFFTALARERVVAERRALPHPRLRILGLLEARLLSVDRVVVAGLDEGV 639

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP     + FL+R M+  + L   E+ +GQ AHDF  A G    + TR+ +    P + S
Sbjct: 640  WPPKAETDAFLNRPMRGAVGLSPPERRLGQTAHDFVQALGCPDAVITRAHKREGSPMVPS 699

Query: 714  RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTK--QPHYKRPKPFPPLEAQPRTYS 771
            R+LQRL    G + +    + G+ +      LD  T+   P   RP P P     PR+ S
Sbjct: 700  RFLQRLRAFMGEEAWSARVRAGERFRALAAALDRGTEPLPPRLARPAPKPDPALFPRSLS 759

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE- 830
             +E++ L+ DPYA++AR +L LD +      P  +DRGT+ H+++     +R  +  P  
Sbjct: 760  VTEVETLVRDPYAIFARHVLGLDPLEPVAVQPSASDRGTIVHDVLGGF-AQRFPEALPAD 818

Query: 831  -INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
             +  L+   +++     +  P +   W   F +++ +FL  E + +  + ++      + 
Sbjct: 819  PLTPLLDLAVNAFAPIADAYPELYAEWWPRFERMAGAFLAWEAERRPGLARVHAETFGRW 878

Query: 890  AIESIG----IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
             I  IG      L   ADRI++ + G   I D+KTG  P  +       PQL+LEAA L+
Sbjct: 879  RI-PIGPAEDFTLRARADRIEVTRGGGHVIVDFKTGQPPSAKEVFAGFAPQLTLEAAMLR 937

Query: 946  AGSFSQID-CRKVANLFYIRL-KQKFKIDCI----TNDKKKYSADELSEKSLKNLIEIVT 999
            AG F  +     V +L Y+R    K  +D +       +++  AD + E + +    I  
Sbjct: 938  AGGFRDLGAAAAVPDLLYVRAGGGKVPLDPVPLKPPRGEERSVADLVDEHARRFQALIAR 997

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             LQ GE  F+S     + +   S YDHLARV EW
Sbjct: 998  FLQ-GEAAFLSR-PYPKYARAYSAYDHLARVKEW 1029


>gi|85714149|ref|ZP_01045138.1| hypothetical protein NB311A_08333 [Nitrobacter sp. Nb-311A]
 gi|85699275|gb|EAQ37143.1| hypothetical protein NB311A_08333 [Nitrobacter sp. Nb-311A]
          Length = 1059

 Score =  422 bits (1086), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 318/1053 (30%), Positives = 499/1053 (47%), Gaps = 42/1053 (3%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             V  +  S PF R +I AL++G L+E FR     P  LA VT+Y+PT+RA +  R  F++
Sbjct: 13   RVRNVPTSVPFLRTVITALVDGALIEGFRPR-AQPERLAEVTLYLPTRRAGRMARDIFLD 71

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDI 126
            +    + ILP I +LG + E++       + +L+P    +   LE     L     +   
Sbjct: 72   VLDNDAVILPRIVALGGIDEDELA--FAQAVSLSPEALELPPALEGLARRLALARLIDAW 129

Query: 127  IKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
             + L P  P   P+    PA+ + LA++LA ++D + T    W  L  L  E    +W L
Sbjct: 130  ARRLKPGEPSQAPLVLGGPASTLALAEDLARLMDDMATRGVDWRALDGLVPEALDRYWQL 189

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
              DFLKIA  +W   L E     P   +  L+ AEA  L+    GP+I AGSTGS+P+TA
Sbjct: 190  TLDFLKIARDHWPIHLQETGRVEPGVRRDRLIEAEAARLVT-HAGPVIAAGSTGSMPSTA 248

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT-EKSTNITSSNTTYSTHPQYSLAKLLDF 302
            +L+  +A  P GA+VLPGLD  +    W  I   K  +        + HPQ++L  LL  
Sbjct: 249  KLLHVIATLPQGAVVLPGLDTDLDEDAWQLIGGHKDKSGAFITLPAAGHPQFALHGLLTR 308

Query: 303  LDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN-IQKCFSDVAL 361
              I R +VK LG  +   YGR ++ S++  P + +   +T + + ++   I     ++A+
Sbjct: 309  FGITRREVKPLGAPAP--YGRELLASEAMRPSEATAQWHTRLAKPEVAEKIAAGLQNLAV 366

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPL 421
            I A N   EA+ IA+A+R + + NK  +AL+T DR LARRV   L R+ ++ D S G PL
Sbjct: 367  IAAANPEIEALGIAVAMREARELNKT-AALVTFDRALARRVMAALGRWNLSFDDSGGDPL 425

Query: 422  STTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNK- 480
              T                 +  A+  L+KHPL + G      SRA   LEL  LRG + 
Sbjct: 426  MDTPAGIFARLAAETACNGLEPPALLALLKHPLCRLGRAAGGWSRAVATLELAVLRGTRP 485

Query: 481  --NSYDIMDLKSLVL---DRIATQKNNT-HVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
               S  + D  +      D++   +N++ H    ++ L     + A  L+  +   + PL
Sbjct: 486  PPGSKGLADEFARFCGERDKLDRGENSSLHRSEPRAALKPHHLDEARHLIAALRDALAPL 545

Query: 535  VTYKTNKNSTCGNLSISDWTKLTVTCLQNV-CLDEHRKLPNLWFE-EEGKTLSSLFSKII 592
                 ++++        D++ L     Q +  L    +   + F+ + G+ L+  F  + 
Sbjct: 546  EGDGASRSA--------DFSVLAAQHRQTIDALSHDDEGVAVAFDGQHGRALADAFDDLR 597

Query: 593  ETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLN 650
            ETG  S +     ++ D          V+     +++L I G LE+RL   D +ILGGLN
Sbjct: 598  ETGERSGLTVRIADYPDTFEAAFGDRVVRRPQTTTASLRIYGPLEARLTQCDRVILGGLN 657

Query: 651  EGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPT 710
            EGVWP     +P+LSR M+ DL L   E+ IG +AHDF    G   +I + + +    P 
Sbjct: 658  EGVWPPAPPTDPWLSRPMRHDLGLDLPERRIGLSAHDFTQLLGAEDVILSHAAKAGGSPA 717

Query: 711  IASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            +ASR+L RL  + G   +    + G  Y+ +   LD   +     +P+P PP  A+P   
Sbjct: 718  VASRFLHRLEAVAGATRWTAAIQAGARYIRYAEALDRPDQVTPVTKPEPKPPRAARPAHL 777

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            S + I+  + DPY +YA+ ILKL  +          DRG+  H+ + +  K        +
Sbjct: 778  SVTAIEDWLRDPYTIYAKYILKLLPLDAVDMPLSAADRGSAIHDALGDFTKLYPANLPDD 837

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
               +M+ I + HF      P    +W   F +I+  F E E   ++ + +I   +  K+ 
Sbjct: 838  PEDVMRAIGERHFAPLMQRPEARALWWPRFQRIAAWFAEWERTRRAHLVRIDAEVSGKIE 897

Query: 891  IESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
            I   G     L+  ADRI+ L  G   I DYKTG  P  +  +  + PQL+LE+A L+ G
Sbjct: 898  IPIDGDRKFMLSARADRIEHLGGGRFAILDYKTGRPPSSKQVRIGLSPQLTLESAILRKG 957

Query: 948  SFSQIDCRKVAN-LFYIRLKQKFKID--CITN----DKKKYSADELSEKSLKNLIEIVTL 1000
             F+ I      N L Y+RL    +    C+ N       K S DE ++++L+ L  ++  
Sbjct: 958  GFAGIPAGASVNELVYVRLSGNSQPGEACLVNLNNGKTDKQSPDEAADRALEELTALIRA 1017

Query: 1001 LQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              + +Q + S L L         YD LAR+ EW
Sbjct: 1018 FDDEQQGYPS-LDLPMWKTRYGVYDDLARIKEW 1049


>gi|154250593|ref|YP_001411417.1| double-strand break repair protein AddB [Parvibaculum lavamentivorans
            DS-1]
 gi|154154543|gb|ABS61760.1| Double-strand break repair protein AddB [Parvibaculum lavamentivorans
            DS-1]
          Length = 1001

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 322/1063 (30%), Positives = 515/1063 (48%), Gaps = 112/1063 (10%)

Query: 7    NVFTIAPSSPFFREMIPALLNG-TLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            N+FT+ P +PF   +   LL+  +L   F+  P     LA +TI +PT+R+++ L   F+
Sbjct: 7    NLFTMPPGTPFLERLAATLLDDPSLGGRFKGSPE----LAEITILLPTRRSVRALGEAFL 62

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLL--------SYNLNPPVSNIQRLLELARLIL 117
                    +LP I++LGDV EE    DL+L        +  L P +  ++R L LAR+I+
Sbjct: 63   RAGAGAPLLLPSIRTLGDVDEE----DLILDPRGLGREALELPPAMPALERQLRLARMIV 118

Query: 118  IWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKY 177
              +                        A+ LA +L   +D++ TE      L  L  + +
Sbjct: 119  EGQGG------------------DETRALALAADLGHFLDMVLTEGADLTRLADLVPQDF 160

Query: 178  GMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK-GPIIIAGST 236
               W +  DFLK+ +  W E L  L        +  L+RA+AE        GP+I AGST
Sbjct: 161  ADHWQITIDFLKVLTARWPEELARLGHMEQAERRNLLLRAQAEAWTAAPPPGPVIAAGST 220

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSL 296
            GSIPATA L+  VA+ P GA+VLP LD  +    WN I +  T         ++HPQY +
Sbjct: 221  GSIPATAALLGVVAHLPMGAVVLPALDLDLDEESWNIIGKPGT---------ASHPQYGM 271

Query: 297  AKLLDFLDIKREDVKRLGNV--SNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQK 354
             KLL  L   R DV        S  +  R  ++S++  P +T++ R    L     +++ 
Sbjct: 272  KKLLAHLRATRADVGIWPGAERSAALRSRGRLLSEALRPAETTE-RWLGRLGALDGDVKD 330

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
                +ALIEA +ER+EA ++A+ +R  L+   K +AL+T DR LARRV +EL R+ I+++
Sbjct: 331  GLKGLALIEAPSERDEAGAVALLMRDVLERPGKTAALVTPDRKLARRVAMELRRWKIDVN 390

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGF-PEKYLSRAKNALEL 473
             S G PL+ T   + L  + N + +    + +   +KHPLA  G  P K+ +R +  LE+
Sbjct: 391  DSGGEPLAKTAPVAFLRLVANMVTEDLAPVPLLACLKHPLAAAGEEPAKFRARVRR-LEM 449

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
              LRG + +  +  L++    R    K              +  E+++LL D I + I P
Sbjct: 450  HLLRGPRPAPGLDGLRAAC--RALEDKPG------------DSGEISILL-DKIERSIAP 494

Query: 534  LVTYKTNKNSTCG--NLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI 591
            L+   T K +        +    +L  +  +            LW  E G+  +    ++
Sbjct: 495  LLNAATKKGTATSIVEAHVEAAERLAASATETGA-------ERLWKGEAGEAAADFIREL 547

Query: 592  IETGSCIKANAIEWIDIITR--------LIDGETVKPKIEKSSTLFILGTLESRLLNFDT 643
            +E             DI  R        L+ G  ++P+  + S LFI G LE+RL + D 
Sbjct: 548  MEATPAFG-------DIDPRFYPHFFDVLLSGRVLRPRWGRHSRLFIWGPLEARLQHADR 600

Query: 644  LILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSL 703
            +ILGGLNEG WP     +P+L+R M++ + L+  E+ IG AAHDF           TR+L
Sbjct: 601  MILGGLNEGTWPAEANIDPWLNRPMRATMGLEPPERRIGLAAHDFAEGASAGEAFLTRAL 660

Query: 704  RENNIPTIASRWLQRLL-VLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPP 762
            +    PT+ASRW  RL  +L G +  + +      +  W  KLD   K     RP+P PP
Sbjct: 661  KVEGAPTVASRWWLRLASLLQGLEQEEAVS--APQWWQWAHKLDEPAKVLTPLRPRPVPP 718

Query: 763  LEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKK 822
            LEA+P+ +S +EI+ LI DPYA+YAR+IL L  +     D    +RGT+ H  + + ++ 
Sbjct: 719  LEARPQRFSVTEIETLIRDPYAIYARKILGLKVLDPLDADIAAAERGTIIHEALEKFVEA 778

Query: 823  RINKNTPEINHLMK--QIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
               ++ PE N L +   + +  F +    P +   W   F +I+   +++E++ ++ +  
Sbjct: 779  -YPRDLPE-NALQELINVGEEAFRQAIGRPGVAAFWWPRFLRIAKWIVDYEQEERAGLRH 836

Query: 881  IFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLS 938
            I      ++ I  +   + L+G ADRID  + G V+I DYKTG  P  +  +  + PQL 
Sbjct: 837  IHAETRGEILIAELAQPVVLSGKADRIDEREDGMVNIVDYKTGTVPSIKQVEIGLTPQLP 896

Query: 939  LEAAALKAGSF-----SQIDCRKVANLFYIRL---KQKFKIDCITNDKKKYSADELSEKS 990
            LEAA +  G F     + I   K A+L Y+RL   +   ++  I ++       +L++ +
Sbjct: 897  LEAAMMARGGFRTKDGAPIPPAKAASLIYLRLTGGETAGEVRAIPDEGA-----DLADNT 951

Query: 991  LKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
               L++++   +    P++S  R         +YDHLARV EW
Sbjct: 952  YAWLVDLLRQYEAETTPYLSRPRPMFWGRY-GDYDHLARVKEW 993


>gi|146337256|ref|YP_001202304.1| helicase-exonuclease type V family protein AddB subunit
            [Bradyrhizobium sp. ORS278]
 gi|146190062|emb|CAL74054.1| putative helicase-exonuclease type V protein family, addB subunit
            [Bradyrhizobium sp. ORS278]
          Length = 1048

 Score =  416 bits (1068), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 316/1064 (29%), Positives = 507/1064 (47%), Gaps = 65/1064 (6%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENF--RYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
             VFT+  S+PF R +I AL++G LV+ F  R DP     LA+ T+Y+PT+R+++  R  F
Sbjct: 2    RVFTVPISAPFLRSVIAALVDGRLVDGFEARSDPAR---LATATLYLPTRRSLRVAREMF 58

Query: 65   IEITGKKSTILPIIKSLGDVVEEK--FTAD---LLLSYNLNPP--VSNIQRLLELARLIL 117
            ++     + +LP + +LGD+ E++  F  D    L    L  P  + ++QR L LARL+ 
Sbjct: 59   LDELRTDAAVLPRLVALGDIDEDELAFAEDRDAFLGPAPLELPERLDDLQRRLTLARLVA 118

Query: 118  IWRNKLPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKN 174
             W             ++P+S P+    PA+ + LA +LA +ID I T    W+ L  L  
Sbjct: 119  AW------------AKTPVSAPLVIGGPASTLALAGDLARLIDDIVTRGVSWDALDQLVP 166

Query: 175  EKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAG 234
            ++   +W  + +FL+IA   W   L E+    P   +  L+ AEA  L     GP+I AG
Sbjct: 167  DQLDKYWQFSLEFLRIARTAWPAYLQEIERIEPAARRDLLIAAEAARLSAHPDGPVIAAG 226

Query: 235  STGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT---EKSTNITSSNTTYSTH 291
            STGS+PATA+ +  VA  P+GA+VLPGLD  +  A W++I    ++S  + +       H
Sbjct: 227  STGSMPATAKFLLAVAKLPHGAVVLPGLDTDLDEAAWSSIGGAKDRSGRVITPPAV--NH 284

Query: 292  PQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIP- 350
            PQY++  LL    ++R DV RL        GR ++IS++  P + + + +  + +  I  
Sbjct: 285  PQYAMHLLLRRFGLERRDVLRLAPPGRG--GREVLISEAMRPSEATAIWHERLRQFDIAA 342

Query: 351  NIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFG 410
            NI +   +++++ A N   EA++IAIA+R +     K +AL+T DR LARRV   LTR+ 
Sbjct: 343  NIAEAMDNLSVVAAPNPEMEALAIAIAMREA-RHLGKSAALVTPDRALARRVMAALTRWH 401

Query: 411  INIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNA 470
            +  D S G  L  T           A  +  +   +  L+KHPL + G        A   
Sbjct: 402  LTFDDSGGDALLETPAGIFARLAAEAAARGLEPPTLLALLKHPLCRLGRNAYGWKHAIET 461

Query: 471  LELVALRGNKNSYDIMDLK---SLVLDRIA----TQKNNTHVPHWQSRLSEEDKELAVLL 523
            LEL  LRG +       L    +   D  A     + ++ H    ++RL  +  + A  L
Sbjct: 462  LELALLRGTRPQAGTGGLARDFARFRDEHAKLHQGEASSLHRAEPRARLKPDQLDQAAAL 521

Query: 524  VDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT 583
            +  +   + PL    + +      L+      L      +V L         + + +G  
Sbjct: 522  IAQLQTALAPLENLASPRPQDFAELAARHREVLIALSTDDVGLG------TAFTDRDGAA 575

Query: 584  LSSLFSKIIETGS-C-IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
            L+  F  ++ +G  C + A   ++ D+         V+      + L I G LE+RL+  
Sbjct: 576  LARCFDDLLASGERCGLMAPLSDYPDLFHTAFSDRAVRRPERHGAQLQIYGPLEARLMQT 635

Query: 642  DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
            D +I+GGL EG+WP     +P+LSR M+  L L   E+ IG +AHDF    G   +I T 
Sbjct: 636  DRMIIGGLVEGIWPPAPRIDPWLSRPMRHQLGLDLPERRIGLSAHDFAQLLGAPEVILTH 695

Query: 702  SLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFP 761
            + +    P +ASR+L RL  + G   +     RG+ Y+ +   LD   +     +P P P
Sbjct: 696  AAKSGGAPAVASRFLHRLQAVAGDAQWKAATARGETYVRYAEVLDQPREVKPIPQPAPKP 755

Query: 762  PLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK 821
            PLEA+P   S + I+  + DPY ++AR IL+LD +          DRG+  H  I E  +
Sbjct: 756  PLEARPLRMSVTAIEDWLRDPYTIFARYILRLDPLDPVDMPLSAADRGSAIHEAIGEFTQ 815

Query: 822  KRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKI 881
                +      H ++ I + HF      P    +W   F +I+  F   E   +  I  I
Sbjct: 816  TFAKELPLHPAHALRVIGEKHFAPLMERPEARALWWPRFQRIAGWFAAWETARREHIGAI 875

Query: 882  FVNIPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLS 938
               I  ++ I   +     L+  ADRI+    G   I DYKTG  P  +  +  + PQL+
Sbjct: 876  TAEIRGEIGIPLGKDRTFMLSARADRIEQRAEGTYAILDYKTGQPPTAKQVRMGLSPQLT 935

Query: 939  LEAAALKAGSFSQIDCRK-VANLFYIRL--------KQKFKIDCITNDKKKYSADELSEK 989
            LEAA L+ G F  I     ++ L Y+RL        ++  ++    +D  ++  D+ +++
Sbjct: 936  LEAAILREGGFDGIPAGSLISQLVYVRLSGNNPPGEERILELKINKSDTPQHP-DQAAQE 994

Query: 990  SLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +   L E++   ++  Q + S L LS  +N    YD LAR+ EW
Sbjct: 995  ARNKLEELIRSFEDVNQGYTS-LNLSMWANRYGSYDDLARIKEW 1037


>gi|217977593|ref|YP_002361740.1| double-strand break repair protein AddB [Methylocella silvestris BL2]
 gi|217502969|gb|ACK50378.1| double-strand break repair protein AddB [Methylocella silvestris BL2]
          Length = 1043

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 308/1057 (29%), Positives = 505/1057 (47%), Gaps = 53/1057 (5%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            K NVFTIAP +PF +    A L+G +VE F     NPL LA  TIYVPT+RA + L  EF
Sbjct: 3    KKNVFTIAPGAPFLKTFAEAFLDGRVVEGFCAGE-NPLELAEATIYVPTRRAARALTDEF 61

Query: 65   IEITGKKSTILPIIKSLGDVVE-------EKFTADLLLSYNLNPP--VSNIQRLLELARL 115
                  K+ +LP I  LG + E       E   AD   S  L PP  +  I R ++LA L
Sbjct: 62   FRALPTKAVLLPRILPLGALDESETELLFEDGGADEF-SAPLEPPLAIGEIDRRMQLAEL 120

Query: 116  ILIWRNKL--------PDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWE 167
             L W   L         D  + L     L +  + A+A  L+ +LA +ID +  E+  W 
Sbjct: 121  CLSWSRLLRHAIVRVEADGARVLDERESLLVGATAADAWGLSGDLARLIDELIIEDIDWA 180

Query: 168  DLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK 227
             L  L +E +  +W +  DFLKIA   W   L +         Q++L+  ++  L     
Sbjct: 181  RLDPLASEGFDDYWRITLDFLKIAITQWPHILEQRGLVDRARRQVSLIERQSLALRDAPG 240

Query: 228  -GPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNT 286
             GP++  GSTGS  ATARL+  +A+ P GAIVLPGLD  +                    
Sbjct: 241  LGPVVAIGSTGSNRATARLLDAIASAPRGAIVLPGLDLKLD----EAAFALVARAADEGE 296

Query: 287  TYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDI 344
               THPQ +L +LL  L++ R++V+ LG ++     R   IS++  P + +D  +     
Sbjct: 297  PAFTHPQAALCRLLRTLNMSRDEVRPLGALTKAQDARERFISEALRPAEATDAWIAYRQA 356

Query: 345  LENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKL 404
            ++  +  +++  + V LIEA +EREEA+++AIA+R +L+     +AL+T DR LARRV  
Sbjct: 357  IDPAL--LEEALAGVTLIEAADEREEALALAIAMRHALERPDGTAALVTPDRELARRVAA 414

Query: 405  ELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMA--IATLVKHPLAKFGFPEK 462
            EL R+G+ ++ SAG PL +   + +L  L+ A    +D  A  +A L+ H   + GF  +
Sbjct: 415  ELLRWGVRVEDSAGEPLGSG-EAGLLARLVAAC-AADDMSAATVAALMAHGALRLGFSRE 472

Query: 463  YLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVL 522
             ++R +  LE+  LR        +   +  ++  A Q +  H    Q R+   + +    
Sbjct: 473  EIARLRPLLEIGVLRAAAGGK--LRDPARAIELAAAQADGPHAHPAQKRIFPRESDALRD 530

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGK 582
             +  +   + P++          G   ++ W +   T L  +   E  +  +    E+G+
Sbjct: 531  FLMRLEAALRPML-------EAGGERDLAFWVEAHRTALAAIRAGEPEEEDS---GEDGE 580

Query: 583  TLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKS-STLFILGTLESRLLNF 641
             L++LF ++  + +       E        + GE       ++   L ILG LE+RL++ 
Sbjct: 581  ALAALFEELALSATSEMRFDAEAYQFFFAAVAGEARLGAAGRTHPRLKILGLLEARLMDV 640

Query: 642  DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
            D ++LGGL+E VWP     + FL+R M++ L L   E+ +GQ AHDF  A G   ++ +R
Sbjct: 641  DVMLLGGLDESVWPPQARADAFLNRPMRAALGLSPPERKLGQTAHDFVQAMGRDKVVLSR 700

Query: 702  SLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH-YKRPKPF 760
            + +    PT+ASR++QRL  LGG   +     RG+ YLD  R +D     P   +RP+P 
Sbjct: 701  AAKRGGAPTVASRFIQRLAALGGP-AWAACAARGKTYLDLARLIDRPAAAPAPLRRPEPK 759

Query: 761  PPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI 820
            PP+  +P   S ++I+ L  DPYAVYA  ILKL  +    + P   + G+  H  I    
Sbjct: 760  PPVALRPNRLSVTKIETLRRDPYAVYAETILKLLPLDSIGRTPGPAETGSAIHAAIEAFT 819

Query: 821  KKRINKNTPE-INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
                    P      ++ ++    E     P     +     ++   ++  E   +S ++
Sbjct: 820  ASFGPGPLPAGARDTLRALLLKALEDNLADPGFAAFYVPRLKQMIDFYMGFEASRRSGLD 879

Query: 880  KIFVNIPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQ 936
            +I      ++     +     LT  ADRI+   SG + + D+KTG  P  +  +    PQ
Sbjct: 880  EIRTEAAGRLEFFLSDGSPFALTARADRIERAASGKLSLIDFKTGAPPGIKEIEVGFAPQ 939

Query: 937  LSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIE 996
            L+LEAA  K G+F      ++ +  Y++L             K  + ++++++   +L+E
Sbjct: 940  LTLEAAMAKRGAFGPAGQDEI-DALYVKLNGPGGGKVKPVVFKGRTVEDVADQHFAHLVE 998

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +++  ++ ++ +       + +   + YDHLARV EW
Sbjct: 999  LLSQFRDPDRSYPPR-PFPKFAKAYNAYDHLARVKEW 1034


>gi|90421910|ref|YP_530280.1| hypothetical protein RPC_0386 [Rhodopseudomonas palustris BisB18]
 gi|90103924|gb|ABD85961.1| DNA helicase/exodeoxyribonuclease V, subunit B [Rhodopseudomonas
            palustris BisB18]
          Length = 1042

 Score =  412 bits (1060), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 310/1054 (29%), Positives = 493/1054 (46%), Gaps = 50/1054 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VF    S+PF R +I AL+ G LV  F     NP  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    RVFNTPASAPFLRTLIAALVEGRLVPGFEAR-ANPERLAEATLYLPTRRAGRMAREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTA-------DLLLSYNLNPPVSNIQRLLELARLILIW 119
            +    + +LP I +LG + E++          D + S  + P ++ + R L LARL+  W
Sbjct: 61   VLQSDAVLLPRIVALGGIDEDELAFADDAEPFDGVASLEIPPNLAELDRRLILARLVAAW 120

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
              +L  ++              PA+A+ LA +LA ++D + T + +W  L  L  ++   
Sbjct: 121  GKELAPLVVG-----------GPASALALAGDLARLMDDMVTRKVEWAALDGLVPDELDN 169

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
            +W L   FLKIA ++W   L       P   +  L+ AEA+ L     GP+I AGSTGS+
Sbjct: 170  YWQLTLGFLKIAREHWPAYLAANALIEPAARRDLLIEAEAKRLAAHHTGPVIAAGSTGSM 229

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITE-KSTNITSSNTTYSTHPQYSLAK 298
            PATAR +  +A  P GA+VLPGLD H+    W  I   +  N  +     S HPQY+L  
Sbjct: 230  PATARFLRAIAALPQGAVVLPGLDTHLDDDAWRKIGGIRDANGKAVTPPSSNHPQYALHA 289

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKI-PNIQKCFS 357
            LL+   I+R DV  LG  +    GR ++ S++  P + +   +  + E  +  NI    +
Sbjct: 290  LLETFGIERRDVAPLGAPAPR--GRELLASEAMRPSNATAQWHQRLAEPAVEQNIAAGMT 347

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
            ++A+I ADN   EA++IA+A+R + + NK  +AL+T DR LARRV   L R+ +  D S 
Sbjct: 348  ELAVISADNPELEALAIAVAMRQARELNKS-AALVTPDRALARRVMAALGRWKLPFDDSG 406

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G  L  T           A     +   +  L+KHPL + G    +   A   LE   LR
Sbjct: 407  GDALIDTPPGVFARLSAQAATAQLEPATLLALLKHPLLRLGQAPGFWRGAIETLEQAVLR 466

Query: 478  GNKN-------SYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            G +        S D    +  +      + +  H    ++RL+++  + A  L+  +   
Sbjct: 467  GTRPAAGSAGLSRDFARFRDELGKLRRRETSMLHGSEPRARLNDDALDRAQALIAQLQTA 526

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            + PL T   N+      L  SD        +  +  D+       +   +G  L++ F  
Sbjct: 527  LAPLETLDPNRP-----LDFSDLATKHRAVVAALSRDDD-GFVAAFDGPQGNALNTAFDD 580

Query: 591  IIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLN 650
            +    S + A   ++ ++         V+    +S++L I G LE+RL   D +ILGGL 
Sbjct: 581  L-PAPSGLAAQPGDYTELFQTAFADRVVRRPEAESASLRIFGPLEARLTQCDRVILGGLV 639

Query: 651  EGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPT 710
            EG+WP     +P+LSR M+  L L   E+ IG +AHDF    G   +I + + +    P 
Sbjct: 640  EGIWPPAPRSDPWLSRPMRHQLGLDLPERRIGLSAHDFAQMLGADEVILSHAAKVAGAPA 699

Query: 711  IASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            +ASR+L RL  + G + +   + RGQ YLD+   LD   K     +P P PP +A+P   
Sbjct: 700  VASRFLHRLEAVAGAERWKAAEARGQIYLDYAHALDRPDKVVPITQPMPRPPRDARPLQL 759

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            S + I+  + DPY +YA+ ILKL  +          DRG+  H  + E  +        +
Sbjct: 760  SVTAIEDWLRDPYTIYAKFILKLAPLDPVDMPLSAADRGSAIHEALGEFTQVFAQALPDD 819

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
                ++ I   HF      P    +W   F +I+H F   E + + ++  +       ++
Sbjct: 820  PAAALRAIGQKHFAPLMERPEARALWWPRFLRIAHWFATWETERRLNVAGVDAETRGTLS 879

Query: 891  IESIGIH---LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
            I         L+  ADRI+        I DYKTG  P  +  +  + PQL+LEAA L+ G
Sbjct: 880  IPLDATRRFVLSARADRIERRADRTFAILDYKTGRPPTGKQVRMGLSPQLTLEAAILREG 939

Query: 948  SFSQIDC-RKVANLFYIRLK-----QKFKIDCITNDKKKYS--ADELSEKSLKNLIEIVT 999
             F  I     V+ L Y++L       + KI  +  D+ + +   D+ + ++   L  ++ 
Sbjct: 940  GFEGIAAGSSVSELVYVKLSGNNPPGEEKILELKRDRAEEALFPDDAAIEARAKLEALIR 999

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
               +   P+ S L L   +N   +YD LAR+ EW
Sbjct: 1000 KFDDATTPY-SSLNLPMWANRYGDYDDLARIKEW 1032


>gi|323138128|ref|ZP_08073201.1| double-strand break repair protein AddB [Methylocystis sp. ATCC
            49242]
 gi|322396590|gb|EFX99118.1| double-strand break repair protein AddB [Methylocystis sp. ATCC
            49242]
          Length = 1027

 Score =  412 bits (1059), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 317/1054 (30%), Positives = 516/1054 (48%), Gaps = 65/1054 (6%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENF-RYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            NVFTIAP +PF    + A L G +V +  R  P  PL +A  TIYVPT+RA + L ++F 
Sbjct: 4    NVFTIAPGAPFLETFVEAFLAGEIVASVSRASP--PLAMARATIYVPTQRAGRALAAQFA 61

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYN-----LNPPVSNIQRLLELARLILIWR 120
                + +T+LP I  LG + EE  TA L          L  P+  ++R L LA+L++ W 
Sbjct: 62   RAYDRGATLLPRILPLGGL-EESETAALFGGAEDFDDALPAPIEELERRLLLAQLVMQWS 120

Query: 121  NKLPDIIKDLYPES--------PLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHAL 172
              +   I  + P          PL +  SP+ A  LA +L  +ID    E+   E +  +
Sbjct: 121  KAIGRAILSIDPTGAPVLDETEPLLVASSPSGAYALAADLGALIDEFIIEDVAPEAIDRI 180

Query: 173  KNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPII 231
             ++ +  +W +   FL+IA   W + L E         Q  L+ A+   L +    GP+I
Sbjct: 181  VDDSFDKYWSITTQFLRIALHQWPDILSERGRIDAASRQKILLEAQVAALAQQKHGGPVI 240

Query: 232  IAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTH 291
              GSTG+ P TARL++ +A   NGA++LPGLD  +    W  + E      S +    +H
Sbjct: 241  ALGSTGAHPTTARLLAAIAALENGAVILPGLDREMSPDAWARVGE------SDDEPAFSH 294

Query: 292  PQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPP-DTSDMRNTDILENKIP 350
            PQ  L +LL+ + + REDV  LG VS E+ GR  +++++ LP  +TS  R      +   
Sbjct: 295  PQTMLKRLLNVMGVHREDVCELGKVSPELSGRRALVAEAMLPAIETSAWRL--FRASHGA 352

Query: 351  NIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFG 410
            +      DV+ IEA +ER EA+++A+ +R +L+  ++ +AL+T DRNLARRV  EL RF 
Sbjct: 353  SFVSALEDVSAIEAPDERMEALALALFMREALETPQRTAALVTPDRNLARRVAAELRRFD 412

Query: 411  INIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMA--IATLVKHPLAKFGFPEKYLSRAK 468
            I ID S G  L++T    +L  L+  I     F A  +A L+ HPLA  G   + ++   
Sbjct: 413  IEIDDSGGASLAST-SEGVLARLVAEI-GAEGFSAVNVAALLAHPLALLGHAREKVAALA 470

Query: 469  NALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEED-KELAVLLVDHI 527
              +E+  LR        +          A  ++     H   R+S+++ +++  LL    
Sbjct: 471  PLVEIGVLRELGAGQHGLSASVAKAREFAGARHAHPAAH---RISDDEWRDIEALL---- 523

Query: 528  LQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSL 587
             Q      TY + +    G  ++S W +      + +             ++  + L  L
Sbjct: 524  RQLEAAFATYVSLR----GENALSTWAQAHRAAFEALTQGASEA------DDGAQALFGL 573

Query: 588  FSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
            F ++I   +    +A+ +  +  R+    T++        L ILG LE+RL+  D +++G
Sbjct: 574  FDRLIAAEAPPGFDALSYASLFDRISFETTLRGPRRAHPRLKILGPLEARLIEADLVLIG 633

Query: 648  GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENN 707
            GL+EGVWP  T    FL+R M+  L+L   E+ IGQ+AHDF MA G + ++ +R+++   
Sbjct: 634  GLDEGVWPPQTDTGAFLNRSMRRQLDLSPPERRIGQSAHDFVMALGAQSVVLSRAVKRGG 693

Query: 708  IPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP 767
             PT+ASR+L RL  L G D F   K RG   L     LD+        RP P PP++ +P
Sbjct: 694  SPTVASRFLTRLEALAG-DAFAGCKARGDRMLAIAAALDHPRDYVTIARPAPRPPIDLRP 752

Query: 768  RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKN 827
               S + +++L  DPYA+YA  +LKL  +     +    +RGT  H  + E + +     
Sbjct: 753  TKLSVTRVERLRRDPYAIYAEYVLKLVPLAPLGAEIGARERGTALHEALAEFVMRHPRGP 812

Query: 828  TP-----EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
             P     +++ + ++ +   F     P      W  +   + H+ L+ E++ +S   +IF
Sbjct: 813  LPPDARAQLHDMARRKLSDFFLD---PAFATFTWPRIAQGLDHA-LDFEQERRSEGCEIF 868

Query: 883  VNIPA--KMAIESIG-IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
            +      ++ +E      LT  ADRI++   G   + DYKTG  P  +       PQL+L
Sbjct: 869  IETRGAWRLPLEDGSTFTLTAVADRIEVDPHGRAYVFDYKTGAPPSVKQVGAGWAPQLTL 928

Query: 940  EAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVT 999
            EAA ++AG+F+ +    V    Y+ LK       + N K +  AD ++   ++ + ++++
Sbjct: 929  EAAMVEAGAFADVGVHPVGGAAYVGLKDGGDTQWL-NWKDRGFADVVATHRVE-VEKMLS 986

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +    P+ S   ++  S +  +YDHLARV EW
Sbjct: 987  QYRASATPYPSRPFVAFVSGV-GDYDHLARVKEW 1019


>gi|170738833|ref|YP_001767488.1| double-strand break repair protein AddB [Methylobacterium sp. 4-46]
 gi|168193107|gb|ACA15054.1| double-strand break repair protein AddB [Methylobacterium sp. 4-46]
          Length = 1040

 Score =  409 bits (1051), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 321/1057 (30%), Positives = 501/1057 (47%), Gaps = 59/1057 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             +FTI P +PF   +  ALL+GTLV      PL    LA+VT+++PT+RA + L +E   
Sbjct: 5    RIFTIPPGAPFLATLADALLDGTLVGPVAQGPLG---LAAVTLFLPTRRATRALAAELAA 61

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSYNL-----NPPVSNIQRLLELARLILIWRN 121
              G  + +LP +  LG+  E +     L          +PP+  ++R L LARL+  W  
Sbjct: 62   RCGP-AVLLPRMTPLGEADEAELDLAALAPGECPEAVAHPPIPALERRLILARLVQAWAA 120

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
             +   +  +  E P  +P SPA+A+ LA +L  ++D +  E   W+++      +Y  ++
Sbjct: 121  GIDRRLLPMGEEVPFRVPSSPADAVGLAADLEGLMDALTVEGLPWDEIGRAVEAEYSQYF 180

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGSIP 240
             L  DF++IA+++W   L E   S PV    AL+ AEA  L +     PI++AGSTGSIP
Sbjct: 181  SLTLDFVRIAAEHWPAILAERGVSDPVARGRALVLAEAARLRRERPADPIVVAGSTGSIP 240

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA L+  +A  P GA+VLPGLD  +    W         I +       HPQ  L +LL
Sbjct: 241  ATAALIGAIAAMPRGAVVLPGLDLALDEEGW-------AAIETGEAVAHGHPQAILHRLL 293

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF---- 356
              LD  R  V+ LG        R+ ++S++  P +T     TD   +  P  ++      
Sbjct: 294  RGLDCPRAAVRPLGAPGPAARARAELLSQALRPAET-----TDAWADLDPGAREALARAG 348

Query: 357  -SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
             + +AL+EA +EREEA++IA+ALR +L+    ++ALIT DR LARRV  EL R+ I  + 
Sbjct: 349  GAGLALVEAADEREEALAIAVALREALERPDCRAALITPDRGLARRVAAELGRWEIVAED 408

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLN-DFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
            +AG PL+ +L +  L  L   +  L+     +  L+ HP+ + G     L RA  ALE+ 
Sbjct: 409  TAGQPLALSL-AGRLARLATDVAALDAKPERVLALLAHPMVRLGLARPALERAAAALEIG 467

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLV---DHILQCI 531
             LRG   +     L   +  R+A      H P    RL++ D E A  LV   D   +  
Sbjct: 468  VLRGPAPAKGFAGLAEAL--RVARGGERPHAPRPVRRLTQADWEAAADLVARLDRAFRDF 525

Query: 532  TPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI 591
             P       +      ++++   + T   L +   D  +  P++        L  LF  +
Sbjct: 526  APRDFAPDQEEGVRDLVALAQAHRETCDLLLD-GPDAPQDEPSV------AVLDGLFDDL 578

Query: 592  -IETGSCIKANAIEWIDIITRLIDGETVKPKIEKS-STLFILGTLESRLLNFDTLILGGL 649
             +     ++    ++    T L     V  + E+    L ILG LE+RLL  D ++LGGL
Sbjct: 579  ALAQAGMLEGRFSDYPAFFTALARERVVSARAERPHPRLRILGLLEARLLRVDRVVLGGL 638

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            +EGVWP     + FL+R M++ + L + E+ +GQ AHD   A G    + TR+ +    P
Sbjct: 639  DEGVWPPKAETDAFLNRPMRAAVGLSSPERRLGQTAHDLVQALGCPDAVITRAHKREGSP 698

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ--P 767
            T+ SR+LQRL    G   +      G         LD  T+    +  +P P  +    P
Sbjct: 699  TVPSRFLQRLRAFMGEAAWSGCLAAGGRLRALAASLDRGTEPLPPRPARPAPRPDPALFP 758

Query: 768  RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKN 827
            R  S +E++ L+ DPY ++AR +L LD +      P  +DRGT+ H+++     +R  + 
Sbjct: 759  RALSVTEVETLVRDPYGIFARHVLGLDPLEPVAVQPSASDRGTIVHDVLGGF-AQRFPEA 817

Query: 828  TPEINH--LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNI 885
             P      L    +++     +  P +   W   F +++ SFL  E + +  + ++   I
Sbjct: 818  LPADPRLPLYDLAVNAFAPIADAYPELYAEWWPRFERMAASFLAWEVERRPGLRRVHAEI 877

Query: 886  PAKMAIESIG----IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEA 941
              +  I  IG      L   ADRI+  + G   I D+KTG  P          PQL+LEA
Sbjct: 878  SGRWRI-PIGPAEDFTLRARADRIEARRDGGHVIVDFKTGQPPSAREVFAGFAPQLTLEA 936

Query: 942  AALKAGSFSQIDCRKVA-NLFYIRLK-QKFKIDCI---TNDKKKYSADELSEKSLKNLIE 996
            A L+AG F  +     A  L Y+R    K  +D +       +  S +EL ++  +    
Sbjct: 937  AMLQAGGFRDLGPGTGAPELLYVRASGGKVPLDPVPLKPPRGEARSVEELIDEHARRFQG 996

Query: 997  IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +V     GE  ++S     + +   S YDHLARV EW
Sbjct: 997  LVARFLRGEAAYLSR-PYPKYARAFSPYDHLARVKEW 1032


>gi|300023816|ref|YP_003756427.1| double-strand break repair protein AddB [Hyphomicrobium denitrificans
            ATCC 51888]
 gi|299525637|gb|ADJ24106.1| double-strand break repair protein AddB [Hyphomicrobium denitrificans
            ATCC 51888]
          Length = 1038

 Score =  409 bits (1051), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 316/1059 (29%), Positives = 501/1059 (47%), Gaps = 56/1059 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
            N+FT+ P  PF + +  A+LNG L       P + L L ++T+ +PT+RA +  R  F+ 
Sbjct: 4    NIFTLPPGVPFLKAVARAILNGDLPAPGGAAP-DLLKLPNITLLLPTRRAARTARDAFLS 62

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLN--------PPVSNIQRLLELARLILI 118
            +    + I+P I+ + +  +++     L    L+        P +  + R L L +LI  
Sbjct: 63   VANTPAIIMPRIRPISEGDDDRSLISSLAGDGLSSASALDQPPAIDPLDRTLVLMQLISH 122

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
            WR  +     D    S      +PA +  LA  L  ++D IE E     D+  L  E Y 
Sbjct: 123  WRATMAQSDADRSSGS------TPAQSARLAAELGKLMDDIERENVSLSDIQNLVPETYA 176

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIII-AGSTG 237
              W    DFLKI +++W   L     +SP   + AL+ AEAE + K     I+I AG TG
Sbjct: 177  EHWQKTVDFLKIVTEFWPAHLEASGMTSPEARRNALILAEAERIAKLAPDEIVIVAGITG 236

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            SIPAT  LM  VA  P+GAIVLP LD  +  A W+ I           + +  HPQ+ L 
Sbjct: 237  SIPATVELMRAVAARPSGAIVLPALDQSLDDASWSAIV----------SGHPEHPQFGLK 286

Query: 298  KLLDFLDIKREDVKRL-----GNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNI 352
            KLLD L+++R  V  L     G+V      RS  +S+S  P  ++D  +          +
Sbjct: 287  KLLDGLNVERGAVLTLPGFEAGDVDRT---RSAFVSESMRPSSSTDQWHRYATTADKGEL 343

Query: 353  QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
            +K  + ++LIEA + ++EA ++A+ LR +++   + +AL++ DR LARRV + L  +GI 
Sbjct: 344  EKALAGISLIEAPSAQDEAETVALILREAIETPGQTAALVSPDRLLARRVAIRLEAWGIR 403

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIAT--LVKHPLAKFGFPEKYLSRAKNA 470
            +D SAG P + T+  + L  ++ A+  +++F    T  L++HPL +  F    + +   A
Sbjct: 404  VDDSAGRPFAKTVPGAFLALVIGAM--VSEFAPAETMALLRHPLCRLKFNAFDIRKYARA 461

Query: 471  LELVALRGNKNSYDIMDLKSLV--LDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
            LE+ A R +   + +  +++ +   +R   +K   H      RL  ED + A  LV  + 
Sbjct: 462  LEISAFRTSYLGHGLDGIRAALETAERDRAEKKRMHPA--ARRLWSEDCDGARELVARLA 519

Query: 529  QCITPLVT-YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN-LWFEEEGKTLSS 586
                PL   Y  N + T    + +                      N LW  E G T S 
Sbjct: 520  AAFQPLADLYAANGDQTLAEFARAHAEAAEALAQLPDDDAAAEASANPLWQGESGDTASR 579

Query: 587  LFSKIIETGS-CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLI 645
             F+K+++  +  +  +A ++ D+   L+  E V+ +      + I G  E+RL   D L+
Sbjct: 580  FFAKLLDDATPAVAISAADYADLYATLLARENVRERTAVHPRISIWGPFEARLQQPDVLV 639

Query: 646  LGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRE 705
            LG LNEG WP+      +L+R M+ DL L + E+ IG+AAHDF    G + +  TR+ + 
Sbjct: 640  LGSLNEGTWPEAAEPGAWLNRPMRRDLGLPSPEEEIGRAAHDFTSLLGAKTIYLTRAEKV 699

Query: 706  NNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLD-YTTKQPHYKRPKPFPPLE 764
            + +PT+ SRWL R+  L      +++    + +L W R  D    K+   K P+P P L 
Sbjct: 700  DGVPTVPSRWLMRMRALLKGMKLESVLVADKPWLAWARARDRIVGKRIAIKPPEPRPALA 759

Query: 765  AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
             +PR  S ++I++ I +PYA YAR ILKL+ +P     PD + RG L H++++       
Sbjct: 760  LRPRRMSVTDIERWIANPYATYARHILKLEPLPPLGASPDASLRGALVHDVLSRFANAFP 819

Query: 825  NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
            ++   +    +++I     +       I   W     +    F E EEK +  +  +   
Sbjct: 820  DRLPDDPLAELEKIAADVLQTYTGNARIAAFWMPRLKRFLSWFAEGEEKRREGVRSVIAE 879

Query: 885  IPAKMAIESI--GIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAA 942
            I   + +        LT  ADRID   S  + ITDYKTG  PK+E  +    PQL LEAA
Sbjct: 880  ISGALVLAPTPDPFTLTARADRIDDTGSAVI-ITDYKTGAIPKQEWVENGRSPQLPLEAA 938

Query: 943  -ALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSAD--ELSEKSLKNLIEIVT 999
             AL    F  +  R V  L YIR       +    ++   S D   L+ ++ + L  ++ 
Sbjct: 939  IALGETGFPNLAGRTVEALRYIRASGG---EPAGEERAIKSNDIGTLAAQARQGLERLIA 995

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
               +   P+ + LR    S     Y  LARVAEW    D
Sbjct: 996  EFDDPATPYRA-LRRPSYSYDYDAYAQLARVAEWSAHVD 1033


>gi|115522489|ref|YP_779400.1| hypothetical protein RPE_0461 [Rhodopseudomonas palustris BisA53]
 gi|115516436|gb|ABJ04420.1| DNA helicase/exodeoxyribonuclease V, subunit B [Rhodopseudomonas
            palustris BisA53]
          Length = 1049

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 326/1058 (30%), Positives = 507/1058 (47%), Gaps = 50/1058 (4%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VFTI PS+PF R +I AL++G LV  F      P  LA+ T+Y+PT+RA +  R  F++
Sbjct: 2    RVFTIPPSAPFLRRLITALVDGELVPGFEAR-TQPERLATATLYLPTRRAGRMAREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKFT----ADLL---LSYNLNPPVSNIQRLLELARLILIW 119
            +  + + ILP I +LGD+ E++      AD L    + ++ P +  ++R L LA+L+ +W
Sbjct: 61   VLQRDAAILPRIVALGDIDEDELAFAQEADPLGGAAALDVPPALGELERRLTLAQLVAVW 120

Query: 120  RNKLPDIIKDLYPESPLSLPI---SPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEK 176
                    K L P  P + P+    PA+ I LA +LA +ID + T    W+ L  L  + 
Sbjct: 121  -------AKQLKPGDPAAAPLVVGGPASTIALATDLARLIDDMATRGVDWKQLDGLVPDA 173

Query: 177  YGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGST 236
               +W L+ DFLKIA ++W   L E     P   +  L+ AEA+ L     GP+I AGST
Sbjct: 174  LDRYWQLSLDFLKIARQWWPAFLQERGRIEPALRRDQLIDAEAKRLAAHPTGPVIAAGST 233

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT-EKSTNITSSNTTYSTHPQYS 295
            GS+PATAR ++ +A  P GA+VLPGLD  +  A W  I   + +   +     S HPQ++
Sbjct: 234  GSMPATARFLAAIARLPQGAVVLPGLDSDLDDAAWALIGGHQDSQGQTLAPPSSNHPQFA 293

Query: 296  LAKLL-DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKI-PNIQ 353
            L  LL D L I+R DV  LG  S    GR ++ S++  P   +   +  + E  +   I 
Sbjct: 294  LHALLRDHLKIERRDVVPLGEPSP--TGRELLASEALRPSTATARWHQRLQEPAVEARIA 351

Query: 354  KCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINI 413
                 +++I ADN   EA+SIA+ALR + D   + +AL+T DR LARRV   L R+ +  
Sbjct: 352  AGMQTLSVIAADNSEMEALSIAVALREA-DALGRTAALVTPDRALARRVMAALGRWNLPF 410

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D S G  L  T           A     +   +  L+KHPL + G  +    RA   LEL
Sbjct: 411  DDSGGDALVDTPVGIFARLAAEAATTGLEPATLLALLKHPLLRLGAAQGTWQRAIETLEL 470

Query: 474  VALRGNK----NSYDIMDLKSLVLDRIATQKNNTHVPHW---QSRLSEEDKELAVLLVDH 526
              LRG +    +S    +     ++    ++    + H    +++L +   + A LL+  
Sbjct: 471  AVLRGTRPPAMSSGLAQEFSRFRVELAKLRRGEPSLLHRAEPRAQLRDAALDQAELLITR 530

Query: 527  ILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSS 586
            +   + PL T +  +        ++++ +     L  +  D    +  L    +G  L+ 
Sbjct: 531  LAAALAPLETLQAAQQ-----FDLAEFARRHCEVLIALSSDADGLVAAL-DGPQGSVLAG 584

Query: 587  LFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLIL 646
             F ++  + S + A   ++ +    L     V+      + L I G LE+RL + D LIL
Sbjct: 585  AFDEMPAS-SGVTALPRDYPEAFAALFADRIVRRPEAVGARLRIYGPLEARLTHCDRLIL 643

Query: 647  GGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLREN 706
            GGL EG+WP     +P+LSR M+  L L   E+ IG +AHDF    G   +I T + +  
Sbjct: 644  GGLVEGIWPPAPRIDPWLSRPMRHQLGLDLPERRIGLSAHDFAQLLGHDEVILTYAAKVG 703

Query: 707  NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ 766
              P +ASR+L RL  + G   + +   RGQ YLD+   LD   K     +P P PP  A+
Sbjct: 704  GSPAVASRFLHRLEAVAGETRWKDAVARGQTYLDYAHALDRPDKIEPIAQPAPRPPRAAR 763

Query: 767  PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK 826
            PR  S + I+  + DPY +YA+ ILKL  +          DRG+  H  I E  +     
Sbjct: 764  PRKLSVTAIEDWLRDPYTIYAKHILKLIPLDPVDMPLSAADRGSAIHAAIGEFTETYATS 823

Query: 827  NTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIP 886
               +   L++ I   HF      P    +W   F +I+  F   E + + ++  +     
Sbjct: 824  LPQDSAALLRAIGRRHFAPLMQRPEAAALWWPRFLRIADWFANWETERRLNVSSVITEQS 883

Query: 887  AKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
              + I         L+  ADRI+        + DYKTG+ P  +  +  + PQL+LEAA 
Sbjct: 884  GSLTIALDHDREFVLSARADRIERRTDRTFALLDYKTGNPPSAKQVRMGLSPQLTLEAAI 943

Query: 944  LKAGSFSQIDC-RKVANLFYIRLKQKFKI--DCITNDKKK-----YSADELSEKSLKNLI 995
            L+AG F+ I     V+ L Y++L        +C+   K+       S D+ + ++   L 
Sbjct: 944  LRAGGFADIPAGASVSELVYVKLSGNNPPGNECVLELKRDRSEPVQSPDDAASEARAKLE 1003

Query: 996  EIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            E++   ++   P+ S L L+  SN    YD LAR+ EW
Sbjct: 1004 ELIRKFEDEATPYTS-LDLAMWSNRYGSYDDLARIKEW 1040


>gi|163797152|ref|ZP_02191107.1| Inactivated superfamily I helicase [alpha proteobacterium BAL199]
 gi|159177668|gb|EDP62221.1| Inactivated superfamily I helicase [alpha proteobacterium BAL199]
          Length = 1005

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 296/1010 (29%), Positives = 465/1010 (46%), Gaps = 57/1010 (5%)

Query: 40   NPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFT------ADL 93
            +PL LA  T+ +PT+RA++     F+ +   +  +LP ++++ DV E++        A +
Sbjct: 30   DPLALARATVLLPTQRAVRSAAEAFLRLGDGRPMLLPTLQAIADVDEQELDLAHGDDAGV 89

Query: 94   LLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLA 153
              + +L P +  ++R L LARL+L + ++L            ++ P SP  A+ LA  LA
Sbjct: 90   AAALDLPPAIPALRRQLLLARLVLAYADRLE--------ADGVAAPRSPEQAVRLAAALA 141

Query: 154  DIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIA 213
             +ID ++ E   +E L  L   +Y   W L   FL I ++ W + L E  A  PV  + A
Sbjct: 142  GLIDQVQAEGLAFEALTGLVPSEYAEHWGLTLRFLTIVTELWPKWLEEQGAVDPVVRRDA 201

Query: 214  LMRAEAEHLMKGTKG-PIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWN 272
            LMRA A          P+IIAGSTGS+PATA LM+ V   P G +VLPGLD     ++W 
Sbjct: 202  LMRARATAWQAAPPSDPVIIAGSTGSVPATAGLMTAVLGLPQGTLVLPGLDQDSDDSVWA 261

Query: 273  TITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSN---EMYGRSMVISK 329
            ++            T + HPQ+ L +LL  L I R DV      +        R+ ++ +
Sbjct: 262  SVG-----------TDAAHPQHGLHRLLVGLGIPRGDVGLWPGAATFVPATAARARMLRE 310

Query: 330  SFLPPDTSD---MRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENK 386
            +  P  T++   M  T   E   P     F  +  +EA + REEA +IA+ +R  L+   
Sbjct: 311  AMRPAATTEAWRMLATRPSEPDAPAT-GAFDGIRRLEAPSPREEAGAIAMLMREVLETPG 369

Query: 387  KKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAI 446
            + +AL+T DR+LARRV  EL R+ + +D SAG PL+ +  ++ L  + +   +    + +
Sbjct: 370  RTAALVTPDRSLARRVASELERWDLTVDDSAGRPLAESAPAAFLRLIGDLAAEQAAPVPL 429

Query: 447  ATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVP 506
               +KHPLA  G       R    LE + LRG + +     L+     R      + H  
Sbjct: 430  LAALKHPLAAGGQAPDAFRRMVRRLERLVLRGPRPAPGFTGLR-----RAVEVLEDKHA- 483

Query: 507  HWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL 566
                    E +   ++ VD +   + PL+    N+ +           +      Q+   
Sbjct: 484  --------EARAGLLVWVDGLAGRLGPLLD-TLNRPAVAATEMADAHARAAEALAQS--- 531

Query: 567  DEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK-ANAIEWIDIITRLIDGETVKPKIEKS 625
            D+      LW  + G+ L+ LF ++ +    ++      W  +   L++   V+P+    
Sbjct: 532  DQQSGADRLWRGDAGEALARLFDEMRDALDALEPVPGRAWPGLFEALLESRVVRPRWGAH 591

Query: 626  STLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAA 685
              L ILG LE+RL  FD +ILGGLNEG WP + A +P++SR M+ D  L   E+ IG AA
Sbjct: 592  PRLHILGALEARLQRFDRVILGGLNEGTWPADPAPDPWMSRPMRRDFGLPAPERRIGLAA 651

Query: 686  HDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKL 745
            HD  MA G   ++ TR+ R    PT+ SRWL RL  +      +   +     + W  +L
Sbjct: 652  HDVSMAFGAPEVVLTRATRVEGTPTVPSRWLLRLETVARALGAEAEFRSDPAPVAWHGQL 711

Query: 746  DYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDR 805
            D        K P P PP+  +PRT S + I   + DPY++YA RIL L  +     DP+ 
Sbjct: 712  DRPASVEPGKAPLPCPPVHVRPRTLSVTRIDTWLRDPYSIYASRILDLRALDDLDSDPNA 771

Query: 806  TDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISH 865
             +RG   HN +   +        P+    + +   + F      P +   W   F +++ 
Sbjct: 772  AERGNAIHNALDAFVAAYPRDLPPDPLQRLLEYGQASFADHLDRPGVWAFWWPRFERVAA 831

Query: 866  SFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDN 923
             F+E E   +  +         ++A+        LTG ADRID +  G   I DYKTG  
Sbjct: 832  WFVEVERDRRRGLSATVTEQKGRLAVPGPAGDFTLTGIADRIDRMGDGTYAIVDYKTGGY 891

Query: 924  PKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSA 983
            P K   +    PQL LEA  L  G F  +    V++L Y R+        I  D  +   
Sbjct: 892  PSKNDLKNGAAPQLPLEALILAGGGFPDLPVAPVSSLAYWRVGGGDPPGAI--DAVESGV 949

Query: 984  DELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             EL  ++   L  ++    + + P+ S      K    ++Y HLAR+ EW
Sbjct: 950  AELVAEAEAGLRTLIATFDDEQTPYHSVPDAGRKPRF-NDYAHLARIGEW 998


>gi|209883636|ref|YP_002287493.1| double-strand break repair protein AddB [Oligotropha carboxidovorans
            OM5]
 gi|209871832|gb|ACI91628.1| double-strand break repair protein AddB [Oligotropha carboxidovorans
            OM5]
          Length = 1066

 Score =  399 bits (1026), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 324/1065 (30%), Positives = 509/1065 (47%), Gaps = 58/1065 (5%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             +F I  S+PF R ++ AL +G L+E F     NP  LA  T+Y+PT+RA +  R  F++
Sbjct: 11   RLFNIPSSAPFLRTLLTALADGRLIEGFEARK-NPERLAEATLYLPTQRACRMAREVFLD 69

Query: 67   ITGKKSTILPIIKSLGDVVEEKFT-----ADLLLSYNLNPPVSNIQRLLELARLILIWRN 121
            +  + + +LP I +LG V E++       A    S N+   +  + R L L RL+  W  
Sbjct: 70   VMEQDAVLLPRIVALGHVDEDELAFAQDEATEFPSLNVPDALDGLPRRLVLMRLVSAWAK 129

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            +L    ++L   +PL +   PA+ + LA +LA +ID + T    W  L+ L  +    +W
Sbjct: 130  RLGS--RELA-SAPL-VAGGPASTLALADDLARLIDDMTTRGVDWHALNTLVPDDLDQYW 185

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPA 241
             +  DFLKIAS+ W   L E     PV  +  L+ AEA  +     GP I AGSTGS+P+
Sbjct: 186  KITLDFLKIASEAWPAHLRESELIEPVARRDLLIAAEAARMAA-APGPFIAAGSTGSMPS 244

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITE-KSTNITSSNTTYSTHPQYSLAKLL 300
            TA+ +  VA HP GA+VLPGLD  +    W  I   + +    +    S+HPQY+L  LL
Sbjct: 245  TAKFLHAVAQHPQGAVVLPGLDTDLDDEAWRAIGGVRDSTGRFAEHPLSSHPQYALHGLL 304

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPP-DTSDMRNTDILENKIPNIQKCFSDV 359
            D   + R+ V+ L   S   +GR ++ S++  P  +T+   +     +    I+  F ++
Sbjct: 305  DVFGVDRKAVRALAEPS--AHGRELIASEAMRPARETAQWHHRLADPDVTTRIEAGFDNL 362

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
            A++EA N   EA++IA A+R +  +  K +AL+T DR LARRV   L R+ +  D S G 
Sbjct: 363  AIVEAANPEMEALAIATAMREA-RQFGKTTALVTPDRALARRVMAALGRWQLPYDDSGGD 421

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
             L  T            +        +  L+KHPL + G P    ++A   LEL  LRG 
Sbjct: 422  SLMDTPAGIFARLAAETVTSELAPPTLLALLKHPLLRLGAPAGGWTKATANLELAVLRGT 481

Query: 480  KNSYDIMDLKS----LVLDRIATQK---NNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532
            + +     L++     V +   TQ+   +  H    ++RL+ +D E A   +D ++  + 
Sbjct: 482  RPAPGCKGLQAAFAAFVEEWSKTQRKELSTLHPSEPRARLTPDDIESATRALDALVSALA 541

Query: 533  PL--VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
            PL  V   T+  +T            T+T L      ++  L   +   +G+ L+S F++
Sbjct: 542  PLESVVRGTHDFATLAQRHYE-----TITHLSR----DNDGLIAAFAGTDGQQLASAFNE 592

Query: 591  I-------IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDT 643
            +       +   + I   A ++ D+         V+      + L I G LE+RL   D 
Sbjct: 593  LAPPNENDVPAPTHIALEAADYPDLFATAFANRVVRRPENSDAALRIYGLLEARLTQCDR 652

Query: 644  LILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSL 703
            +ILGGL EGVWP     +P+LSR M+ +L L   E+ IG  AHDF    G + +I T + 
Sbjct: 653  VILGGLVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLTAHDFAQLLGAKEVIITHAT 712

Query: 704  RENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPL 763
            +    P +ASR+L R+  + GT  +   +KRG  Y+ +   LD         +P P PP+
Sbjct: 713  KVGGAPAVASRFLHRMKAIAGTKAWTEAEKRGADYVRYAEALDAPDSITPVAQPAPTPPV 772

Query: 764  EAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKR 823
              +P   S +EI+  + DPY ++A+RILKL  +          DRG+  HN + +  +K 
Sbjct: 773  ALRPLQMSVTEIEDWLRDPYTIFAKRILKLTLLDPVDLPLTAADRGSAIHNALGDFTQKH 832

Query: 824  INKNTPE-INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
             +K  PE I   ++   + HF      P    +W   F +I+  F   E + ++   +I 
Sbjct: 833  -SKTLPEDIVAELRFCGEEHFAALMAHPEARALWWPRFLRIADWFAGWELRRRAETVEIA 891

Query: 883  VNIPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
                 ++AI   +     L+  ADRI+L       I DYKTG  P  +  Q  + PQL+L
Sbjct: 892  AEQRGEIAIPLGDGREFRLSARADRIELRADRTFAIIDYKTGQPPSNKQVQLGLSPQLTL 951

Query: 940  EAAALKAGSFSQIDCRKVAN-----LFYIRLKQKFKI--DCITNDKKKYSADEL----SE 988
            EAA L+ G F        AN     L Y+RL        + I N   K    +L    ++
Sbjct: 952  EAAILRGGGFRHAFASLPANPSVSELVYVRLSGNNPAGKEQIVNLTPKGGDVQLPDDAAD 1011

Query: 989  KSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             +L  L  ++    + +Q + S L L+  S+    YD LAR+ EW
Sbjct: 1012 AALAKLTALIRKFDDPKQAYNS-LALAMWSDRYGVYDDLARIKEW 1055


>gi|299133348|ref|ZP_07026543.1| double-strand break repair protein AddB [Afipia sp. 1NLS2]
 gi|298593485|gb|EFI53685.1| double-strand break repair protein AddB [Afipia sp. 1NLS2]
          Length = 1055

 Score =  395 bits (1016), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 320/1071 (29%), Positives = 509/1071 (47%), Gaps = 72/1071 (6%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             V  I  S+PF R ++ AL++G L++ FR     P  LA  T+Y+PT+RA +  R  F++
Sbjct: 2    RVSNIPSSAPFLRTLLSALVDGRLIDGFRARE-APERLAQATLYLPTQRACRMAREIFLD 60

Query: 67   ITGKKSTILPIIKSLGDVVEEKF---TADLLLSYNLNPP--VSNIQRLLELARLILIWRN 121
            + G+ + +LP I +LG V E++      + +  ++L  P  +  + R L L RL+  W  
Sbjct: 61   VMGQDAVLLPRIVALGHVDEDELDFARGEAVEFFSLAVPEALDGLPRRLVLMRLVDAWAK 120

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            +L    ++L   +PL +   PA+ + LA +LA +ID + T    W  L  L  +    +W
Sbjct: 121  RLGS--RELA-AAPL-VAGGPASTLALADDLARLIDDMTTRGVDWSALDNLVPDDLDRYW 176

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPA 241
             L  DFLKIA   W   L E N   P   +  L+  EA  +     GP I AGSTGS+P+
Sbjct: 177  QLTLDFLKIAKDAWPAYLGEQNLIEPARRRDLLIETEAARIAT-LPGPFIAAGSTGSMPS 235

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITE-KSTNITSSNTTYSTHPQYSLAKLL 300
            TA+ +  +A HP GA+VLPGLD  + +  W  I   + +    +    S+HPQY+L  LL
Sbjct: 236  TAKFLHAIAKHPQGAVVLPGLDIDLDSESWRAIGGIRDSEGRFTEHPLSSHPQYALHGLL 295

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIP-NIQKCFSDV 359
            + L ++R DV  L   ++  +GR ++ S++  P   +   +  + E  +   I   F  +
Sbjct: 296  ELLGLERRDVIPLAEPAS--HGRELLASEAMRPAAETAQWHDRLAEQDVAARIASGFETL 353

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
             +IEA N   EA++IA+A+R +  +NK  +AL+T DR LARRV   L R+ +  D S G 
Sbjct: 354  TVIEAANPEMEALAIAVAMREARQKNKT-AALVTPDRALARRVMAALGRWKLAFDDSGGD 412

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHP---------LAKFGFPEKYLSRAKNA 470
             L  T            IF       I T +  P         L + G  E   ++  + 
Sbjct: 413  SLMDTP---------AGIFARIAAETITTGLSPPTLLALLKHPLLRLGQAEGAWTKTVHD 463

Query: 471  LELVALRGNKNSYDIMDLKSLV---LDRIATQKNNTHVPHWQS----RLSEEDKELAVLL 523
            LEL  LRG + +     L++     +D     +   H    +S    RL++ D +    L
Sbjct: 464  LELAVLRGTRPAPGCEGLQAAFAWFVDEWGKARRKEHSALHRSEPRCRLTQGDIDGIARL 523

Query: 524  VDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT 583
            +  + + +TPL      +N   G   ++   +L    L  +   +  ++  ++   +G+ 
Sbjct: 524  LVALTEALTPL------ENIARGAHDLATLAQLHRETLIRLSTSDDGRI-AVFGGHDGQQ 576

Query: 584  LSSLFSKII-----ETGSCIKANAIEWID----IITRLIDGETVKPKIEKSSTLFILGTL 634
            L+  F +++      T       A+E  D      T    G   +P+ E +S L I G L
Sbjct: 577  LAQAFDELLLPSGDATSPAQTHIALEIADYPDLFATAFASGMVRRPQNEDAS-LRIYGLL 635

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            E+RL   D +ILGGL EGVWP     +P+LSR M+ DL L   E+ IG  AHDF    G 
Sbjct: 636  EARLTQCDRVILGGLVEGVWPPAPRIDPWLSRPMRHDLGLDLPERRIGLTAHDFAQLLGA 695

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHY 754
              +I T + +    P++ASR+L R+  +   + +D   +RG  Y+ +   LD+       
Sbjct: 696  EDVILTHAAKAGGAPSVASRFLHRMKAIAKPEAWDAALERGARYIRYAEALDHPDSIQPI 755

Query: 755  KRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHN 814
             +P P PP+  +P   S +EI+  + DPY ++A+RILKL  +          DRG+  HN
Sbjct: 756  AQPAPKPPVTLRPLQMSVTEIEDWLRDPYTIFAKRILKLTPLDPIDLPLTAADRGSAIHN 815

Query: 815  IITELIKKRINKNTP-EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEK 873
             + +  +   +KN P  I   ++   + HF      P    +W   F +I+  F   E K
Sbjct: 816  ALGDFTEAH-SKNLPGNIAAELRSFGERHFAALMEHPEARALWWPRFLRIAEWFAGWEIK 874

Query: 874  IQSSIEKIFVNIPAKMAIESIGIH---LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQ 930
             +  I +I   +  ++ I         L+  ADRI+        I DYKTG  P  +  +
Sbjct: 875  RREDITEIAAELRGEIPIPLANGRRFILSARADRIEYRSDRTFAIVDYKTGTPPSGKQVR 934

Query: 931  KLIDPQLSLEAAALKAGSFSQIDCR-KVANLFYIRL-------KQKFKIDCITNDKKKYS 982
              + PQL+LEAA L+ G F     R  V+ L Y+RL       ++K     I    +   
Sbjct: 935  LGLAPQLTLEAAILRGGGFKPFPARASVSELVYVRLNGNNPAGEEKIVDLRIARGNEPQL 994

Query: 983  ADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             D+ ++++L  L  ++   +N EQ + S L L+  SN    YD LAR+ EW
Sbjct: 995  PDDAADEALAKLTALIKKFENPEQAYTS-LDLAMWSNRYGTYDDLARIKEW 1044


>gi|218516573|ref|ZP_03513413.1| hypothetical protein Retl8_24496 [Rhizobium etli 8C-3]
          Length = 507

 Score =  386 bits (991), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 222/509 (43%), Positives = 307/509 (60%), Gaps = 17/509 (3%)

Query: 96  SYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADI 155
           + +L  P+SN  R LELARLIL WRNKLP+I++ ++ +SPL  P SPA+AIWLA+NLA++
Sbjct: 3   TIDLAQPLSNTARQLELARLILAWRNKLPEIVRHIHSDSPLVAPASPADAIWLARNLAEL 62

Query: 156 IDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM 215
           ID IETE+  W +L  L    Y  WW L A+FL+IAS +W  RL EL  SSP  ++ A++
Sbjct: 63  IDSIETEDLDWSELSKLDTGDYAAWWQLTAEFLQIASAFWPARLAELGKSSPARHRNAIL 122

Query: 216 RAEAEHLMKGTK--GPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNT 273
           RAEA  L   TK  GPIIIAGSTGS+PATA L+S VAN   G IVLPGLD  +P   W  
Sbjct: 123 RAEAARL-SATKPGGPIIIAGSTGSVPATADLISAVANLREGVIVLPGLDLAMPEEHWQM 181

Query: 274 ITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLP 333
           +  +      +N    +HPQY L+ LL  L + R DV  L     ++  R+ ++S++  P
Sbjct: 182 VAPEPVPGQHANPASRSHPQYGLSSLLKRLRLTRADVSTLDRPDADLDRRAEILSRALAP 241

Query: 334 PD-TSDMRNTDILENKIPN--IQKCFSDVALIEADNEREEAISIAIALRMSLD----ENK 386
            + TSD     I ++++P   +   F+DV+LIEA NEREEA +IA+ALR++L+    + +
Sbjct: 242 AEATSDW---GIWKSELPGGALTSAFNDVSLIEAANEREEATAIAVALRLALERPGQDGE 298

Query: 387 KKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAI 446
            ++ALIT DRNLARRV  EL+RFGI  D SAG PLS T   S+L  LL A  +  D +AI
Sbjct: 299 SRAALITPDRNLARRVMAELSRFGILADDSAGTPLSATPQGSLLQLLLEASLRPGDPVAI 358

Query: 447 ATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVP 506
            +L+KHPLA+FG     L+ A  ALEL+ALRG     DI  L+ L+  ++A Q  + H P
Sbjct: 359 VSLLKHPLARFGLERNALTFATEALELLALRGGVAEVDIGALEPLLTHQLAEQALDRHAP 418

Query: 507 HWQSRLSEEDKELAVLLVDHILQCITP----LVTYKTNKNSTCGNLSISDWTKLTVTCLQ 562
            W+  L  E  + A  L   + +   P    LV ++        + ++S+W + T   L+
Sbjct: 419 QWRKALPTEAADAAFELAGRVSRATEPLAAALVRHRPEDRGKTASFTLSEWAQRTGRALE 478

Query: 563 NVCLDEHRKLPNLWFEEEGKTLSSLFSKI 591
            V  D    L +LW  E G  L+SL  ++
Sbjct: 479 AVAADPQGNLADLWSNEAGDALASLLGEV 507


>gi|23015052|ref|ZP_00054841.1| COG3893: Inactivated superfamily I helicase [Magnetospirillum
            magnetotacticum MS-1]
          Length = 975

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 314/1051 (29%), Positives = 471/1051 (44%), Gaps = 105/1051 (9%)

Query: 8    VFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEI 67
            VFTI P + F   +   LL     E       +PL LA + I +PT+RA + +   F+ +
Sbjct: 7    VFTIVPGAAFVDTLAAHLL--AEAEG------DPLALADMEILLPTRRACRAMSDAFLRL 58

Query: 68   TGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDII 127
            +G +  +LP ++ LGD+ EE+         ++ P V+  +R+L LARLIL         +
Sbjct: 59   SGGRPLLLPRLRPLGDMDEEELDLAGADPLDIAPAVTPTERVLILARLILTAAQAQGGHV 118

Query: 128  KDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADF 187
                         SP  A+ LA  LA ++D ++ E   + DL  L  E+Y   W +   F
Sbjct: 119  P------------SPDQAVRLASELAKLLDAVQVERLDFADLAKLVPEEYAEHWQVTLKF 166

Query: 188  LKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGSIPATARLM 246
            L I ++ W   L E     P      +M A+ E    +  +  II AGSTGS PATA L+
Sbjct: 167  LAILTEAWPGILAERGVLDPEDRLNRVMAAQIEAWRARPPRHKIIAAGSTGSRPATADLL 226

Query: 247  STVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIK 306
            + VA  P+G +VL GLD             K+ +  S       HPQY L  LLD L ++
Sbjct: 227  AAVAGLPSGRVVLAGLD-------------KAMDEESWAVLDPAHPQYGLKALLDRLGVE 273

Query: 307  REDVKRLGNVSNEMYGRSMVISKSFLPPDTSDM-RNTDILENKIPNIQKCFSDVALIEAD 365
            R  V+ L N  +    R  +++++  P  T +  R+   L+ ++         V  ++A 
Sbjct: 274  RHRVRPLTNDVDLRQDRVRLLAEALRPAATCEAWRDLPTLDPRV------LDGVWRLDAP 327

Query: 366  NEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTL 425
              REEA +IA+ +R  LD     +AL+T DR LARRV  EL R+GI ID SAG  L  + 
Sbjct: 328  TPREEAGAIALMMRRELDRTGHTAALVTPDRGLARRVAGELERWGIRIDDSAGRSLGLSE 387

Query: 426  HSSILTSLLNAIFKLNDFM--AIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSY 483
              + L   L A     DF   A+   +KHPLA  G            LE +ALRG + + 
Sbjct: 388  PGAFLR--LVAEMVAEDFAPHAVLACLKHPLAAGGLETGAFRALVRRLERLALRGPRPAP 445

Query: 484  DIMDLKSLVLD-RIATQKNN--THVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTN 540
             +  L+  V D R+A    +  T    W   L  E+  LA LL  H              
Sbjct: 446  GVAGLRQGVKDSRLAGWLADLETMAAPWPIGLKAEEGTLADLLRAH-------------- 491

Query: 541  KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLP-NLWFEEEGKTLSSLFSKI-------- 591
                   +  ++W          +  D+    P  LW  E G+T +   + +        
Sbjct: 492  -------MEFAEW----------LATDDQLPGPARLWRGEAGETAARFAADLAAAAPALG 534

Query: 592  IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
            +  G C  A       +   L+ G  V+   +    LFI G LE+RL + D LILGGLNE
Sbjct: 535  VMAGRCYPA-------LFDELMAGVAVRSAWDHHPRLFIWGPLEARLQHADLLILGGLNE 587

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTI 711
            G WP     +P++SR MQ+   L   E+ IG AAHDF        ++ TRS R +  PT+
Sbjct: 588  GTWPAPPEADPWMSRPMQAAFGLAPPERRIGLAAHDFAQGFAAPRVVLTRSSRVDGTPTV 647

Query: 712  ASRWLQRL-LVLGGTDF-FDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             SRWL RL  V+ G+   FD    +   +L+W   LD   +    + P P PP+ A+PR 
Sbjct: 648  PSRWLMRLDAVMKGSGLAFDQDAAQ---WLEWHALLDRPDRWKRPEIPAPAPPVSARPRR 704

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
             S +EI+  + DPYA+YA+ +L+L  +     DP   + G++ H  +   +K        
Sbjct: 705  LSVTEIETWMRDPYAIYAKHVLRLKALKPIDADPGAAEYGSMVHEALELFLKAWPAHLPS 764

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +    + +I    FE +   P +   W   F  ++      E   + ++ ++       +
Sbjct: 765  DPQGELLRIGREVFEAKVTSPALWAFWWPRFESVARWVAAKEMGRRHAVRRVHAEAGGAL 824

Query: 890  AIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
             IE+      LT  ADRID  + G + + DYKTG  PK         PQL LEA   + G
Sbjct: 825  EIEAPAGPFTLTAKADRIDEGQDGTLALIDYKTGTPPKAREVAAGFAPQLPLEAVIARHG 884

Query: 948  SFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
             F  +    V+ L Y  LK     D     +    A  L+ ++L+ L  +V++  +   P
Sbjct: 885  GFGGVKAAPVSELLYWHLKG--GADGGFEREAGGDATTLAAEALEGLHALVSVFDDPATP 942

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            + +     E +   S+Y HLARV EW    D
Sbjct: 943  YAARPH-PEHAPKYSDYLHLARVREWASGGD 972


>gi|182679137|ref|YP_001833283.1| double-strand break repair protein AddB [Beijerinckia indica subsp.
            indica ATCC 9039]
 gi|182635020|gb|ACB95794.1| double-strand break repair protein AddB [Beijerinckia indica subsp.
            indica ATCC 9039]
          Length = 1076

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 309/1101 (28%), Positives = 507/1101 (46%), Gaps = 108/1101 (9%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF-- 64
             VFTIAP SPF +  + AL +G +++ F     +P  LA  TIYVPT+RA + L  E   
Sbjct: 5    KVFTIAPGSPFLKTFVTALKDGKIIDGFTI--ADPFALAKTTIYVPTRRAARALADELAN 62

Query: 65   ---IEITGKKSTI-----LPIIKSLGDVVEEKFTADLLLSYNLNPP-------------V 103
                   G  + +     LP IK  G + EE  T+ L     L+ P              
Sbjct: 63   SLIFSSPGSGAAVPSAMLLPRIKPFGGI-EETETSLLFDRATLDDPSSEDSLLEDLPLAA 121

Query: 104  SNIQRLLELARLILIWRNKLPDIIKDLYPESPL--------SLPISPANAIWLAKNLADI 155
            S I R ++L  LIL W   L   I  + P+  +        S+  S  +A  L+  LA +
Sbjct: 122  SEIGRRMQLTELILKWAEALNHAIVRIGPDGTIESDTTERFSVARSVTDAWHLSGQLAQL 181

Query: 156  IDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM 215
            ID +  E+  W  L  L   ++  +W +  +FL IA + W E   E         ++ L+
Sbjct: 182  IDELIIEDITWSQLDPLVLPEFDAYWRITMNFLNIAIESWPEICSEQGWIDAAKRRVLLL 241

Query: 216  RAEAEHLMKGT-KGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTI 274
              EA  L +GT +GP+I  GS G    T+ L++++A  P GA++LPGLD  +  A +  I
Sbjct: 242  AREARKLDEGTAEGPVIALGSPGFNRTTSALLASIARAPQGAVILPGLDQDLDEAAFKMI 301

Query: 275  TEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPP 334
              +S            HPQ    +LL  L + R+DV  LG +S  +  R   +S++  P 
Sbjct: 302  DHESFG----------HPQAVYVRLLPILGVTRQDVMPLGEMSPMLIRRHGFLSEALRPA 351

Query: 335  DTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITA 394
            DT+D   T  + N   ++    S + +IEA +ER+EA+++AIALR  L+   K +AL+T 
Sbjct: 352  DTTDEWITYQVRNVSTDLADALSGITMIEAQDERQEALALAIALREILETPGKTAALVTP 411

Query: 395  DRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPL 454
            DR LARRV+ EL R+ I ID S G PL+T+    +    L  I    D   +A L+ +  
Sbjct: 412  DRELARRVRTELLRWNIEIDDSGGDPLNTSPRGLLARLALACITSGMDAKDLAALLANEQ 471

Query: 455  AKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSE 514
               G     +       E+  LR +       D   + L        +T+    ++R+  
Sbjct: 472  VSLGLGRDRIKALAPQFEIAILR-SAPVMRFFDQPDIALTMARDAAFDTYAHPAKARIEA 530

Query: 515  EDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVC------LDE 568
            ED +    +++ +   ++PL   +       G   ++ W       L  +         +
Sbjct: 531  EDWDGLAQILERLRDVLSPLRALR-------GTWPLARWIAAHRMVLDGLVRDADQTDGQ 583

Query: 569  HRKLPNLWFEEEGKTLSSLFSKIIETGSC-----IKANAIEWIDII--TRLIDGETVKPK 621
             ++   L   E+   L +LF ++  T        + + A  + DI    RL       P+
Sbjct: 584  DQQDRTLEAGEDAAALEALFDELSGTTPQGLLFDVASYAAFFTDISGEVRLRGPRRAHPR 643

Query: 622  IEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYI 681
            ++      ILG +E+RL+  D ++LGGL+E +WP     + FL+R M++ L L   E+ +
Sbjct: 644  LK------ILGLIEARLMQADVMLLGGLDETIWPPAAQMDAFLNRPMRAALGLTPPERRL 697

Query: 682  GQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDW 741
            GQA HDF  A G   +I +R+ +    PT+ASR +QR+  L G D + +  ++G+ +L +
Sbjct: 698  GQATHDFTQAMGAESVILSRAKKRGGTPTVASRLIQRMAALAG-DVWQSCLEQGERFLAF 756

Query: 742  TRKLDYTTKQPH-------YKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLD 794
               LD T   P          RP P PP+  +P   S ++I+ L  DPYA++A +IL L 
Sbjct: 757  AEALDRTPINPADHRPQRPLGRPNPKPPVGLRPTHLSVTQIETLRRDPYAIFAEKILGLK 816

Query: 795  FIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHID- 853
             +       DR D G   H ++    K  ++   P    + +Q++   + +E L   +D 
Sbjct: 817  ALDALGAGADRRDDGMAVHAVLERCGK--LHPTGPLPADMDEQLL--SWLREALAARLDD 872

Query: 854  -----IIWRHLFHKISHSFLEHEEKIQSSIEKI----FVNIPAKMAIESIGIHLTGFADR 904
                   W  L  K    +L  E + + ++ +I    F  +P  +A  S  + LT  ADR
Sbjct: 873  PDFSAFQWPRL-QKAIDVYLAFEAERRDNLVRIEVETFGRLPIDLADGSRFL-LTARADR 930

Query: 905  IDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIR 964
            ++  +   + + DYKTG  P  +  +  + PQL+LEAA  K G+F      +     Y++
Sbjct: 931  LEFHRDQSLVLVDYKTGAPPSSKEIRTGLAPQLTLEAAMAKRGAFGSDAIAQAYGGLYLK 990

Query: 965  LKQ---------KFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLS 1015
            L           +F      N  +  + D+++E+  + L+ ++   ++    + S  RL+
Sbjct: 991  LGGADGGQVRPVEFSSGRGKNKDQSIAFDDVAEQHFQGLLILLNQFRDPATGYPS--RLA 1048

Query: 1016 EK-SNIQSEYDHLARVAEWRE 1035
             K +++   YDHLARV EW +
Sbjct: 1049 PKFAHVPLPYDHLARVNEWAQ 1069


>gi|295687599|ref|YP_003591292.1| double-strand break repair protein Addb [Caulobacter segnis ATCC
            21756]
 gi|295429502|gb|ADG08674.1| double-strand break repair protein AddB [Caulobacter segnis ATCC
            21756]
          Length = 995

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 305/1051 (29%), Positives = 482/1051 (45%), Gaps = 91/1051 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  F+I    PF  ++   LLN         +PL P  L   T+  PT+R  + L   F+
Sbjct: 13   PRWFSIPAHRPFVDDLARGLLNA-------LEPLGPEALPRATVLTPTRRGARALADAFL 65

Query: 66   EITGKKSTILPIIKSLGDVVE-EKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
             + G ++ +LP I+ LGD+ E E       L+ +L P +++ +R  ELARL++       
Sbjct: 66   AVGGGRALLLPQIRPLGDLDEGEPPFEPGELAIDLPPAIASRRRRFELARLVVD------ 119

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWED-LHALKNEKYGMWWLL 183
                DL     LS    P   + LAK L+D +D  + EE ++ED L  L        W +
Sbjct: 120  --HGDL-----LSFKPGPVQTLELAKALSDFLDSCQIEEIQFEDRLDGLAEGDLAQHWQV 172

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIA-GSTGSIPAT 242
            +A FLK   + W ERL  L        ++ L+RA  +   +     +++A GSTG+ PAT
Sbjct: 173  SARFLKAVLRAWPERLKHLGLIDVSERRVRLLRALEKQWSENPPTEVLVAAGSTGTAPAT 232

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDF 302
            A L+  VA  P GA+VLPGLD  +  + W+ I           +    HPQ ++ +LLD 
Sbjct: 233  ADLLRVVAAAPKGAVVLPGLDEDLADSAWDRI---------EGSQGEQHPQGAMKRLLDR 283

Query: 303  LDIKREDVKR-LGNVSNEMYGRSMVISKSFLPPD-TSD-MRNTDILENKIPN---IQKCF 356
              + R DV+  + +  +    R  +++++  P + T+D +     L  + P+   I +  
Sbjct: 284  AGVARGDVRAWVPDADSRGRWRRRIVNEALRPAEATADWLAQIASLRAEAPDLDPIAEGL 343

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
               ++I A  E E A + A+ LR +L+   K +AL+T D+ LARRV   L R+G+  D S
Sbjct: 344  MGFSVIAARAEEEAAGACALLLREALETPDKTAALVTPDQTLARRVMTRLQRWGVIPDSS 403

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            AG PL+    S+IL             +  A LV+ PL     P + L+ AK+   LV  
Sbjct: 404  AGAPLAAA-GSAILA------------LHFARLVEEPL----NPVRLLAVAKH--PLVLG 444

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
                 +  +++ K L   R A   +   +   ++RL +  + LA  L D +L  +    +
Sbjct: 445  EDEAPAAAVLERKGL---RGAAPGSAEGL---RARLKDTPEALA--LCDRVLAAVDHAAS 496

Query: 537  -YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETG 595
             Y       C         K  V  L+ +          LW    G+ L +L + +I+ G
Sbjct: 497  PYADGFARPCQA------AKALVEALEGLIAPAR-----LWAGGAGECLGALMAALIQDG 545

Query: 596  SCIK-ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVW 654
              +  A+   + DI+ RL++ ETV+        L ILG +E+RL+  D L+L GL EGVW
Sbjct: 546  EPLPDASPQAFADILDRLVNEETVRVGGATHPRLRILGAIEARLVRADRLVLAGLEEGVW 605

Query: 655  PKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASR 714
            P+    +PFLSR M+S L L   E+ +G  AHDF  A     ++     R    P + SR
Sbjct: 606  PQGAPIDPFLSRPMRSRLGLPPPERRVGLTAHDFAQAASAPDVVLVHCERRGGAPAVESR 665

Query: 715  WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSE 774
            WL RL  L        L +R    LDW R LD        KRP+P PP+E +PR  + + 
Sbjct: 666  WLWRLKTLAAGAGL-ALPRRDDV-LDWVRALDAPEPYSPIKRPEPRPPVEDRPRKMAVTR 723

Query: 775  IKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHL 834
            I+ L  DPYAV+AR ILKL  +    +  +   RGT  H    +  +   +    +   +
Sbjct: 724  IEALTRDPYAVWARDILKLYPLERPDEPVEARARGTAIHAAFEKFAETYPDSVPADAAAV 783

Query: 835  MKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK--MAIE 892
             ++          +PP      R L  + +    + E + ++   KI V    K  ++I 
Sbjct: 784  FERFYIEALVGAGMPPTALTRERALAREAAQWVADWERQRRAGARKIVVEAEGKLELSIN 843

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
                 LT  ADRI+  + G   I DYKTG  P ++       PQL+L AA L  G F  +
Sbjct: 844  GRAFTLTAKADRIEPTQDGTAHILDYKTGAAPSQKQVDTGFSPQLTLTAAILMNGGFPDL 903

Query: 953  DCRKVANLFYIRLKQKF-----KIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
                   L Y+R+  +      ++  + N +    ++E + K++  L++++    + ++P
Sbjct: 904  GSPAPGELTYVRVTGRRPAGEEQVRALANGE----SEEAARKAMDGLVKLIARYDDPDEP 959

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            + S +          +Y HLARV EW    D
Sbjct: 960  YRSRVAPQFVKEHPGDYAHLARVFEWSTSGD 990


>gi|260429437|ref|ZP_05783414.1| double-strand break repair protein AddB [Citreicella sp. SE45]
 gi|260420060|gb|EEX13313.1| double-strand break repair protein AddB [Citreicella sp. SE45]
          Length = 977

 Score =  376 bits (965), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 308/1050 (29%), Positives = 486/1050 (46%), Gaps = 108/1050 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            ++ P VF +AP   F     PA L   L +     P  P  +A V + V T R  + +R 
Sbjct: 5    SETPRVFALAPGVDF-----PAALVAGLKQRMAGQP--PEAMARVELIVNTTRMARRIRQ 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F       +T+LP I+ L ++      AD +   +L  PVS ++R LEL  L+    +K
Sbjct: 58   LF---DAGPATLLPRIRLLTEI------ADPIALADLPAPVSPLRRRLELTGLV----SK 104

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            L D   DL P + L           LA +LA ++D ++ E    +D+  L        W 
Sbjct: 105  LLDAQPDLAPRTAL---------FDLADSLATLMDEMQDEGVSPDDIAQLDVSDESGHWQ 155

Query: 183  LAADFLKIASKYW--TERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIP 240
             A  F  I  +Y+   E   ++NA      ++AL +   +  +     P+I+AGSTGS  
Sbjct: 156  RALSFFNIVQRYFKTGEEAPDVNAFR----RLALEQRLKDWEISPPSHPVILAGSTGSRG 211

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
             T RLM+ VA  P GA+VLPG D   P ++W+ +T+  +           HPQ+  A+L+
Sbjct: 212  GTNRLMNAVARLPQGALVLPGFDFDTPASVWDGLTDALSG--------EDHPQFRFARLM 263

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              L ++ +D+ R    +    GR+ ++S +  P   +D    +     +P++ +  S++ 
Sbjct: 264  HGLGLRPDDIARWSGDAAPNDGRNRLVSLALRPAPVTDQWRDE--GPSLPDLTEATSELT 321

Query: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
            L+EA ++R+EA +IA+ LR +  E+   +ALIT DR L R+V   L R+GI  D SAG P
Sbjct: 322  LVEAASQRDEATAIALRLRQAA-EDGVTAALITPDRMLTRQVTAALDRWGILPDDSAGTP 380

Query: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNK 480
            L  T     L  +     +     A+ TL+KHPL   G       RA   LEL  +R   
Sbjct: 381  LQLTPPGRFLRHVSTLFQQDLTAEALLTLLKHPLTHSGHERGEHLRATRELEL-HIRNKS 439

Query: 481  NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTN 540
              Y               Q +N     W    +E     A  +      C  P+      
Sbjct: 440  WPY--------------PQPDNLRA--WGE--AEGFGPWADWVAASF--CQPPV------ 473

Query: 541  KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG-KTLSSLFSKIIETGSCIK 599
                 G   ++DW  L V   + +          LW E  G KT +++     E G    
Sbjct: 474  ----HGTHLLADWLDLHVARAEAIAAGPMADDSELWKEAAGRKTRATVDGLRDEAGYGTD 529

Query: 600  ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTA 659
             +A ++ D+   ++    ++ +      + I GTLE+R+   D LILGGLNEG WP+   
Sbjct: 530  LDARDYADLFNAVLSRGELRDRDAPHPRILIWGTLEARVNGADLLILGGLNEGSWPELPG 589

Query: 660  KNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRL 719
             +P+L+R M+    L   E+ IG AAHDF+ A     +  TR+L+ ++  T+ SRWL RL
Sbjct: 590  ADPWLNRRMRHKAGLLVPERRIGLAAHDFQQAVAAPQVWLTRALKSDDAETVPSRWLNRL 649

Query: 720  LVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSF 772
            + L        G +    +K+RG  +L   R L+     P   RP P PP+EA+PR  S 
Sbjct: 650  MNLMNGLPARHGPEALAAMKQRGAHWLALARALETPRPSPPATRPSPAPPVEARPRALSV 709

Query: 773  SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK----NT 828
            +EIK L+ DP+ +YARR+LKL  +   ++ PD   RGTL H ++ + +++ ++      T
Sbjct: 710  TEIKTLLRDPFHIYARRVLKLQALNPLQRAPDALLRGTLIHEVLEQFVRQSVSDPAQLTT 769

Query: 829  PEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA 887
              +  L  QI+    + E +P P    +W+    K++  F E E   Q     +      
Sbjct: 770  EALLRLSVQIVG---DPEVVPYPTTRHLWQARLAKVAEWFAETERARQQIARPVHFEQMG 826

Query: 888  KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
            +  I ++G  L G ADRID+ + G   + DYKTG  P  E  Q   D QL LEAA ++ G
Sbjct: 827  RGEIPALGFTLRGKADRIDMDERGNAHLYDYKTGAAP-SEKEQLHFDKQLLLEAAMVERG 885

Query: 948  SFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNL-IEIVTLLQNGEQ 1006
            +F ++  R      ++          +   K +     L+E   + +  E  TL+    +
Sbjct: 886  AFKELQPRHAERAVFV---------SLAPGKPREVPAPLAEAPAQQVWAEFETLMTRWFE 936

Query: 1007 P---FISHLRLSEKSNIQSEYDHLARVAEW 1033
            P   + +   L ++S+  S+YDHL+R  EW
Sbjct: 937  PDRGYTARAALLKESD-SSDYDHLSRFGEW 965


>gi|167648807|ref|YP_001686470.1| double-strand break repair protein AddB [Caulobacter sp. K31]
 gi|167351237|gb|ABZ73972.1| double-strand break repair protein AddB [Caulobacter sp. K31]
          Length = 999

 Score =  375 bits (964), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 311/1050 (29%), Positives = 479/1050 (45%), Gaps = 90/1050 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  F+I    PF  ++   LL+          PL P  L + T+  PT+R  + L   F+
Sbjct: 17   PRWFSIPAHRPFVEDLARGLLSA-------LAPLGPEALPAATVLTPTRRGARALADAFV 69

Query: 66   EITGKKSTILPIIKSLGDVVE-EKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
               G K+ +LP I+ LGD+ E E       LS +L P VS+ +R  ELARL+        
Sbjct: 70   AAGGGKALLLPQIRPLGDLDEGEPPFEPGELSLDLPPAVSSRRRRFELARLV-------- 121

Query: 125  DIIKDLYPESPL-SLPISPANAIWLAKNLADIIDIIETEEKKWED--LHALKNEKYGMWW 181
                     +PL S       A+ +AK LAD +D  + EE   +D  L +L        W
Sbjct: 122  ------AEHAPLLSFQPQAGQALEMAKALADFLDSCQIEEVVADDGRLDSLAEGDLAQHW 175

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIP 240
             ++A FLK     W +RL EL        ++ L+ A ++   +   +G ++ AGSTG+ P
Sbjct: 176  QVSARFLKAVLTAWPKRLDELGLIDVSDRRVRLLNALSDQWEQNPPQGVLVAAGSTGTAP 235

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATARL+  +AN P GA+VLPGLD  +    W+ I         +      HPQ ++ +LL
Sbjct: 236  ATARLLGVIANLPQGAVVLPGLDDGLADDAWDKI---------AGVQGEQHPQGAMKRLL 286

Query: 301  DFLDIKREDVKRL-GNVSNEMYGRSMVISKSFLPPD-TSD-MRNTDILENKIPN---IQK 354
            D     R DV+       +    R  +I+++  P + T+D +   D L  + P    I +
Sbjct: 287  DGAGATRADVRPWWPEADSRGRWRRRLINEALRPAEATADWLAQIDRLREEAPGLDPIAE 346

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
                ++L+    E E A++ A+ LR +L+     +AL+T D+ LARRV   L R+G+  D
Sbjct: 347  GLKGLSLVSTRTEEEAAVACALLLREALETEGLTAALVTPDQELARRVGARLMRWGVIPD 406

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             SAG PL+ +  ++IL               +A L   PL     P + L+ AK+ L   
Sbjct: 407  SSAGAPLAAS-PAAILA------------QHVAALAVDPLD----PVRLLAVAKHPL--- 446

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
             LR +  +   ++LKSL   R    ++   +     +L +    LA  L + +L      
Sbjct: 447  -LRADAVAARDLELKSL---RGPAPRDAGQL---LGKLKDHPDALA--LAERVLAAARQA 497

Query: 535  VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIET 594
                 +  +     S++  T+  V  L+ +         +LW    G+ L+ L S +I  
Sbjct: 498  AAPYVDDQAPP---SVA--TRALVESLEALA-----DPADLWAGSAGECLAGLLSSLITD 547

Query: 595  GSCIK-ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
            G  +  A+A+ + D++ RL++ ET++        L I G +E+R++  D LIL GL EG+
Sbjct: 548  GVVLPPASALGFADLLDRLVNEETLRVGGATHPRLRIFGAIEARMVRADRLILAGLEEGI 607

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WPKN   +PFLSR M++ LNL   E+ IG  AHDF  A     +I   S R    P + S
Sbjct: 608  WPKNAPIDPFLSRPMRAKLNLPPPERRIGLTAHDFAQAACAPDVILVHSERRGGAPAVES 667

Query: 714  RWLQRLLVLG-GTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSF 772
            RWL RL  L  G      L +R    L W R LD        KRP P PP+  +PR  + 
Sbjct: 668  RWLWRLKTLARGAGL--RLTERPDV-LAWVRDLDAAGLYDPIKRPAPTPPVADRPRKMAV 724

Query: 773  SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEIN 832
            + ++ L  DPYAV+AR ILKL  +    +  +   RGT  H        +          
Sbjct: 725  TRVEALTRDPYAVWARDILKLYPLDRPNEPVEARARGTAIHAAFETFALQHPGPVPANAA 784

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE 892
             +   +  S      +PP      R L  + +    + E + ++  E+I V     +  +
Sbjct: 785  EIFAGLYLSELVAAGMPPAALARERALAREAALWVADLETRRRAGAERIVVEAAGSLTFD 844

Query: 893  SIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
              G    +T  ADRI+    G   I DYKTG  P K+  +    PQL+L AA L+ G F 
Sbjct: 845  IGGRPFTVTAKADRIEPTADGMAHILDYKTGAAPSKKQVETGFSPQLTLTAAILREGGFP 904

Query: 951  QIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSE--KSLKNLIEIVTLLQNGEQPF 1008
             I  R+  +L Y+R+  + K   +   +    AD      K+L  L E++    + +QP+
Sbjct: 905  DIGPREPGDLTYLRVTGR-KPAGVEEVRAAAGADAQEAAIKALNGLRELIERYDDPKQPY 963

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            +S +      +   +Y HLARV EW    D
Sbjct: 964  LSRVAPQFVHDHVGDYGHLARVFEWSTSGD 993


>gi|114762247|ref|ZP_01441715.1| hypothetical protein 1100011001331_R2601_14950 [Pelagibaca
            bermudensis HTCC2601]
 gi|114545271|gb|EAU48274.1| hypothetical protein R2601_14950 [Roseovarius sp. HTCC2601]
          Length = 976

 Score =  369 bits (946), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 299/1045 (28%), Positives = 476/1045 (45%), Gaps = 99/1045 (9%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VF +AP   F   ++  L         R +   P  +A V + V T R  + +R 
Sbjct: 5    SAAPRVFAVAPGIDFPEALVAGL-------RTRMEGQPPEAMARVELIVNTTRMARRIRQ 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F       +T+LP I+ L +V      AD +   +L  PVS ++R LEL  L+    + 
Sbjct: 58   IFDR---GPATLLPRIRLLSNV------ADPIALAHLPAPVSPLRRRLELTGLV----SG 104

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            L D   DL P + L           LA +LA ++D ++ E    ED+ AL        W 
Sbjct: 105  LLDAQPDLAPRTAL---------FDLADSLATLMDEMQDEGVSPEDIAALDVSDESGHWQ 155

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPAT 242
             A  FL I  +Y+     E    +    ++AL +  ++  +     P+I+AGSTGS   T
Sbjct: 156  RALSFLNIVQRYFDS--AEDAPDTTSFRRLALKQRLSDWEVNPPSHPVILAGSTGSRGGT 213

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDF 302
              LM  VA  P G +VLPG D   P ++W+ +T+   +          HPQ+  AKL++ 
Sbjct: 214  NELMRAVARLPQGELVLPGFDFDTPESVWHGLTDALAS--------EDHPQFRFAKLIND 265

Query: 303  LDIKREDVKRLGNVSNEMYGRSMVISKSFLP-PDTSDMRNTDILENKIPNIQKCFSDVAL 361
            L ++  DV R          R+ +IS +  P P T   R+   +   +P++     D+ L
Sbjct: 266  LGMQAGDVLRWSEAEPPSAARNRLISLALRPAPVTDQWRDEGPM---LPDLIAATEDLTL 322

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPL 421
            +EA ++R+EA +IA+ LR + +E    +ALIT DR L R+V   L R+ I  D SAG PL
Sbjct: 323  VEAASQRDEATAIALRLRQAAEEGVT-AALITPDRMLTRQVTAALDRWNILPDDSAGTPL 381

Query: 422  STTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKN 481
              +     L  +           A+ TL+KHPL   G       RA   LEL  +R    
Sbjct: 382  QLSPPGRFLRHVSTLFQHDLTAEALLTLLKHPLCHSGHDRGEHLRATRELEL-HIRNKSW 440

Query: 482  SYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNK 541
             Y   +L                +  W   ++ E +  A  + D    C  P        
Sbjct: 441  PYPRPEL----------------IRAWG--VAAEMESWANWVADSF--CQPP-------- 472

Query: 542  NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII-ETGSCIKA 600
                G  ++SDW +  +   + +      +   LW E  G+   ++   +  E G     
Sbjct: 473  --RRGKRALSDWIEDHIARAEAIAAGPQGEDSELWKEAAGRKARAVVEGLRDEAGFGTDL 530

Query: 601  NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAK 660
            +A ++ D+   ++    ++ +      + I GTLE+R++  D LILGGLNEG WP+    
Sbjct: 531  DARDYGDLFAAILQQHELRDRDAPHPRILIWGTLEARVMGADLLILGGLNEGSWPELPGA 590

Query: 661  NPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL 720
            +P+L+R M+    L   E+ IG AAHDF+ A     +  TR+L+ ++  T+ SRWL RL+
Sbjct: 591  DPWLNRRMRHKAGLLVPERRIGLAAHDFQQAVAAPQVWLTRALKSDDAETVPSRWLNRLM 650

Query: 721  VL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
             L        G      +K RG  +L   R L+     P   RP P PP+EA+PR+ S +
Sbjct: 651  NLMNGLPDRSGPQALAAMKARGGHWLALARALERPQPSPPATRPSPAPPVEARPRSLSVT 710

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP-EIN 832
            EIK LI DP+ +YA+R+L+L  +   ++ PD   RG L H ++ E +K+ ++  +     
Sbjct: 711  EIKHLIRDPFHIYAKRVLRLAPLNPLQRAPDALLRGILIHEVLEEFVKESLSDPSQLTTE 770

Query: 833  HLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAI 891
             L+++      + E +P P    +W+    +++  F E E   Q+        I     I
Sbjct: 771  ALLRRTTALIGDPERVPYPTTRHLWQARLGRVAEWFAETERARQAIARPAHFEIMGHAEI 830

Query: 892  ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQ 951
             ++G  L G ADRID+   G   + DYKTG  P  E+ Q+  D QL LEAA ++ G+F  
Sbjct: 831  PALGFTLRGKADRIDIDDRGGAHLYDYKTGAAP-TESQQRHFDKQLLLEAAMVERGAFKD 889

Query: 952  IDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP---F 1008
            +  R      ++          + N+ ++  A      + +   E  TL+    +P   +
Sbjct: 890  LQPRHTEQAVFV---------SVANNPREVPAPLEEMPAQQVWAEFETLMARWFEPDRGY 940

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEW 1033
             +   L  + ++ SEYDHL+R  EW
Sbjct: 941  TARAALVREKDL-SEYDHLSRFGEW 964


>gi|254511546|ref|ZP_05123613.1| double-strand break repair protein AddB [Rhodobacteraceae bacterium
            KLH11]
 gi|221535257|gb|EEE38245.1| double-strand break repair protein AddB [Rhodobacteraceae bacterium
            KLH11]
          Length = 975

 Score =  367 bits (943), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 304/1046 (29%), Positives = 469/1046 (44%), Gaps = 108/1046 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF + P + F     P +L   L   F   P  P  LA V + V T+R  + +R  F 
Sbjct: 8    PRVFAVPPGADF-----PKVLVNGLRRRFAGQP--PDALARVQLVVNTRRMARRVRDLFD 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            +       +LP +  L D+ E   +ADL     + P +  ++R LEL +LI    +KL D
Sbjct: 61   Q---GAPCLLPRLSLLTDLGE---SADL---AQVPPAIPPLRRRLELTQLI----SKLLD 107

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL   S L           L+ +LA +ID ++ E    + +H L        W  A 
Sbjct: 108  QQPDLAARSSL---------FDLSDSLAGLIDEMQGEGVSPDAIHQLDVSDMSGHWARAQ 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-----PIIIAGSTGSIP 240
             F+ IA  +       +NA +      A  R   E+L+   +      P+I+AGSTGS  
Sbjct: 159  AFIGIADHF-------MNAGADALDAQARQRRVVENLIARWQANPPHHPVILAGSTGSRG 211

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
             T  LM  VA  P GA+VLPG D   P  +W  + E  T+          HPQY   KL+
Sbjct: 212  TTLMLMQAVARLPQGALVLPGYDFDQPGPVWRNLDEALTS--------EDHPQYRFRKLM 263

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              L +  + ++R          R+ ++S +  P   +D   T+     +P+++    DV 
Sbjct: 264  LGLGLTPDHIQRWSADQAPSPARNKLVSLALRPAPVTDAWMTE--GPDLPDLEGATRDVT 321

Query: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
            L+EA + R EA++IA+ LR +  E  + +ALIT DR L R+V   L R+ I  D SAG+P
Sbjct: 322  LVEAPSPRAEALAIALRLREAA-ETGQTAALITPDRMLTRQVSAALDRWNILPDDSAGLP 380

Query: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNK 480
            L  +     L  +     +  D  A+ TL+KHPL   G                   G++
Sbjct: 381  LQLSPPGRFLRHVAGLFARRLDGEALLTLLKHPLCHDG-------------------GDR 421

Query: 481  NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTN 540
             ++ ++  + L LD         H P +    S         L    ++  TP    +  
Sbjct: 422  GAH-LLHTRDLELDL------RRHGPPFPDSAS---------LTAFAIRTETPEDWVRWV 465

Query: 541  KNSTC-----GNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG-KTLSSLFSKIIET 594
              + C     G   ++DW +   T  + +          LW +  G K L+ + +   E 
Sbjct: 466  VGTFCDQHKPGEQPLTDWVEQLCTLAEAISAGASGDTGRLWDKNAGQKALAVITALQTEA 525

Query: 595  GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVW 654
                   A ++ D++  L+ GE V+ +      L I GTLE+R+   D LILGGLNEG W
Sbjct: 526  KYGGGMTAHDFADLLGALLAGEEVRDRDAPHPHLMIWGTLEARVQGADLLILGGLNEGSW 585

Query: 655  PKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASR 714
            P+  A +P+L+R M+    L   E+ IG +AHDF+ A G   +  TR++R ++  T+ SR
Sbjct: 586  PEAAAPDPWLNRQMRDAAGLLLPERRIGLSAHDFQQAIGAPEVFVTRAIRSDDAETVPSR 645

Query: 715  WLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP 767
            WL R+  L       GGTD    ++ RGQ +L     L+   +     RP P PP+ A+P
Sbjct: 646  WLNRITNLLQGLPAQGGTDALTAMRARGQLWLGRAEMLEQAPRITAAIRPSPRPPVAARP 705

Query: 768  RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKN 827
            R  S +E+K+LI DPY +YAR +L+L  +    + PD   RG + H ++   I+  +   
Sbjct: 706  RRLSVTEVKRLIRDPYDIYARHVLRLKPLDPLVQAPDALLRGIVIHEVLEHFIRDSVLDP 765

Query: 828  TPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA 887
                     +   +   +    P    +W     +I+ SFL  E + ++    +   +  
Sbjct: 766  ALLTRENFLKRASTLLNEYVAWPTARKLWLARLERITDSFLSAELQRRNDGCPVAFEVAM 825

Query: 888  KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
            K+A+  +   + G ADRID    G + I DYKTG  P  E  Q   D QL +EAA  + G
Sbjct: 826  KLALAPLDFTIAGRADRIDRSGHGALRIIDYKTG-TPPTENQQAKFDKQLLIEAAIAEQG 884

Query: 948  SFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
                 D   VA   +I +   +K   +    +K  AD    K L  L E+++     +Q 
Sbjct: 885  GVDGFDPLPVAQAIFIGMGGTYK--EVPAPLQKEPAD----KVLSELKELISAYLEPDQG 938

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            F S   L + ++I  +YDHLAR  EW
Sbjct: 939  FSSRRMLHKDTDI-GDYDHLARFGEW 963


>gi|83594764|ref|YP_428516.1| hypothetical protein Rru_A3435 [Rhodospirillum rubrum ATCC 11170]
 gi|83577678|gb|ABC24229.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 1018

 Score =  360 bits (923), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 323/1081 (29%), Positives = 503/1081 (46%), Gaps = 120/1081 (11%)

Query: 8    VFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEI 67
            V TI    PF        L   +V+       +PL    VT+ +PT+RA + LR  F+ I
Sbjct: 6    VQTIPAGLPFLDT-----LAAGIVDRLGDRTADPLAATRVTVLLPTRRACRALREAFLRI 60

Query: 68   TGKKSTILPIIKSLGDVVEEKFT----ADLLLSYNLN--PPVSNIQRLLELARLILIWRN 121
             G K+ +LP I  LGD+ E++      AD  L   L+  PP++ ++R + LARLIL   +
Sbjct: 61   EGGKAALLPRILPLGDLEEDESAGAGLADGALRPTLDFAPPIAPLERQVLLARLILARDS 120

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHAL--KNEKYGM 179
                   D          ++PA A+ LA++LA ++D+ +TE      + AL  +      
Sbjct: 121  AKATAGGDSA--------MTPAQALRLAQDLAGLLDLAQTEHIDLSTVAALVPQTSPLAE 172

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIIIAGSTGS 238
             W L  DFL + +  W   L   +A  P  ++  ++    A        GP+I AGSTGS
Sbjct: 173  HWQLTLDFLALLTSVWPGLLAAHHALDPADHRNKVLDAQAAAWAAHPPAGPVIAAGSTGS 232

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +PATA L++T+A+ P G +VLPGLD  +    W  + +             +HPQ  + +
Sbjct: 233  VPATAALLATIAHLPQGLVVLPGLDIGLDDESWEALED-------------SHPQAGMKR 279

Query: 299  LLDFLDIKREDVKRLGNVSNEMY-----GRSMVISKSFLPPDTSDMRNTDILENKIPNIQ 353
            LLD L + R+ V+                R++++ ++  P  T+D      L    P+  
Sbjct: 280  LLDTLGLSRQAVRFFSETPPRGAIAAPPARALLVREALRPAATTDRWRR--LRESGPSGG 337

Query: 354  KCFS----DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRF 409
            + F+     V L+ A   REEA +IA+ +R +L+   + +ALIT DR LARRV   L R+
Sbjct: 338  EAFARALDGVTLVRAAGPREEAAAIAVMMRGALETPGRTAALITPDRALARRVAAALGRW 397

Query: 410  GINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAK- 468
            G+ +D SAG PLS T   + L     A+      +A+ +L++HPLA  G  +  + RA+ 
Sbjct: 398  GLRVDDSAGRPLSQTPVGAFLRLAAQAVADGLGPVALLSLLQHPLAAGGE-DPVVFRARL 456

Query: 469  NALELVALRGNKNSYDIMDLKSLVLDRIATQKN-NTHVPHWQSRL------------SEE 515
              L+   LRG +    +  L   +  + A   +   H+  W  RL            S+E
Sbjct: 457  RLLDREVLRGPRPDPGVAGLAQAI--KAADDPDMERHLGGWLERLEALAGPFCTLMDSDE 514

Query: 516  DKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNL 575
              ++A L+  H+  C       +    +  G +     T+L                   
Sbjct: 515  PVDVAALIDAHMRFC-------EGLAEAREGGVEKPGATRL------------------- 548

Query: 576  WFEEEGKTLSSLFSKIIETGSCIKANAIE-WIDIITRLIDGETVKPKIEKSSTLFILGTL 634
            W  ++G+  + L + + E    + A A   +  ++  L+DG  V+PK +  S LF+ G L
Sbjct: 549  WAGDDGEAAALLGADLTEAAPSLGAIAPRHYPALLDALMDGRAVRPKRDLHSRLFLWGPL 608

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            E+RL   D LILGGLNEG WP      P++SR M   + L   E+ IG AAHD   A   
Sbjct: 609  EARLQRADLLILGGLNEGGWPAAVDTGPWMSRPMLDQIGLPQPERRIGLAAHDVSQALCA 668

Query: 695  RHLIYTRSLRENNIPTIASRWLQRL-LVLGGTDF---FDNLKKRGQCYLDWTRKLDYTTK 750
              +  TR+LR    PT+ SRWL RL  V+G T     +   ++RG   L   R L+    
Sbjct: 669  PEVAITRALRVEGTPTVPSRWLTRLDAVIGATGLDKEWAKARQRGDRLLALARSLE---- 724

Query: 751  QPHYKR-----PKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDR 805
            QP  +R     P+P PPL  +PR  S + I+  + DPYA+YA+ IL L  +   + DP  
Sbjct: 725  QPQGERKPCPAPEPRPPLADRPRRLSVTRIETWMRDPYALYAQFILGLSELDPLEADPGV 784

Query: 806  TDRGTLFHNIITELI----KKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFH 861
            +D GTL H  + + +    K        EI  L       H  +    P +   W   F 
Sbjct: 785  SDYGTLVHGALEDFVGLYPKDLPGDPEAEIIRLGTLRFAPHMTR----PGVRAFWWPRFL 840

Query: 862  KISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYK 919
            +I+H   E E + +  I ++F    A+M +        LT  ADRIDL + G + + DYK
Sbjct: 841  RIAHWIAEREIERRPEILEVFAERRAEMTLTGPAGPFILTAKADRIDLRRDGTLAVIDYK 900

Query: 920  TGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKK 979
            TG  P K+  +  + PQL LEA     G F  I  + V++L + +L+     D +  + +
Sbjct: 901  TGMLPSKKEVESGLSPQLPLEALLASRGCFPGIAGKPVSDLGFWKLRG----DRLGGEIR 956

Query: 980  KYSADE--LSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEY 1037
            + + D   ++E + K L +++T   N + P+ +           + Y HLARV EW E+ 
Sbjct: 957  QAADDPEGVAEAAHKGLSDLITAFDNPDTPYFARPHPDHAPRF-NPYQHLARVKEWAEKG 1015

Query: 1038 D 1038
            D
Sbjct: 1016 D 1016


>gi|218672989|ref|ZP_03522658.1| hypothetical protein RetlG_15865 [Rhizobium etli GR56]
          Length = 431

 Score =  359 bits (922), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 275/431 (63%), Gaps = 7/431 (1%)

Query: 52  PTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRL 109
           PT+RA++ LRSEF+++ G +S ILPII+ LG+  ++   F   L  + +L  P+SN  RL
Sbjct: 1   PTRRAVRVLRSEFVDLLGGRSAILPIIRPLGETDDDSGYFDEALPATIDLAQPLSNTARL 60

Query: 110 LELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDL 169
           LELARLIL WRNKLP+I++ ++ +SPL  P SPA+AIWLA+NLA++ID IETE+  W +L
Sbjct: 61  LELARLILAWRNKLPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIETEDLDWSEL 120

Query: 170 HALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKG 228
             L    Y  WW L A+FL+IAS +W  RL EL  SSP  ++ A++RAEA  L      G
Sbjct: 121 SKLDTGDYAAWWQLTAEFLQIASAFWPARLSELGKSSPARHRNAILRAEAARLSAAKPSG 180

Query: 229 PIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTY 288
           P+IIAGSTGS+PATA L++ VA+ P G IVLPGLD  +P   W  +  +      +N   
Sbjct: 181 PVIIAGSTGSVPATADLIAAVADLPEGVIVLPGLDLAMPEGHWQMVAPEPAPGQHANPAS 240

Query: 289 STHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENK 348
            +HPQY L+ LL  L + R DV  L     ++  R+ ++S++  P + +    T   E  
Sbjct: 241 RSHPQYGLSSLLKRLRLTRADVSILDRPGADLDRRAEILSRALAPAEATSDWGTWKSELP 300

Query: 349 IPNIQKCFSDVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKL 404
              +   F+DVALIEA NEREEA +IA+ALR++L+    + + ++ALIT DRNLARRV  
Sbjct: 301 AGALTSAFNDVALIEAANEREEATAIAVALRLALERPGQDGESRAALITPDRNLARRVMA 360

Query: 405 ELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYL 464
           EL+RFGI  D SAG PLS T   ++L  LL A  +  D +A   L+KHPLA+FG     L
Sbjct: 361 ELSRFGILADDSAGTPLSATPQGTLLQLLLEAALRPGDPVATVALLKHPLARFGLERDTL 420

Query: 465 SRAKNALELVA 475
             A  ALEL+A
Sbjct: 421 ISATEALELLA 431


>gi|294084829|ref|YP_003551589.1| inactivated superfamily I helicase [Candidatus Puniceispirillum
            marinum IMCC1322]
 gi|292664404|gb|ADE39505.1| Inactivated superfamily I helicase [Candidatus Puniceispirillum
            marinum IMCC1322]
          Length = 1002

 Score =  357 bits (917), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 302/1065 (28%), Positives = 488/1065 (45%), Gaps = 106/1065 (9%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
            +V+ I   +PF +E+   ++             +P  LA   + VP++RA Q LRS F++
Sbjct: 5    SVYNIPAGTPFAKELAKGVIQLAS---------SPTDLARAIVMVPSQRAAQALRSAFLD 55

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLL-------SYNLNPPVSNIQRLLELARLILIW 119
            +T  ++ +LP +  +GD+ ++   AD+         +  L P +S ++R + LA+L+  +
Sbjct: 56   VTKGQAALLPRMIPIGDLADD--VADVFPELYGGADTAMLPPAISPLRRQMMLAKLLGGF 113

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            +         L  ++P + P     A+ LA  L  ++D +   +   + L  +  E+Y  
Sbjct: 114  K---------LGGQTP-TFP----QAMMLAHTLGQLLDQLYNVDANPDQLRDMLPERYSA 159

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGS 238
             W      L I    W   L   N    V  +  L+RA  +       +  I+IAGSTGS
Sbjct: 160  HWQDIIKLLTILVDNWPAILASENVMDGVDRRNRLIRARVKAWQDNPPETLIVIAGSTGS 219

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCH-IPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            I AT  L+  V+N PNG +VLPGLD   +P   W+ I+  S            HPQY LA
Sbjct: 220  IIATRELIRCVSNLPNGHVVLPGLDSGAVPE--WDAISHDSG-----------HPQYQLA 266

Query: 298  KLLDFLDIKREDVKRLGNVSN-----EMYGRSMVISKSFLP-PDTSDMRNTDILENKIPN 351
            +LL F+DI   DV+    VSN         R  ++ + F P P T+  R    L    P+
Sbjct: 267  QLLHFMDITPLDVQNW--VSNPESQPATSARRDLMREVFRPAPTTATWRQ---LSEDRPD 321

Query: 352  IQK-CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFG 410
            + +     + +IE  + R EA  IA  LR +L+   + +ALIT DR+LA  V  EL R+ 
Sbjct: 322  LGRDALQGLQVIETHDRRAEAGLIAADLRATLEHEDQTAALITPDRHLAEAVIAELARWK 381

Query: 411  INIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNA 470
            I ID SAG  L T    + L  L+ A+ +    +A+  ++KHP A  G  +         
Sbjct: 382  ITIDDSAGTTLLTHRAGAFLQLLVEAMQENFAPLALLGVLKHPCAAGGMAQADFRAKVRH 441

Query: 471  LELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            +E + LRG + +  +  L   + D                     DK+L   +  HI   
Sbjct: 442  IEKLVLRGQRPAPGLEGLAIAIGD---------------------DKDLRDFIAIHIAVP 480

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL------------DEHRKLPNLWFE 578
             TPLV        T  +L+        +   Q +C+            D++    +LW  
Sbjct: 481  FTPLVDAWQAPAPTMASLARGLGQTAEMMAAQTMCIPSDGPDTETRVADKNDGALHLWDN 540

Query: 579  EEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRL 638
            + GK  + L   ++E G     NA ++   + +++   TV    +    L ILG +ESR+
Sbjct: 541  QGGKAAADLLKNLVEHGHDQAVNATDFAQTLVQIMQDITVHAVQQSHPRLAILGAVESRM 600

Query: 639  LNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLI 698
               D LI+ G NEG WP     +P+++  M+  + L         +AHD  MA     + 
Sbjct: 601  QTADHLIIAGFNEGNWPPQPQTDPWMNSDMRKAVGLPPHNWRTSLSAHDVYMAICNPKVT 660

Query: 699  YTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPK 758
             TR+ R+N+  TI SRWLQR+ V+           RG    +W   L+  T     KRP 
Sbjct: 661  ITRAQRQNDAATIPSRWLQRMDVVLSALGIAKALDRGDEKFEWLAILNPKTIPNRIKRPA 720

Query: 759  PFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITE 818
            P PPL A+PR +S +EI   INDPYA+YA++ILKL  +    + PD   RGTLFHN++ +
Sbjct: 721  PKPPLSARPRKFSATEIDMWINDPYALYAKKILKLRQLDDIDRPPDAALRGTLFHNVLAD 780

Query: 819  LIKKRINKNTPEINHL-MKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSS 877
              +   + + P+  +  +  I  +HF  +   P I   W   F  ++   +E E++ +  
Sbjct: 781  FTRTFPSGSLPDTAYQDLLAIGKTHFADQWATPDIRYFWWPRFEMVAGWIIETEKQRRDD 840

Query: 878  IEKIFVNIPAKMAIESIG----IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLI 933
            +   F++   K +    G    + L+  ADR++  K G   I DYKTG  P K       
Sbjct: 841  LA--FIHAEKKGSTILTGPAGPVELSARADRLEKTKDGTWHIIDYKTGIVPSKSKVASGR 898

Query: 934  DPQLSLEAAALKAGSFSQIDCRKVANLFYIRLK-QKFKIDCITNDKKKYSADELSEKSLK 992
              QL +EA     G +       +A + Y +L  +K KI     D      D+ S ++ +
Sbjct: 899  ATQLLVEALIAWDGGYDDKPGCDIAKMQYWKLSGRKNKI----GDIYDVLPDDGSPENTR 954

Query: 993  NLIE-IVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREE 1036
            ++++ ++TL  + E  + +   +  K +  + Y HLAR++EW++E
Sbjct: 955  DMMQSLITLFDDPEATYPAEPNIKFKLSY-NPYRHLARISEWQQE 998


>gi|254486211|ref|ZP_05099416.1| double-strand break repair protein AddB [Roseobacter sp. GAI101]
 gi|214043080|gb|EEB83718.1| double-strand break repair protein AddB [Roseobacter sp. GAI101]
          Length = 987

 Score =  357 bits (917), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 301/1061 (28%), Positives = 476/1061 (44%), Gaps = 110/1061 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
             K P V+ +AP   F +E++       LV   +  P  P+ +  + + V T+R  + LR 
Sbjct: 5    TKTPRVYGLAPGIDFPQELV-----AGLVSRLKGQP--PVAMGRIDLVVNTRRMQRRLRE 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F       +++LP I  + ++  +   A + L      P   ++R LEL  L+    +K
Sbjct: 58   IF---DAGPASLLPRIHLIDNL--DTLAAGIALPR----PSPALRRRLELITLV----SK 104

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            L D   +L P + L           L+ +LA +ID ++ E    E +  L        W 
Sbjct: 105  LLDQAPELAPRASLYD---------LSDSLAGLIDEMQGEGVPVEAITDLDVSDQSGHWE 155

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAE-AEHLMKGTKGPIIIAGSTGSIPA 241
             A  FL IA +Y  E +   +  +     +A M A  AE      + PII+AGSTGS   
Sbjct: 156  RAKQFLDIAHRYLGESVTRPDPRARQRQIVAQMIAGWAE---TPPQHPIIVAGSTGSRGT 212

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLD 301
            +A LM  VA  P GA++LPG D  +PT++W  + E    ++        HPQY     L 
Sbjct: 213  SAMLMQAVAGLPQGAVILPGFDFDMPTSVWADMGEAQEQLSQD------HPQYRFRHFLR 266

Query: 302  FLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVAL 361
             LD+ R  ++           R+ ++S S  P   + +  T+    K+P++ K    + L
Sbjct: 267  ALDLARSTIEPWTTCEPPSPERNALVSLSLRPAPVTHVWLTE--GPKLPDLGKATQGLTL 324

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPL 421
            I+A   R EA++IA+ LR ++ E+ + +ALIT DR L+R+V   L R+ I  D SAG+PL
Sbjct: 325  IQAPTPRAEALAIALRLRQAV-EDGQTAALITPDRMLSRQVTSALDRWNIVPDDSAGMPL 383

Query: 422  STTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKN 481
              +     L  + +   +  D  A+ TL+KHPL   G            LEL   R    
Sbjct: 384  HLSPPGRFLRHVADLFVRKLDSEALLTLLKHPLTHSGGDRNIHQLNTQRLELQVRRDGLP 443

Query: 482  SYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSE--------EDKELAVLLVDHILQCITP 533
              D   +  L    ++  K    +  W + +          +DK L   + DH+      
Sbjct: 444  YPDADGVLRLSRKTVSRSKKPDQMDIWATWVGAHFAGIDVGQDKPLEDWVADHLAVAA-- 501

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
                           +I+D +  T+                LW  + G+    + + + E
Sbjct: 502  ---------------AIADGSNPTIES-------------ALWLRKSGEEAKKVMANLSE 533

Query: 594  TGS-CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEG 652
                  + +A ++ D++  L+    ++        + I GT+E+R+   D +I+GGLN+ 
Sbjct: 534  NAPYGGEMSASDYADLVGALLQQGEIRDSDAPHPDVMIWGTMEARVQGADLIIMGGLNDS 593

Query: 653  VWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIA 712
             WP+    +P+L+R M+    L   E+ IG +AHD++ +     +  TR++R +   T+ 
Sbjct: 594  TWPEAPPPDPWLNRQMRLQAGLLLPERRIGLSAHDYQQSIAAPEVCLTRAIRSDEAETVP 653

Query: 713  SRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEA 765
            SRWL RL  L       GG   +  + KRG  +L+  R L+  ++     RP P PP  A
Sbjct: 654  SRWLNRLGNLLNGLPEQGGDAAWQTMIKRGDHWLEQARALEAVSRVDPAIRPSPRPPRGA 713

Query: 766  QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK---- 821
            +P   S +EIK+LI DPYAVYA+  LKL  +    + PD   RG + H I+   IK    
Sbjct: 714  RPHALSVTEIKRLIRDPYAVYAKHSLKLRALNPLVQSPDAPVRGIIVHEIMERFIKSVTA 773

Query: 822  --KRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
              K + K     +HL+ +   +  + E   P   I+W     +I+  F+E+E + QS   
Sbjct: 774  DPKNLTK-----SHLL-ETASTVLDAEAPWPAARIMWLTKIERIADWFIENEVRRQSYSS 827

Query: 880  KIFVNIPAKMA--IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQL 937
                   AK +     +G  LTG+ADRID    G + I DYKTG  P K   QK  D QL
Sbjct: 828  PAAFEKAAKGSHIFPDLGFTLTGYADRIDRTDDGDILIYDYKTGTPPSK-LEQKAFDKQL 886

Query: 938  SLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEI 997
             LEAA ++ G F +I    VA   YI L  K        +      DE   + L  L  +
Sbjct: 887  LLEAAMVEEGGFKEIGVATVAQAAYIGLGSK------PVELAAPLEDEPPHEVLAKLHAL 940

Query: 998  VTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            +T   + +Q F +  R+ + ++   +YDHLAR  EW    D
Sbjct: 941  ITSYLSDDQGFTAR-RMVKTTDFAGDYDHLARFGEWDATTD 980


>gi|16127767|ref|NP_422331.1| hypothetical protein CC_3537 [Caulobacter crescentus CB15]
 gi|221236587|ref|YP_002519024.1| ATP-dependent nuclease subunit B [Caulobacter crescentus NA1000]
 gi|13425271|gb|AAK25499.1| hypothetical protein CC_3537 [Caulobacter crescentus CB15]
 gi|220965760|gb|ACL97116.1| ATP-dependent nuclease subunit B [Caulobacter crescentus NA1000]
          Length = 996

 Score =  353 bits (905), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 299/1052 (28%), Positives = 472/1052 (44%), Gaps = 86/1052 (8%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
             + P  ++I    PF  ++   LLN TL      +PL P  L   T+  PT+R  + L  
Sbjct: 10   REGPRWYSIPAHRPFVDDLARGLLN-TL------EPLGPEALPRATVLTPTRRGARALAD 62

Query: 63   EFIEITGKKSTILPIIKSLGDVVE-EKFTADLLLSYNLNPPVSNIQRLLELARLILIWRN 121
             F+ + G ++ +LP I+ LGD+ E E       LS  L P +S+ +R  ELARL+    +
Sbjct: 63   AFLSVGGGRALLLPQIRPLGDLDEGEPPFEPGELSLTLPPAISSRRRRFELARLVTDHGD 122

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWED-LHALKNEKYGMW 180
            KL             S    P  A+ LAK L++ +D  + EE  ++D L  L        
Sbjct: 123  KL-------------SFKPGPVQALELAKALSEFLDSCQIEEVNFDDKLDGLAEGDLAQH 169

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRA-EAEHLMKGTKGPIIIAGSTGSI 239
            W ++A FL+   + W+ RL  L        ++ L+RA EA+         ++ AGSTG+ 
Sbjct: 170  WQVSARFLRSVLRAWSTRLDTLGLIDVSERRVRLLRALEAQWRDNPPTEVLVAAGSTGTA 229

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L+  +A  P GA+VLPGLD  +    W  I           +    HPQ ++ +L
Sbjct: 230  PATADLLRVIAAAPKGAVVLPGLDEDLADTAWAKI---------KGSQGEQHPQGAMKRL 280

Query: 300  LDFLDIKREDVKR-LGNVSNEMYGRSMVISKSFLPPD-TSD-MRNTDILENKIPN---IQ 353
            LD   + R +V+  +  V +    R  +++++  P + T+D +     L  + P    + 
Sbjct: 281  LDRAGVSRAEVRAWVPEVDSRGRWRRRIVNEALRPAEATADWLSQIAALRAEAPGLDPVA 340

Query: 354  KCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINI 413
            +  +  ++I A  E E A + A+ LR +L++  + +AL+T D+ LARRV   L R+G+  
Sbjct: 341  EGLTGFSVIAARAEEEAAGACALLLREALEDPVRTAALVTPDQTLARRVMTRLQRWGVIP 400

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFK--LNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
            D SAG PL+    S+IL   L  + +  LN    +A   KHPL   G  E     A   L
Sbjct: 401  DSSAGAPLAAA-GSAILALHLARLVEEPLNPVRLLA-FAKHPLV-LGEDEVP---AAALL 454

Query: 472  ELVALRGNK-NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            E   LRG    S D++                      ++RL E    LA  L + +L  
Sbjct: 455  ERKGLRGAAPGSADVL----------------------RARLREAPDALA--LAERVLVA 490

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSK 590
                V +           + +   +  V  L+++   +      LW    G+ L +L + 
Sbjct: 491  ----VNHAAAPYGDGALAAPARAAQALVEALESLIAPDR-----LWAGNAGECLGALMAA 541

Query: 591  IIETGSCIK-ANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            +I+ G  +  A+   + DI+ RL++ ETV+        L ILG +E+RL+  D L+L GL
Sbjct: 542  LIQDGEPLPDASPQAFGDILDRLVNEETVRVGGATHPRLRILGAIEARLVRADRLVLAGL 601

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
             EGVWP+    +PFLSR M+  L L   E+ IG  AHDF  A     ++     R    P
Sbjct: 602  EEGVWPQGAPIDPFLSRPMRQRLGLPPPERRIGLTAHDFAQAASAPDVVLVHCERRGGAP 661

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             + SRWL RL  L      + L +R     DW   LD         RP P PP+E +PR 
Sbjct: 662  AVESRWLWRLKTLAAGAGLE-LPRRDDVT-DWVSALDAPGPYAPIGRPAPKPPVEDRPRK 719

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
             + + ++ L  DPYAV+AR ILKL  +    +  +   RGT  H       +   +    
Sbjct: 720  MAVTRVEALTRDPYAVWARDILKLYPLERPDEPVEARARGTAIHAAFERFAELYPDAVPA 779

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK- 888
            E     +++         +PP      + L  + +    + E + ++ + +I V    K 
Sbjct: 780  EAASAFEKLYVDALVSAGMPPTALAREKALAREAAAWVADWERQRRTQVRRIVVEAEGKL 839

Query: 889  -MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
             + I      LT  ADRI+    G   I DYKTG  P ++       PQL+L AA L  G
Sbjct: 840  ELVINGRPFTLTAKADRIEPTPDGTAHILDYKTGAAPSQKQVDTGFSPQLTLTAAILMNG 899

Query: 948  SFSQIDCRKVANLFYIRL-KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQ 1006
             F  +      +L Y+R+  ++   +     K    +++ + K+L+ L  ++    + ++
Sbjct: 900  GFPDLGRPAPGDLTYVRVTGRRPAGEEQVRAKGDGESEDAARKALEGLSSLIARYDDPDE 959

Query: 1007 PFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            P+ S +          +Y HLARV EW    D
Sbjct: 960  PYRSRVAPQFVKEHPGDYAHLARVFEWSTSGD 991


>gi|83859062|ref|ZP_00952583.1| hypothetical protein OA2633_11695 [Oceanicaulis alexandrii HTCC2633]
 gi|83852509|gb|EAP90362.1| hypothetical protein OA2633_11695 [Oceanicaulis alexandrii HTCC2633]
          Length = 1017

 Score =  346 bits (888), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 314/1066 (29%), Positives = 492/1066 (46%), Gaps = 106/1066 (9%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VFT+ P++PF  E     L   L E F     +P  L+ VT+ +PT+RA +EL  
Sbjct: 9    SPSPRVFTLPPAAPFLTE-----LARGLTEAF----PDPEALSRVTVLIPTRRAGRELAE 59

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNP-PVSNIQRLLELARLILIWRN 121
             F  ++   + +LP+I+ +GDV  ++   +      + P  VS  +R  ELA LIL    
Sbjct: 60   AFTRLS-PGAALLPMIRPIGDVDADEPPFEPGELAEIAPEAVSPARRRFELASLIL---Q 115

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            K   + + +     L+L    A  +       D+ D+    E+   +L A   E      
Sbjct: 116  KEKAVGRSMGAGGALALADDLARLL-DDLATEDVDDLGALTEEIRANLPAHMQE------ 168

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGSIP 240
              AA FL I    W ERL E+    P   +  L++A A+         P+I AGSTGSIP
Sbjct: 169  --AAMFLDIVLVAWPERLKEMQRVDPARRRSLLLKALAKRWRDNPPADPVIAAGSTGSIP 226

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            A A L+S VAN P G IVLPG    +    W  I +              HPQ ++  L+
Sbjct: 227  AAAALLSAVANLPQGCIVLPGFARDMDEEGWAAIDDG-------------HPQRAMKTLI 273

Query: 301  DFLDIKREDVKRLGNV--SNEMYGRSMVISKSFLPPD-TSD--MRNTDILENKIPNI-QK 354
            + L I+R DV+         +   R+ VI+++  P + T+D   R  D+ E    ++ + 
Sbjct: 274  ESLGIERHDVRFWPGAEEGRQDAPRARVIAEALRPAEATADWLRRVEDLKEAWGEDVFET 333

Query: 355  CFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINID 414
                +++I+A    EEA +IA+ LR +L+    +  L+T DRNL+RRV  E+ RFG+ +D
Sbjct: 334  ALEGLSVIDAPAPAEEARAIALMLRETLETPGARGILVTPDRNLSRRVITEMARFGVTVD 393

Query: 415  ISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELV 474
             SAG PLS T   + L  +L A       +A + L   PL   G     L      +E  
Sbjct: 394  DSAGQPLSDTPSGAFLIRVLQAALDPGSALAFSALATSPLFSLGEERAPLRGVLGTMERR 453

Query: 475  ALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPL 534
            ALRG +  +D   L   V D     ++      W              +++ +   ++PL
Sbjct: 454  ALRGRRPGHDWDALYEHVRDAAGDDEDRRR--RWGG------------IIEAMATALSPL 499

Query: 535  VTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL-DEHRKLPNLWFEEEGKTLSSLFSKIIE 593
               +       G+  ++ WT+  V   + +   DE      LW  + G+  + L  + +E
Sbjct: 500  SALE-------GDQPLAVWTRALVESAEALARNDEMAGADRLWATDAGENAAQLMREFME 552

Query: 594  TGSCIKANAI-EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEG 652
                +   ++ ++   +        ++P+      L ILG LE+RL   D +IL GLNEG
Sbjct: 553  EADALPPVSLHDFTRAVLETARSRLIRPRYGAHPRLQILGPLEARLAEADRVILAGLNEG 612

Query: 653  VWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIA 712
            VWP     +PFLSR M+    L   E+  G AAHDF      R +  TRS + +  PT+A
Sbjct: 613  VWPAPPKSDPFLSRGMRIAAGLSAPEERFGLAAHDFAQLACARDVTLTRSAKVDGAPTVA 672

Query: 713  SRWLQRLLVLGGTDFFDNLKKR---GQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            SRWL RL  L      +  +      Q YL +   LD T +Q   + P+P PP+EA+PR 
Sbjct: 673  SRWLWRLQTLARGALGERAQAALAPAQDYLGFANALDETAEQTMIRPPEPAPPVEARPRK 732

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNII---------TELI 820
             S ++I+  I DPY+++AR+ILKLD +    +     +RGT +H  +         TE++
Sbjct: 733  LSVTQIETWIRDPYSIFARKILKLDKLDPLDRPAGAPERGTAYHAALERWVRSLGDTEIL 792

Query: 821  KKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
             +   +    + H    + ++ F +  L   +       F +++   +  EE  +   E 
Sbjct: 793  PRDALQRL--LAHGQTALSEAGFSENALGVEM-----KRFERVAQFMVAFEEARR---ED 842

Query: 881  IFVNIPAKMAIESIG----------IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQ 930
             F   PA  A+E++G            LTG ADRIDL  SG +DI DYKTG  P  +   
Sbjct: 843  GFT--PA--ALEALGDISFDAPGGLFTLTGRADRIDLRPSGALDILDYKTGMPPSAKEVA 898

Query: 931  KLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFKIDCITNDKKKYSADELS 987
                PQL LEAA    G+F      +  +L Y+RL   +   +   +  +     A  L+
Sbjct: 899  AGFAPQLPLEAAMAARGAFEHAPSHEPGDLMYVRLSGGRVPGEPRSMVRNPDGDDAGMLA 958

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            E++L+ L++ V    + ++ + S  R+ + +N   +YDHLAR  EW
Sbjct: 959  EQALERLMKWVAAFDDPQRTYPSQPRV-KFTNKWGDYDHLARRKEW 1003


>gi|84685774|ref|ZP_01013670.1| putative Helicase/Exonuclease [Maritimibacter alkaliphilus HTCC2654]
 gi|84665867|gb|EAQ12341.1| putative Helicase/Exonuclease [Rhodobacterales bacterium HTCC2654]
          Length = 985

 Score =  346 bits (888), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 308/1060 (29%), Positives = 476/1060 (44%), Gaps = 124/1060 (11%)

Query: 3    NKKPNVFTIAPSSPFFREMIPAL---LNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQE 59
            +++P VF  AP   F   +I  L   LNG            P  +A VT++V T R    
Sbjct: 8    SERPRVFAQAPGVDFPNAVIEGLRARLNGQ----------PPEAMARVTLFVNTMR---- 53

Query: 60   LRSEFIEITGKKS-TILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILI 118
            ++   IE+  +    +LP I+ + D+ ++   ADL       P VS ++R LELA LI  
Sbjct: 54   MKRRLIELFDQGPPALLPRIRLVTDLGQDVAMADL------PPAVSPLRRRLELASLISE 107

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKY 177
              +  PD+              +P +AI+ LA +LA+++D +  E    + L  L   ++
Sbjct: 108  LLDSQPDL--------------APRHAIFPLADSLANLMDEMHGEGVPPDALEDLDVSQH 153

Query: 178  GMWWLLAADFLKIASKYWTERLVE---LNASSPVGYQIALMRAEAEHLMKGTKGPIIIAG 234
              +W  +  F+++ ++++     E   L A      +  + R  A  + +    PI++AG
Sbjct: 154  SAYWARSLAFIRLIARFFGTAGAEPPDLEARQ----RKVIERVTANWVERPPADPILVAG 209

Query: 235  STGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQY 294
            STGS  ATA LM  VA  P GA+++PG D H+P  +W  + +          T   HPQ+
Sbjct: 210  STGSRGATAMLMEAVARLPQGAVIMPGFDAHMPAHVWEKMDDA--------LTAEDHPQF 261

Query: 295  SLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIP---N 351
               +LL  L +   DV            R+  +S +  P        TD  +++ P   +
Sbjct: 262  RFRRLLSSLGLSPGDVGDWHAQDAPNPRRNAFVSLALRPAPV-----TDQWQDEGPGFAD 316

Query: 352  IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGI 411
            I     +++LIEA + REEA +IA+ LR +  +  +++ALIT DR L R+V   L R+ I
Sbjct: 317  IDAATRELSLIEAPSPREEASAIAMILRDAA-QRGREAALITPDRVLTRQVTAALDRWRI 375

Query: 412  NIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
              D SAG PL  T    +L  +     +    + + TL+KHPL   G       R    L
Sbjct: 376  TPDDSAGRPLPLTAPGRLLRHVAEMRGRRITGVDLLTLLKHPLTHTGGERNEHLRLSRDL 435

Query: 472  ELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCI 531
            EL ALR         D  SL L   A +K +     W                   ++ +
Sbjct: 436  ELQALR---RDMPFPDKASLAL--WAGEKPDRV--EW-------------------VEWL 469

Query: 532  TPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEH-------RKLPNLWFEEEGKTL 584
             PLV           +LS +    LT    Q V L E         K   LW  E G+  
Sbjct: 470  APLVA----------DLSETGTQSLTAHVEQVVSLAERLSAGPDDGKSGELWDREAGREA 519

Query: 585  SSLFSKII-ETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDT 643
              L  +++ E     +    ++ D+   +++  +V+        + I GTLE+R+   D 
Sbjct: 520  RRLVDELLREAPFGGEMTPSDFHDLFAAVLNRGSVRNPDTPYPGIKIWGTLEARVGGADL 579

Query: 644  LILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSL 703
            +IL GLNEG WP+  A +P+++R M+    L   E+ IG +AHDF+   G   ++ TRSL
Sbjct: 580  VILAGLNEGTWPERPAPDPWMNRDMRQKAGLLLPERRIGLSAHDFQQGLGAPEVVLTRSL 639

Query: 704  RENNIPTIASRWLQRLLVL------GGTDFFDNLKKRGQCYLDWTRKLDYTT---KQPHY 754
            R++   T+ SRW+ RL+ L       G D    ++ RG  +L   R+LD      K    
Sbjct: 640  RDDEAETVPSRWINRLMNLMNGMSDAGADALKAMRSRGDAWLTLARELDRPGRDHKTDPA 699

Query: 755  KRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHN 814
             RP P PP+E +P+  SF++I  LI DPYA+YA +IL+L  I    + PD   RGT  H 
Sbjct: 700  PRPSPRPPVEHRPKRLSFTQIGTLIRDPYAIYADKILRLRGIDPLHQSPDAPLRGTAVHA 759

Query: 815  IITELIKKRI-NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEK 873
                 I++R  ++   +    +  +    FE +   P   ++W     +I+  FL  E++
Sbjct: 760  AFERFIRERPKDEARSDARARLLSVAREVFEAQAPWPATRLLWLAKLERIADDFLNDEDE 819

Query: 874  IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLI 933
             Q         I  +    +    + G ADRID+L  G V I DYKTG  P  E  QK  
Sbjct: 820  RQRDATNALTEIRGEATFGTPPFTVHGTADRIDVLNFGQVAIYDYKTG-QPPSEKQQKAY 878

Query: 934  DPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKN 993
            D QL LEA   + G F  +   K A + YI L  K K   I  D+       L  ++   
Sbjct: 879  DKQLLLEALVARKGGFGDLGRMKTARVAYIGLGAKSKYVPIDVDET------LLARTQAE 932

Query: 994  LIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            L  ++    N E+ + S   +   +    ++DHLAR  EW
Sbjct: 933  LESVLADFANRERGYTSRRVVLSANRFGGDFDHLARYGEW 972


>gi|255262129|ref|ZP_05341471.1| double-strand break repair protein AddB [Thalassiobium sp. R2A62]
 gi|255104464|gb|EET47138.1| double-strand break repair protein AddB [Thalassiobium sp. R2A62]
          Length = 978

 Score =  346 bits (888), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 287/1026 (27%), Positives = 481/1026 (46%), Gaps = 96/1026 (9%)

Query: 25   LLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDV 84
            L++G L+E F  D L+      V +YV T+R  + +R E  ++   +  +LP IK + D+
Sbjct: 20   LVDG-LIERFDQDELS-----HVEVYVNTRRMQRRMR-EIFDLGPAR--LLPQIKLVTDL 70

Query: 85   VEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPAN 144
              +    D+  +      VS ++R LE++ L+    +  PDI              + ++
Sbjct: 71   ARDPVALDVPAA------VSPLRRRLEISTLVSQLVDAQPDIA-------------ARSS 111

Query: 145  AIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNA 204
               L+ +LA++++ ++ E    E + AL        W  A  F +I  +Y+ +     + 
Sbjct: 112  IFDLSDSLANLMEEMQGEGVDPETVAALDVSDQSGHWERALSFFQIVQRYFGDTYEPPDG 171

Query: 205  SSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDC 264
             +    ++ + R   +        PI++AGSTGS  AT   M+ VA  P+G +VLPG D 
Sbjct: 172  EA--RQRLVVDRLVDQWAASPPNSPIVVAGSTGSRGATFDFMTAVAQLPHGMLVLPGFDA 229

Query: 265  HIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYG-R 323
            H+P  IW  + +  T+          HPQY  A+LL  L+I    V      S   +  R
Sbjct: 230  HLPDPIWRRLKDALTS--------EDHPQYRFARLLQRLEIDPSAVDDWSVHSQRPHSDR 281

Query: 324  SMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLD 383
            + ++S S  P   +D     I   +  ++++  + + LIEA   REEA++IA+ L+ + +
Sbjct: 282  NRLVSLSLRPAPVTDQWR--IEGREFEDLREVTAPLTLIEAFTPREEALAIALRLKKAAN 339

Query: 384  ENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDF 443
             +++K+ALIT DR L R+V   L ++ I  D SAG+PL  T    +L  + + + +    
Sbjct: 340  -DRQKAALITPDRMLGRQVTAALQQWDITPDDSAGLPLQLTAPGRLLRHVASVLSRDMTS 398

Query: 444  MAIATLVKHPLAKFGFPEK--YLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKN 501
              + TL+KHPL   G P +  +L   +  LEL   R   N     D ++L          
Sbjct: 399  EILLTLLKHPLVHTGDPARGAHLLWTRE-LELYIRR---NGLPFPDAETLR--------- 445

Query: 502  NTHVPHWQSRLSEEDKELA-VLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTC 560
                  W      +D  +A    +  ++  I    ++ T +     +LS+   T+   T 
Sbjct: 446  -----QWAHARDTDDGRVAWSEWIATVISSIEDTPSHTTLEQHYLTHLSL---TEALATG 497

Query: 561  LQNVCLDEHRKLPNLWFEEEG---KTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGET 617
                   E      LW ++ G     +  +FS+ +     + A   ++ D+   ++ G T
Sbjct: 498  PNGQDTGE------LWLKDAGIEAAKICEMFSEHVAYSDAMTAG--DYADLFGSVLSGGT 549

Query: 618  VKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTA 677
            V+  ++ +  + ILGTLE+R+ + D +ILGGLN+GVWP+    +P+L+R M+    L   
Sbjct: 550  VRSSVKSNPLIRILGTLEARVNDADLVILGGLNDGVWPERPTPDPWLNRTMRDKAGLLLP 609

Query: 678  EKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL-VLG------GTDFFDN 730
            E+ IG +AHD++ A G   +  TRS+R ++  T+ SRW+ RL+ +LG      G D    
Sbjct: 610  ERRIGLSAHDYQQAIGASEVWLTRSVRSDDSETVPSRWVNRLVNLLGGLPDQYGLDALKA 669

Query: 731  LKKRGQCYLDWTRKLDY--TTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYAR 788
            +  RG  ++++ R +D   T  +P  +RP P PP+ A+P   S + IK LI DPYAVYA 
Sbjct: 670  MIARGDTWINYARAMDQPNTVTKP-AQRPSPCPPISARPVQLSVTRIKTLIRDPYAVYAE 728

Query: 789  RILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENL 848
            ++L L  +      PD   RGT  H+I    I++R  +   E    +  I  +  + +  
Sbjct: 729  KVLGLRPLNPLTPSPDAPLRGTTMHSIFERFIRERGPETLEEARTRLMTIARTVMDADTP 788

Query: 849  PPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLL 908
             P I  +W     +I+  FL  E K  S    +         I+ +G  LT  ADR+D  
Sbjct: 789  WPTIREMWMARLDRIADQFLADEAKRVSIATPVLFEKQGGTRIDHLGFTLTARADRMDQD 848

Query: 909  KSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQ-IDCRKVANLFYIRLKQ 967
             +  + I DYKTG  P KE  Q   D QL LEAA ++ G F++ +    V    YI L  
Sbjct: 849  DAQNIYIYDYKTGAAPTKEQ-QTYFDKQLLLEAAMVERGGFAEWVGTSSVVQASYIGLGS 907

Query: 968  KFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHL 1027
              K+       +    D  +       + ++T   + ++ + +  R  E+    S+YDHL
Sbjct: 908  DPKV------TRAPLEDNPTNAVWAEFVTLMTAWAHVDRGYTAR-RAMEQDRFGSDYDHL 960

Query: 1028 ARVAEW 1033
            +R  EW
Sbjct: 961  SRFGEW 966


>gi|254464697|ref|ZP_05078108.1| double-strand break repair protein AddB [Rhodobacterales bacterium
            Y4I]
 gi|206685605|gb|EDZ46087.1| double-strand break repair protein AddB [Rhodobacterales bacterium
            Y4I]
          Length = 977

 Score =  345 bits (885), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 297/1048 (28%), Positives = 474/1048 (45%), Gaps = 109/1048 (10%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP +F +   + F R ++  L +       R   L P  LA   + V T R  + +RS F
Sbjct: 8    KPRLFAVPCGADFPRALVEGLRS-------RSQGLPPEALARAELIVNTSRMARRVRSLF 60

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
               TG  + +LP +  L D+ + + T D      L P +  ++R LEL++LI     KL 
Sbjct: 61   D--TGP-AMLLPRMMLLTDLAQ-RATLD-----GLPPALPPLRRRLELSQLI----AKLL 107

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            D   DL          S A+   L+ +LA +ID ++ E    + + AL        W  A
Sbjct: 108  DAQPDL---------ASRASLYDLSDSLAALIDEMQGEGVSTDTIRALDVSDMSGHWARA 158

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATAR 244
              F+ IA ++       ++A +    Q+ L   E +   K  + P+I+AGSTGS   T  
Sbjct: 159  QAFIGIADEFTGLHEGAMDAQA-RQRQVVLNLIE-QWQDKPPQHPVILAGSTGSRGTTLM 216

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM  +A  P GA+VLPG D   P  +W  + +   +          HPQY   KL+  L+
Sbjct: 217  LMQAIARLPQGAVVLPGFDFDQPGHVWAGLDDPMIS--------EDHPQYRFHKLMKDLE 268

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCFSDVALI 362
            +   DV+   +       R+ ++S +  P   +D  M    +L      + K   ++ LI
Sbjct: 269  LTPGDVQPWTDTLPASPERNRLVSLALRPAPVTDAWMSEGPLLTG----LSKATENLTLI 324

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
            EA + R EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG PL 
Sbjct: 325  EAPSPRAEALAIALRLRQAA-EDGQTAALITPDRMLTRQVSAALDRWDILPDDSAGQPLQ 383

Query: 423  TTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNS 482
             +     L  +     K     ++ TL+KHPL   G       R    LEL +LR  +N 
Sbjct: 384  LSPPGRFLRHVAGLFCKPLACDSLLTLLKHPLTHDGADRGNHLRQTRELEL-SLR--RNG 440

Query: 483  YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSE--EDKELAVLLVDHILQCITPLVTYKTN 540
                D  +      A +K     P W   LS    D+E+A                    
Sbjct: 441  PPFPDATAFA----AFEKGRELTPGWTGWLSACFADQEIAE------------------- 477

Query: 541  KNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN-LWFEEEGKT-LSSLFSKIIETGSCI 598
                   L ++DW        + +           LW ++ G+  L+ + +   E     
Sbjct: 478  ------TLPLTDWVNRLRDLAERIAAGSQADGSGTLWDKKAGQAALACIENLETEAPYGG 531

Query: 599  KANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNT 658
               A ++ D++  L+    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP+  
Sbjct: 532  GMTARDFADLLGALLSQGEVRDRDAPYGSIMIWGTLEARVQGADLVILGGLNEGSWPEAA 591

Query: 659  AKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQR 718
            + +P+L+R +++   L   E+ IG +AHDF+ A     +  T + R     T+ SRWL R
Sbjct: 592  SPDPWLNRQLRNQAGLLLPERRIGLSAHDFQQAIAAPEVWLTHAERSEEADTVPSRWLNR 651

Query: 719  LLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYS 771
            L  L       GG    D ++ +G+ +L W   L+  T  P Y RP P PP+ A+PR  +
Sbjct: 652  LTNLLSGLPEQGGRAALDTMRSKGRRWLGWAEALEEPTPIPQYPRPSPCPPVAARPRRLT 711

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK-KRINKNTPE 830
             +EI +LI DPYA+YA+ +L+L  +    ++PD   RG + H +    IK  + + +   
Sbjct: 712  ITEIPRLIRDPYAIYAKHVLRLKPLSPLVQEPDALLRGIVVHEVFEHFIKDAQTDPSLLT 771

Query: 831  INHLM---KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA 887
              HL+   ++++++H       P   I+W     KI+  F+  E++ Q+    +      
Sbjct: 772  AGHLIGKTRELLETHVPW----PVARILWHSRIRKIAGDFVLAEQERQARARPVAFEAKG 827

Query: 888  KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
               ++ +   +   ADRID+   GF+ + DYKTG  P  E  QK  + QL +EAA  + G
Sbjct: 828  SARLDPLDFTIACRADRIDMDDRGFLHLYDYKTG-TPPSEAQQKKFEKQLLIEAAMAEEG 886

Query: 948  SFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
            +F  +   +VA   +I L  K           + +A   +E   K   E+ TL+    +P
Sbjct: 887  AFDDLGPAEVARALFIGLGSKL---------SEVAAPLQAEPPAKVWDELRTLIAAYFEP 937

Query: 1008 --FISHLRLSEKSNIQSEYDHLARVAEW 1033
                S  R+  + +I  +YDHLAR  EW
Sbjct: 938  NQGYSSRRMVHRDDIAGDYDHLARYGEW 965


>gi|83309520|ref|YP_419784.1| hypothetical protein amb0421 [Magnetospirillum magneticum AMB-1]
 gi|82944361|dbj|BAE49225.1| Inactivated superfamily I helicase [Magnetospirillum magneticum
            AMB-1]
          Length = 975

 Score =  345 bits (884), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 307/1050 (29%), Positives = 474/1050 (45%), Gaps = 101/1050 (9%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             VFTI P + F   +   LL             +PL LA + I +PT+RA + +   F+ 
Sbjct: 6    QVFTIPPGAAFVDTLAAQLLAEAGG--------DPLALADMEILLPTRRACRAMSDAFLR 57

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDI 126
            ++G +  +LP ++ LGD+ EE+         +L P VS  +R+L LARLIL         
Sbjct: 58   LSGGRPLLLPRLRPLGDMDEEELELSGADPLDLPPAVSPTERVLILARLILT----AAQA 113

Query: 127  IKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAAD 186
             K   P        SP  A+ LA  LA ++D ++ E   +  L  L  E Y   W L   
Sbjct: 114  QKGHVP--------SPDQAVRLASELAKLLDAVQVERLDFAGLAKLVPEDYADHWQLTLK 165

Query: 187  FLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGSIPATARL 245
            FL I ++ W   L E     P      +M A+ E   ++  +  +I AGSTGS PATA L
Sbjct: 166  FLTILTEAWPRILAERGTLDPEDRLNRVMAAQIEAWRVRPPRHKVIAAGSTGSRPATADL 225

Query: 246  MSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDI 305
            ++ VA  P G +VL GLD  +  A W  +                HPQY L  LL  L +
Sbjct: 226  LAAVAALPAGRVVLAGLDRAMDEASWAALD-------------PAHPQYGLKALLARLGV 272

Query: 306  KREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDM-RNTDILENKIPNIQKCFSDVALIEA 364
            +R  V+ L +  +    R  +++++  P  T +  R+   L+ ++         V  +EA
Sbjct: 273  ERHGVRPLTSDVDLRQDRVRLLAEALRPAATCEAWRDLPALDARV------LDGVWRLEA 326

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
               REEA +IA+ +R  LD     +AL+T DR LARRV  EL R+GI ID SAG PL   
Sbjct: 327  PTPREEAGAIALMMRRELDRPGHTAALVTPDRGLARRVAGELERWGIRIDDSAGRPLGLN 386

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
               + L   +  +       A+   +KHPLA  G            LE + LRG + +  
Sbjct: 387  EPGAFLRLAVEMVADEFSPHALLACLKHPLAAGGMETGAFRALVRRLERLNLRGPRPAPG 446

Query: 485  IMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNST 544
            +  L+  V DR         +  W + L    + +A  L D +          K ++ S 
Sbjct: 447  VAGLRQAVKDR--------RLSSWLADL----ETMAAPLADRL----------KADEGS- 483

Query: 545  CGNLSISDWTKLTVTCLQNVCLDEHRKLP-NLWFEEEGKTLSSLFSKIIET--------G 595
                 ++D  +  +   + +  D+    P  LW  E G+  +   + +           G
Sbjct: 484  -----LADLLRAHMEFAEWLAGDDLLPGPARLWRGEAGEAAARFAADLAAAAPALGDLAG 538

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
             C  A       +   L+    V+   +    LFI G LE+RL + D LILGGLNEG WP
Sbjct: 539  HCYPA-------LFDELMGAVAVRSAWDHHPRLFIWGPLEARLQHADLLILGGLNEGTWP 591

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
                 +P++SR MQ+   L   E+ IG +AHDF        ++ +RS R +  PT+ SRW
Sbjct: 592  APPEADPWMSRPMQAAFGLAPPERRIGLSAHDFAQGFAAPRVVLSRSSRVDGTPTVPSRW 651

Query: 716  LQRL-LVLGGTDF-FDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
            L RL  V+ G+   FD  +  GQ +LDW   LD   +    + P P PP+ A+PR  S +
Sbjct: 652  LMRLDAVMKGSGLAFD--QDAGQ-WLDWHALLDRPERWTRPEIPAPAPPVSARPRRLSVT 708

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP-EIN 832
            EI+  + DPYA+YA+ +L+L  +     DP   + G++ H  + EL  +   ++ P +  
Sbjct: 709  EIETWMRDPYAIYAKHVLRLRALDPIDADPGAAEYGSMVHEAL-ELFLEAWPRDLPGDPQ 767

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE 892
              + +I    FE +   P +   W   F  ++      E   +  + ++       + IE
Sbjct: 768  GELLRIGREVFEAKVTSPALWAFWWPRFDSVARWVAAKEVARRPGVARVHAEAGGALEIE 827

Query: 893  SIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
            +      LT  ADR+D +K G + + DYKTG  P+         PQL LEA   + G F 
Sbjct: 828  APAGPFTLTAKADRLDEMKDGTLALIDYKTGTPPRAREVAAGFAPQLPLEAVIARHGGFG 887

Query: 951  QIDCRKVANLFYIRLKQKFKIDCITNDKKKYSAD--ELSEKSLKNLIEIVTLLQNGEQPF 1008
             +   +V+ L Y +LK   +      +++    D   L+ ++L+ L  +V +  +   P+
Sbjct: 888  GVRAAEVSELLYWQLKGGAQ----GGEERAAGGDAATLAAEALEGLHALVAVFDDPATPY 943

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
             +     E +   S+Y HLARV EW    D
Sbjct: 944  AARPH-PEHAPKYSDYLHLARVREWASGGD 972


>gi|83953058|ref|ZP_00961780.1| hypothetical protein NAS141_12156 [Sulfitobacter sp. NAS-14.1]
 gi|83842026|gb|EAP81194.1| hypothetical protein NAS141_12156 [Sulfitobacter sp. NAS-14.1]
          Length = 987

 Score =  345 bits (884), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 302/1040 (29%), Positives = 469/1040 (45%), Gaps = 84/1040 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +AP   F +E++  LL+       R +      +  + + V T+R  + LR  F 
Sbjct: 8    PRVFGLAPGVDFPKELVRGLLS-------RLEGQPAHAIGRIDLVVNTRRMQRRLRDIF- 59

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLS-YNLNPPVSNIQRLLELARLILIWRNKLP 124
                   ++LP I  + ++       D L S  +L  P   ++R LEL  L+    +KL 
Sbjct: 60   --DAGPPSLLPRIHLIDNL-------DTLGSGVDLPRPGPALRRRLELITLV----SKLL 106

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            D   +L P + L           L+ +LA +ID ++ E    E +  L        W  A
Sbjct: 107  DQAPELAPRASLYD---------LSDSLAQLIDEMQGEGVPVEAVTELDVSDQSGHWERA 157

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATAR 244
              FL IA +Y  E +   +  +    Q+A  R  AE      + P+I+AGSTGS   +A 
Sbjct: 158  KQFLAIAHQYLGESVTRPDPRA-RQRQVA-QRLIAEWEQNPPRHPVIVAGSTGSRGTSAL 215

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM  VA  P GA+VLPG    +P A+W  + E    I+        HPQY    LL  L+
Sbjct: 216  LMEAVAKLPQGALVLPGFCFDMPQAVWTDLGEDQEKISQD------HPQYRFRDLLRQLE 269

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            + R  ++   +       R+ ++S S  P   + +  T+    K+P++ +    + LI+A
Sbjct: 270  MSRSKIEAWTDTPPPSAARNALVSLSLRPAPVTHVWLTE--GPKLPDLHQATEGLTLIQA 327

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
               R EA++IA+ LR ++ E+ K +ALIT DR L+R+V   L R+ I  D SAG+PL  +
Sbjct: 328  PTPRAEALAIALRLRQAV-EDGKTAALITPDRMLSRQVTSALDRWNILPDDSAGLPLHLS 386

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
                 L  + +   +  D  A+ TL+KHPL   G    +       LEL   R      D
Sbjct: 387  PPGRFLRHVGDLFLRKLDSEALLTLLKHPLTHSGGDRNFHQLNTQRLELQLRRDGLPYPD 446

Query: 485  IMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNST 544
               +  L    ++  K+   +  W           A  +  H+  C              
Sbjct: 447  AEGVLKLARKTVSRSKDPAQMDVW-----------ADWVGTHLTDC------------EL 483

Query: 545  CGNLSISDWTKLTVTCLQNVCLDEHRKLPN-LWFEEEGKTLSSLFSKIIETGS-CIKANA 602
             G+  + DW  L +     +        PN LW    G+  + + + + E      + +A
Sbjct: 484  TGDRPLEDWVALHMALADAIADGATPSQPNGLWQHHAGEEAAKVMNDLAENAPYGGEMSA 543

Query: 603  IEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
             ++ D++  L+    ++ +      + I GTLE+R+   D +ILGGLN+  WP+    +P
Sbjct: 544  ADYTDLVGALLQQGEIRDRDAPHPNVMIWGTLEARVQGADLVILGGLNDSTWPEAPPPDP 603

Query: 663  FLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVL 722
            +L+R M+    L   E+ IG +AHD++ +     +  TR++R +   T+ SRWL RL  L
Sbjct: 604  WLNRQMRLKAGLLLPERRIGLSAHDYQQSIAAPEVCLTRAIRSDEAETVPSRWLNRLGNL 663

Query: 723  -------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
                   GG   +  + KRG  +LD  R L+  T+ P   RP P PP  A+P   S +EI
Sbjct: 664  LNGLPAQGGDAAWKAMIKRGDHWLDQARALETVTRVPPAPRPSPRPPRAARPHALSVTEI 723

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            K+LI DPYA+YA+  LKL  +    + PD   RG + H I+   IK    +        +
Sbjct: 724  KRLIRDPYAIYAKHSLKLRALNPLVQSPDAPVRGIIVHEIMERFIKSVTAEPALLTKSHL 783

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE--S 893
             +   +  E E   P   ++W     +I+  F+E+E   QS          AK + E   
Sbjct: 784  LETARTVLEAEAPWPAARVMWLTKIERIADWFIENELHRQSYSTPAAFEKAAKGSHEFPD 843

Query: 894  IGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            +G  L GFADRID  + G + I DYKTG  P     QK  D QL LEAA ++ G F +I 
Sbjct: 844  LGFTLMGFADRIDRTEDGDILIYDYKTG-TPPSVAEQKAFDKQLLLEAAMVEEGGFKEIG 902

Query: 954  CRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLR 1013
               VA   YI L  K        ++     DE   + L  L  ++T   + EQ F +  R
Sbjct: 903  PAPVAQAAYIGLGSK------PVERPAPLEDEPPHEVLAKLHALITSYLSDEQGFTAR-R 955

Query: 1014 LSEKSNIQSEYDHLARVAEW 1033
            + + ++   +YD LAR  EW
Sbjct: 956  MVKTTDFAGDYDQLARFGEW 975


>gi|149912863|ref|ZP_01901397.1| hypothetical protein RAZWK3B_02705 [Roseobacter sp. AzwK-3b]
 gi|149813269|gb|EDM73095.1| hypothetical protein RAZWK3B_02705 [Roseobacter sp. AzwK-3b]
          Length = 978

 Score =  343 bits (880), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 302/1051 (28%), Positives = 479/1051 (45%), Gaps = 109/1051 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
             ++P VF +     F R    AL++G L    R+    P  LA V + V T+R  + +R+
Sbjct: 5    TERPRVFGVPLGVDFPR----ALVDGLLA---RHASQPPEALARVQVIVNTRRMARRIRA 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F +     + +LP I+ L D+ E    A      ++  PV  ++R LEL +L+    +K
Sbjct: 58   LFDQ---GPALLLPRIELLTDLGEHWDLA------HIPDPVPPLRRRLELTQLVSSLLDK 108

Query: 123  LPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALK-NEKYGMW 180
             PDI              +P ++++ LA +LA ++D +  E    + +  L   ++ G W
Sbjct: 109  QPDI--------------APRSSLYALADSLASLMDEMHGEGVSPDAIEGLDVTDQSGHW 154

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTK-----GPIIIAGS 235
              + A FL I   Y+       +  +         R   EH+++  +      PIIIAGS
Sbjct: 155  DRITA-FLGIVRHYFDVGTEHPDVET-------RQRLVIEHVIETWQETPPDHPIIIAGS 206

Query: 236  TGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYS 295
            TGS  AT  LM  V+  P GA++LPG D  +PT +W  + +   +          HPQY 
Sbjct: 207  TGSRGATQLLMQAVSKLPQGAVLLPGFDVDMPTHVWGALDDAMLS--------EDHPQYR 258

Query: 296  LAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKC 355
             A L+  L +   ++ R    S     R+ ++S +  P   +D    D     + ++ + 
Sbjct: 259  FADLMGKLGLSPGEIARWTPDSPACPARNRLLSLALRPAPVTDQWLQD--GPSLTDLDRA 316

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
              D+ L+EA + R EA++IA+ LR +  E+ + +ALIT DR + R+V   L R+GI  D 
Sbjct: 317  TQDITLLEAPSTRSEALAIAMRLRQAA-EDGQTAALITPDRTVTRQVTAALDRWGIIPDD 375

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            SAG+PL  +     L  + + +        + TL+KHPL   G       R    LEL  
Sbjct: 376  SAGMPLHLSPPGRYLRHVGDLMRDTLTAELLLTLLKHPLTHSGTDRGPHLRLTRELEL-H 434

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            LR N   Y   D  SL+    A QK+ T  P W   +S+               C     
Sbjct: 435  LRRNGPPYP--DAASLIAWGEA-QKDTTAAP-WARWISD---------------CFC--- 472

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN-LWFEEEGKTLSSLFSKIIET 594
                   +  G+L +S++ +  +     +        P+ LW  + G+      S + E 
Sbjct: 473  -----AKAVNGDLPLSEFVERHIDLANRIAQGPVDSSPHGLWRNDAGQEAWKCVSNLAEH 527

Query: 595  GS-CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
             +   +  A ++  +   ++ G  V+        + I GTLE+R+   D LIL GLNEG 
Sbjct: 528  ANHGGEITAADYGTLFHAILSGGEVRNPDAPHPQILIWGTLEARVQGADLLILAGLNEGS 587

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP+    +P+L+R +++   L   E+ IG +AHDF+ A     +  TRS+R ++  T+ S
Sbjct: 588  WPEAPKPDPWLNRALRNQAGLLLPERRIGLSAHDFQQAASAPEVWMTRSIRSDDAETVPS 647

Query: 714  RWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ 766
            RWL R+  L       GG    +++K RG  +L     L+     P  KRP P PPL A+
Sbjct: 648  RWLNRIRNLLAGLPDQGGAQALEDMKARGAHWLRLVASLEEPGYVPAEKRPSPCPPLAAR 707

Query: 767  PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK 826
            PR +S +EIK+LI DPYA+YAR +L++  +    K PD   RGT+ H ++   IK   + 
Sbjct: 708  PREFSVTEIKRLIRDPYAIYARHVLRVRPLDPLMKVPDALLRGTVLHEVLDRFIKDSQHD 767

Query: 827  NT-PEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
             T    +HLM   +      +N+P      IWR    +++  F++ E   +   +   + 
Sbjct: 768  ETLCTRDHLMA--VTESVLAQNVPWAEARAIWRARMDRVADWFIDGEFDRRQIAQPCALE 825

Query: 885  IPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAAL 944
                  ++ +G+ L   ADRID+  +G + I DYKTG  P     QK  D QL LEAA  
Sbjct: 826  QSGIATLDDLGVTLKAKADRIDIDATGSLHIYDYKTG-KPPSAKEQKYFDRQLLLEAAIA 884

Query: 945  KAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNG 1004
            +   F Q+   +VA   +I L  K +      D+         E   K  IE   L++  
Sbjct: 885  EQAGFGQLAPSQVARAQFIGLGSKPETVLAPLDE---------EPVQKVWIEFEELMRAY 935

Query: 1005 EQPFISHL--RLSEKSNIQSEYDHLARVAEW 1033
             +P   +   R   K   + +YD LAR  EW
Sbjct: 936  LEPDRGYTARRAVFKKADKGDYDQLARFGEW 966


>gi|83942009|ref|ZP_00954471.1| hypothetical protein EE36_07233 [Sulfitobacter sp. EE-36]
 gi|83847829|gb|EAP85704.1| hypothetical protein EE36_07233 [Sulfitobacter sp. EE-36]
          Length = 987

 Score =  342 bits (878), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 301/1040 (28%), Positives = 467/1040 (44%), Gaps = 84/1040 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +AP   F +E++  LL        R +      +  + + V T+R  + LR  F 
Sbjct: 8    PRVFGLAPGVDFPKELVRGLLA-------RLEGQPAHAIGRIDLVVNTRRMQRRLRDIF- 59

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLS-YNLNPPVSNIQRLLELARLILIWRNKLP 124
                   ++LP I  + ++       D L S  +L  P   ++R LEL  L+    +KL 
Sbjct: 60   --DAGPPSLLPRIHLIDNL-------DTLGSGVDLPRPGPALRRRLELITLV----SKLL 106

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            D   +L P + L           L+ +LA +ID ++ E    E +  L        W  A
Sbjct: 107  DQAPELAPRASLYD---------LSDSLAQLIDEMQGEGVPVEAVTELDVSDQSGHWERA 157

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATAR 244
              FL IA +Y  E +   +  +    Q+A  R  AE      + P+I+AGSTGS   +A 
Sbjct: 158  KQFLAIAHQYLGESVTRPDPRA-RQRQVA-QRLIAEWEQNPPRHPVIVAGSTGSRGTSAL 215

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM  VA  P GA+VLPG    +P A+W  + E    I+        HPQY    LL  L+
Sbjct: 216  LMEAVAKLPQGALVLPGFCFDMPQAVWTDLGEDQEKISQD------HPQYRFRDLLRQLE 269

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            + R  ++   +       R+ ++S S  P   + +  T+    K+P++ +    + LI+A
Sbjct: 270  MSRSKIEAWTDTPPPSAARNALVSLSLRPAPVTHVWLTE--GPKLPDLHQATEGLTLIQA 327

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
               R EA++IA+ LR ++ E+ K +ALIT DR L+R+V   L R+ I  D SAG+PL  +
Sbjct: 328  PTPRAEALAIALRLRQAV-EDGKTAALITPDRMLSRQVTSALDRWNILPDDSAGLPLHLS 386

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
                 L  + +   +  D  A+ TL+KHPL   G    +       LEL   R      D
Sbjct: 387  PPGRFLRHVGDLFLRKLDSEALLTLLKHPLTHSGGDRNFHQLNTQRLELQLRRDGLPYPD 446

Query: 485  IMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNST 544
               +  L    ++  K+   +  W           A  +  H+  C              
Sbjct: 447  AEGVLKLARKTVSRSKDPAQMDVW-----------ADWVGTHLTDC------------EL 483

Query: 545  CGNLSISDWTKLTVTCLQNVCLDEHRKLPN-LWFEEEGKTLSSLFSKIIETGS-CIKANA 602
             G+  + +W  L +     +        PN LW    G+  + + + + E      + +A
Sbjct: 484  TGDRPLEEWVALHMALADAIADGATPSQPNGLWQHHAGEEAAKVMNDLAENAPYGGEMSA 543

Query: 603  IEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
             ++ D++  L+    ++ +      + I GTLE+R+   D +ILGGLN+  WP+    +P
Sbjct: 544  ADYTDLVGALLQQGEIRDRDAPHPNVMIWGTLEARVQGADLVILGGLNDSTWPEAPPPDP 603

Query: 663  FLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVL 722
            +L+R M+    L   E+ IG +AHD++ +     +  TR++R +   T+ SRWL RL  L
Sbjct: 604  WLNRQMRLKAGLLLPERRIGLSAHDYQQSIAAPEVCLTRAIRSDEAETVPSRWLNRLGNL 663

Query: 723  -------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
                   GG   +  + KRG  +LD  R L+  T+ P   RP P PP  A+P   S +EI
Sbjct: 664  LNGLPAQGGDAAWKAMIKRGDHWLDQARALETVTRVPPAPRPSPRPPRAARPHALSVTEI 723

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            K+LI DPYA+YA+  LKL  +    + PD   RG + H I+   IK    +        +
Sbjct: 724  KRLIRDPYAIYAKHSLKLRALNPLVQSPDAPVRGIIVHEIMERFIKSVTAEPALLTKSHL 783

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK--MAIES 893
             +   +  E E   P   ++W     +I+  F+E+E   QS          AK   A   
Sbjct: 784  LETARTVLEAEAPWPAARVMWLTKIERIADWFIENELHRQSYSTPAAFEKAAKGSHAFPD 843

Query: 894  IGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            +G  L GFADRID  + G + I DYKTG  P     QK  D QL LEAA ++ G F +I 
Sbjct: 844  LGFTLMGFADRIDRTEDGDILIYDYKTG-TPPSVAEQKAFDKQLLLEAAMVEEGGFKEIG 902

Query: 954  CRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLR 1013
               VA   YI L  K        ++     DE   + L  L  ++T   + EQ F +  R
Sbjct: 903  PAPVAQAAYIGLGSK------PVERPAPLEDEPPHEVLAKLHALITSYLSDEQGFTAR-R 955

Query: 1014 LSEKSNIQSEYDHLARVAEW 1033
            + + ++   +YD LAR  EW
Sbjct: 956  MVKTTDFAGDYDQLARFGEW 975


>gi|99082685|ref|YP_614839.1| hypothetical protein TM1040_2845 [Ruegeria sp. TM1040]
 gi|99038965|gb|ABF65577.1| hypothetical protein TM1040_2845 [Ruegeria sp. TM1040]
          Length = 977

 Score =  342 bits (876), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 301/1056 (28%), Positives = 476/1056 (45%), Gaps = 115/1056 (10%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP +F +     F R    AL +G      R+    P  LA V + + T+R  + +R  F
Sbjct: 8    KPRLFAVPCGVDFPR----ALYDGLTA---RFADALPEELARVELILNTERMQRRVRQLF 60

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
                   + +LP I  L  + +E   A+L     L P +  ++R LEL++LI     KL 
Sbjct: 61   ---DAGPARLLPRISLLSGLNKE---ANL---RGLPPALPPLRRRLELSQLI----AKLL 107

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            D   DL   + L           L+ +LA++ID +++E    + + AL        W  A
Sbjct: 108  DAQPDLAARASLYD---------LSDSLAELIDEMQSEGVSTDQIRALDVSDMSGHWKRA 158

Query: 185  ADFLKIASKY--WTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPAT 242
             DF+ IA ++    E  +++NA      +  +M   AE        PII+AGSTGS   T
Sbjct: 159  QDFIGIADQFVDMHEGALDVNARQ----RQVVMDLIAEWEQTPPTHPIILAGSTGSRGTT 214

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDF 302
              LM  +A  P GA+VLPG D   P  +W ++T+              HPQY   KL+  
Sbjct: 215  LLLMEAIARLPQGAVVLPGFDFDQPEPVWESLTD--------GLVAEDHPQYRFHKLMRD 266

Query: 303  LDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALI 362
            LD++  D+ R  + + +   R+ +IS +  P   +D   ++     + ++ +    + L+
Sbjct: 267  LDLRPSDICRWVDTTPQSPARNRLISLALRPAPVTDAWMSE--GPYLKDLDQATEALTLV 324

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
            EA N R EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG+PL 
Sbjct: 325  EAANPRSEALAIALRLRQAA-EDGQTAALITPDRMLTRQVSAALDRWDILPDDSAGLPLQ 383

Query: 423  TTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG---- 478
             +     L  + +   +      + TL+KHPL   G        A+  L L+  R     
Sbjct: 384  LSPPGRFLRHVADLFCRPLQADMLLTLLKHPLTHSG--------AERGLHLLHTRDLELH 435

Query: 479  -NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTY 537
              +N     D +SL     A        P W   L++                       
Sbjct: 436  MRRNGPPFPDCESLS----AFGSTRDLQPGWSDWLAQ----------------------- 468

Query: 538  KTNKNSTCGNLSISDW-TKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETG 595
                    G  ++SDW + L  T        +      LW ++ G     +  ++  ++ 
Sbjct: 469  SFAGRDRTGTRALSDWVSDLRETAEGIAAGSQVGGTGELWDKKAGNAARDVLEELQAQSP 528

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
                  A ++ D++  L+    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP
Sbjct: 529  HGGDMTARDFADLLGALLSQGEVRDRDAPYGSIMIWGTLEARVQGADLVILGGLNEGSWP 588

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
            +    +P+L+R ++ +  L   E+ IG +AHDF+ A     +  TR++R     T+ SRW
Sbjct: 589  EAARPDPWLNRKLRHEAGLLLPERRIGLSAHDFQQAVAAPEVWLTRAVRSEEADTVPSRW 648

Query: 716  LQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
            L R+  L       GG      ++ RGQ +LDW   LD     P   RP P PP+ A+PR
Sbjct: 649  LNRMTNLLGGLPDQGGQAALSAMRMRGQVWLDWASVLDAPVPTPLSPRPSPRPPVAARPR 708

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
              + +EI +LI DPYA+YA+ +L+L  +    ++PD   RGT+ H ++ + IK    +  
Sbjct: 709  RLTVTEIPKLIRDPYAIYAKHVLRLKPVDPLLQEPDALLRGTIIHKVLEDFIKS--AQEQ 766

Query: 829  PEINHLMKQIIDSH---FEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNI 885
            PE N   +  ID      E E   P    +W     K++  F+  E + QS         
Sbjct: 767  PE-NLSARHFIDHARRVLETEVPWPVARTLWLTRLKKVAEDFVTGERQRQSRARPSGFEK 825

Query: 886  PAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
              ++ ++ +   +   ADRID+ + G + + DYKTGD P  E  QK  + QL +E A  +
Sbjct: 826  SGQVRLDPLDFEIAAKADRIDVDERGLLHLYDYKTGD-PPSEKQQKSFEKQLLIETAMAE 884

Query: 946  AGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQ--- 1002
             G+FS     +V    YI LK            K+ +A  L E   K   E+ +L++   
Sbjct: 885  QGAFSDYGAARVERALYIGLKPPV---------KEVAAPILDEPPAKVWAELRSLVEAYF 935

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            + EQ F S  R+  + +   +YDHLAR  EW    D
Sbjct: 936  DAEQGFSSR-RMVHRDDFAGDYDHLARYGEWDRSSD 970


>gi|84501213|ref|ZP_00999418.1| hypothetical protein OB2597_12648 [Oceanicola batsensis HTCC2597]
 gi|84390504|gb|EAQ02992.1| hypothetical protein OB2597_12648 [Oceanicola batsensis HTCC2597]
          Length = 976

 Score =  342 bits (876), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 305/1053 (28%), Positives = 479/1053 (45%), Gaps = 115/1053 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            + KP +F + P + F R ++  LL        R D L P  L  VT+ V T+R  + +R+
Sbjct: 5    SDKPRLFGLPPGADFPRHLVEGLLE-------RTDGLPPEALGRVTLIVNTRRMARRIRT 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F       + +LP I+ + D+       D +   ++ PPVS ++R LEL  L+    ++
Sbjct: 58   LF---DAGPARLLPRIRLVTDL------GDNMELAHIAPPVSPLRRRLELVPLVRALIDR 108

Query: 123  LPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
             PD+              +P  A++ LA +LA + + +  E   +E + AL    +   W
Sbjct: 109  EPDL--------------APRAALYDLADSLAGVFEEMRGEAVSFEAIRALDVSAHSDHW 154

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-----MKGTKGPIIIAGST 236
              A  FL I  +      VE   + P     A MR  A+HL         + P+I+AGST
Sbjct: 155  ARALKFLTIVEQ------VEDEGALP--DPAARMRLVADHLTDLWRAAPPQDPVIVAGST 206

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSL 296
            GS  AT  LM  VA  P GA+VLPG D  +P A+W+       N    + T   HPQ+  
Sbjct: 207  GSRGATNVLMQAVARLPQGAVVLPGFDFDLPPAVWD-------NNLDDSLTGEDHPQFRY 259

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
             +L+  LD +  DV RL   S +   R+ ++S +  P   +D    +     +  + +  
Sbjct: 260  RRLMRSLDRRPGDV-RLWRESEQNDDRNRLVSLALRPAPVTDQWLAE--GPTLTGLDRAM 316

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
              V LIEA + R+EA +IA+ LR +  E+ + SALIT DR L+R+V   L R+ I  D S
Sbjct: 317  ETVTLIEAPSGRDEAQAIALRLRKAA-EDGQNSALITPDRLLSRQVTAALGRWDILPDDS 375

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            AG PL  T     L  +       +    +  L+KHPL   G       R    LE   L
Sbjct: 376  AGEPLHLTPPGRFLRQVAELSHATHGAAGLLALLKHPLCHTGSDRGPHLRLTRGLE-TEL 434

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
            R N   +   D     + R A ++++     W   ++++    A   +  +   I  LV 
Sbjct: 435  RRNGPPFPDGD----TIRRFAAKQDSEIADAWAEWVADQAFGPAQDALPRLSDRIAALVA 490

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGS 596
                 +  CG                            LW    G+ + +   ++   G+
Sbjct: 491  RAEALSRGCGAGGAG----------------------TLWAGNAGQDVRAKLDEL--AGA 526

Query: 597  CIKANAI---EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGV 653
               A  I   ++ +++T ++ G   +        + I GT ++R+   D +ILGGLNEG 
Sbjct: 527  ADAAGEIGAEDFTNLLTSILRGAEERDSKTPHPHILIWGTRDARVQGADLVILGGLNEGT 586

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIAS 713
            WP+  A +P+L+R M++++ L   E+ IG +AHDF+ A G   +  TR+LR     T+AS
Sbjct: 587  WPEVPAPDPWLNRAMRAEVGLLLPERRIGLSAHDFQQAIGAPEVWLTRALRGPEAETVAS 646

Query: 714  RWLQRLLVL------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP 767
            RWL RL  L      GG    +  + RG  +L    +L+         RP P PP+EA+P
Sbjct: 647  RWLNRLTNLLNGLGPGGRSALEGARARGAHWLGMASQLEQVDPVDPAPRPAPAPPVEARP 706

Query: 768  RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK------ 821
            R  S ++IK LI DPYA+YAR +L+L  +    K+PD   RGT+ H ++   ++      
Sbjct: 707  RRLSVTQIKTLIRDPYAIYAREVLRLRPLDPLMKEPDALQRGTVLHEVMEHFVRAATADP 766

Query: 822  KRINKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
            +R++ +  E+  L ++++      +N+P     ++W     +I+ + +  E    +    
Sbjct: 767  ERLSAD--ELLALTRRVL-----ADNVPWAEARLLWLARMTRIAEAVVTGEAGRLAQGRP 819

Query: 881  IFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLE 940
                +P +  +   G  LT  ADRIDL  +G   I DYKTG        Q   D QL LE
Sbjct: 820  ARFEVPGRATLPGPGFDLTAKADRIDLDPAGNALIYDYKTGQMSSARQ-QMSFDLQLLLE 878

Query: 941  AAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTL 1000
            AA  + G F  I  R V    ++ L      D +    +   AD++  +    LIE    
Sbjct: 879  AAMAERGGFEGIRPRHVLRAAFVGLGS--NTDEVDAPLEDLPADQVWAR-FTTLIE--RY 933

Query: 1001 LQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            L  G QPF +  R   K+++  +YDHLAR  EW
Sbjct: 934  LDAG-QPFTAR-RAMFKADMPGDYDHLARFGEW 964


>gi|221641018|ref|YP_002527280.1| RecB family exonuclease-like protein [Rhodobacter sphaeroides KD131]
 gi|221161799|gb|ACM02779.1| RecB family exonuclease-like protein [Rhodobacter sphaeroides KD131]
          Length = 982

 Score =  338 bits (867), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 284/1006 (28%), Positives = 440/1006 (43%), Gaps = 93/1006 (9%)

Query: 41   PLLLASVTIYVPTKRAIQELRSEFIEI-TGKKSTILPIIKSLGDVVEEKFTADLLLSYNL 99
            P  +A V +YV T+R    +R    E+ T + +  LP I+            +L     L
Sbjct: 20   PEAMARVELYVNTQR----MRRRITELMTAEGAGFLPRIR---------LVTELPPVPGL 66

Query: 100  NPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDI 158
              PV  ++R LELA+L+       PDI              +P +A++ L+ +LA++ID 
Sbjct: 67   PAPVPPLRRRLELAQLVARLIEAQPDI--------------APRSALFDLSDSLAELIDE 112

Query: 159  IETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAE 218
            ++ E    E +  L    +   W     F+ I +  +     +  A +    ++A+ R  
Sbjct: 113  MQGEGVPPEAIARLDVADHSAHWQRTQAFMAIVAPMFGADAPDAQALA----RMAVERIA 168

Query: 219  AEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKS 278
            A         P+I+AGSTGS   T+  M  VA  P GA+VLPG D  +P A+W  + +  
Sbjct: 169  ARWAEAPPDHPVIVAGSTGSRGTTSLFMQAVARLPQGALVLPGFDFDLPAAVWEGMDDA- 227

Query: 279  TNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD 338
                    T   HPQ+   +L+  +     +V R  +       R+ +IS S  P   +D
Sbjct: 228  -------LTAEDHPQFRFHRLMGLVGAGPAEVGRWTDEIPPSPDRNRLISLSLRPAPVTD 280

Query: 339  MRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNL 398
               T+     +  + +    + LIEA   R EA+++A+ LR + +E ++ +ALIT+DR L
Sbjct: 281  QWLTE--GRHLTGLAEAARGMTLIEAPGPRAEALAVAMILRKAAEEGRR-AALITSDRGL 337

Query: 399  ARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFG 458
             R+V   L R+GI  D SAG PL+ +     L  +     +     A+ TL+KHPL   G
Sbjct: 338  TRQVAAALDRWGIVPDDSAGKPLALSAPGRFLRHVARLFGRRLTGEALLTLLKHPLTATG 397

Query: 459  FPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEE-DK 517
                   R    LEL   R         DL      R A    +     W   L E  D 
Sbjct: 398  ADRGNHLRWTRDLELHLRRKGPPFPAAADLALWAGPRPADGVADWA--RWLGGLIEGLDA 455

Query: 518  ELAVLLVDHILQCITPLVTYKTNK-NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLW 576
                 L DH+   +            +T G L    W K      +    +  R+ P+  
Sbjct: 456  AGPRPLADHVAAHLALAEALAAGPAGTTTGEL----WLKEAGEAARAAVEELRREAPH-- 509

Query: 577  FEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLES 636
                              G    A+  +  D I  L  GE V+  ++    L I GTLE+
Sbjct: 510  -----------------GGELTPADYADLFDAI--LARGE-VREAVQARPDLMIWGTLEA 549

Query: 637  RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRH 696
            R+   D +ILGGLN+G WP+    +P+L+R M+    L   E+ IG +AHD+  A     
Sbjct: 550  RVQGADLVILGGLNDGTWPQLPPPDPWLNRQMRLKAGLLLPERRIGLSAHDYSQAVAAPE 609

Query: 697  LIYTRSLRENNIPTIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDY-T 748
            ++ TR+ R+    T+ SRWL RL+ L       GG +    ++ RG+ +LD    L+   
Sbjct: 610  VVLTRATRDAEAETVPSRWLNRLMNLMSGLKAGGGPEALAGMRARGRDWLDLAAALEQPA 669

Query: 749  TKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR 808
            T  P   RP P PP+ A+P   + + I+ LI DPYAVYAR IL+L  +    + PD   R
Sbjct: 670  TPVPLATRPAPQPPVPARPERLAVTGIRTLIRDPYAVYARHILRLYPLDPLHRAPDARLR 729

Query: 809  GTLFHNIITELIKKRI-NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSF 867
            G++ H I+   +K R    + P     + +I ++   +E   P    +W     + +  F
Sbjct: 730  GSILHRILEAFVKDRAPGGDRPAERARLMRIAEAVLAEEVPWPAARALWLARLDRAADFF 789

Query: 868  LEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKE 927
            LE E     +   + +    ++ +  +   LT   DRID+L  G + I DYKTG  P K+
Sbjct: 790  LETEAAHAGT--PVVLEEEGRVDLTPLRFTLTAKPDRIDVLPDGRLHILDYKTGTPPTKK 847

Query: 928  TAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELS 987
              Q+  D QL LEAA  + G F  +   +VA + YI L    K++ +  D        L 
Sbjct: 848  Q-QEQFDKQLLLEAAMAERGGFRGLGPAEVARISYIGLGTSLKVESVETDAA------LL 900

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             +  + L  ++      EQ ++S  R         +YDHLAR  EW
Sbjct: 901  GQVWEGLHALIGRYMRREQGYVSR-RAMFGERFPGDYDHLARFGEW 945


>gi|114568639|ref|YP_755319.1| hypothetical protein Mmar10_0085 [Maricaulis maris MCS10]
 gi|114339101|gb|ABI64381.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 1016

 Score =  338 bits (866), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 303/1072 (28%), Positives = 479/1072 (44%), Gaps = 116/1072 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
               P ++TI P + F R     +L  TL E F     +P  L  + I  PT+RA + L  
Sbjct: 8    TSGPCLYTIPPQADFLR-----VLATTLREEFDA-AGDPDALTRLLILTPTRRAAKALGD 61

Query: 63   EFIEITGKKSTILPIIKSLGDV-VEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRN 121
             F E+ G    +LP+I+ +GDV V++       L+    P +S  +R  ELARLIL    
Sbjct: 62   VFAELAGNGVALLPLIRPIGDVDVDDPPFEPGELAGLAAPAISIERRRYELARLILA--- 118

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
                       E+ L  P+    A+ L+ +LA ++D + TE     D+  L + +  +  
Sbjct: 119  ----------KEAALGRPLGVGGALALSDSLAALLDDLATE-----DVSDLSDLQDAVTT 163

Query: 182  LLAAD------FLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGP----II 231
             L AD      F+ I  + W  RL EL  +     +  ++    E + + TK P    ++
Sbjct: 164  YLPADRREAVEFIDIVQRVWPARLAELGLTDAAARRSLILH---ELVARWTKQPPDHPVL 220

Query: 232  IAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTH 291
              GSTGSIPA  +LM  +AN P GA+VLPG D     + W++I +              H
Sbjct: 221  AVGSTGSIPAARKLMKVIANLPQGAVVLPGFDWDADASAWDSIKDD-------------H 267

Query: 292  PQYSLAKLLDFLDIKREDVKRLGNVSNEMYG--RSMVISKSFLPPDTSDMRNTDILENKI 349
            PQ+++  L+D L + R  +      + +     R  +I+++  P DT     TD    +I
Sbjct: 268  PQWAMKTLVDELGVDRLQMPSWPGAAEDSLAERRRRLIAEALRPADT-----TDEWLKRI 322

Query: 350  PNIQKCFSD---------VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLAR 400
              +Q  F D         ++L+E  +E  EA + A+ LR  L+   + + L+T DR LAR
Sbjct: 323  GELQGRFGDSFFNDGMTGLSLVETADEISEARACALMLREVLETPDRTAILVTPDRMLAR 382

Query: 401  RVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFP 460
            RV  E+TRFG+ +D S G  L+ T+  + LT LL+        +A+  L   PL + G  
Sbjct: 383  RVSAEMTRFGVRLDDSGGAALAETMAGAFLTRLLDVALDCGRVVALTALWGSPLFRAGHR 442

Query: 461  EKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELA 520
                       E  ALRG +   D+  +++ +        +  +V     RL +ED+   
Sbjct: 443  RGQTHTVLAKFEAEALRGARPGRDLAAVRARL--------DGQYV-----RLFDEDRATI 489

Query: 521  VLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEE 580
              ++D +   +  L+T      S                       D       +W  E 
Sbjct: 490  NAILDQLDTSLAGLLTPGKRSASAWA-------RAHAEAAEALASDDSGSGAQAVWVGEG 542

Query: 581  GKTLSSLFSKIIETGSCIKANAI-EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLL 639
            G+  + L   ++E    +   ++ E+      +     V P++     L +LG LE+RL+
Sbjct: 543  GEAAAGLLRSLLEESESLPDMSLPEYAAAFGEMCRSRRVAPRLGVHPRLQVLGPLEARLI 602

Query: 640  NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIY 699
              D +IL GLNEGVWP     +P+LS  M+  + L   E+  G AAHDF        +I 
Sbjct: 603  TADRVILAGLNEGVWPPGPGADPWLSPGMRRTVGLGAPERRYGLAAHDFAQLAAAPDVIM 662

Query: 700  TRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDW---TRKL-DYTTKQPHYK 755
            TRS +    PT+ASRWL RL  L         +       D+   +R+L D         
Sbjct: 663  TRSGKSEGSPTVASRWLWRLKTLARGALGAAAEAAFAPETDYAALSRRLDDPGAPPRAAP 722

Query: 756  RPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNI 815
            RP+P PP+  +PR  S +EI+  + DPY++YAR +L L  +      PD  +RG+  H+ 
Sbjct: 723  RPQPAPPVPVRPRQMSITEIRTWVRDPYSIYARHVLGLRRLDPADMPPDARERGSALHDA 782

Query: 816  ITELIKKRINKNTPEINHLMKQIIDSHFE----KENLPPHIDIIWRHLFHKISHSFLEHE 871
            + E +    +   PE    +KQ++ +H E    +    P   ++ R  F + +   +  E
Sbjct: 783  L-EAVVPAWSDGIPE--DAVKQLV-AHAELKLAEAGFGPEEMVLERARFERAASWLVGWE 838

Query: 872  -EKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928
             E+    I    V I   M  E       LTG +DR D    G +DI DYKTG +   ++
Sbjct: 839  AERRARGIHLDKVEIFGSMPFEGPAGPWTLTGRSDRFDRHPDGRLDIIDYKTGGSASAKS 898

Query: 929  AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL------KQKFKIDCITN-DKKKY 981
             +   DPQL L AA   AG+F  ++  + A L+YI L       ++ +ID   N D   Y
Sbjct: 899  IKAGFDPQLPLTAAMAAAGAFEALEAGEAAGLYYISLPGNAGGGKEVRIDGGRNPDVASY 958

Query: 982  SADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                  E +L +L   +    +   P+ S +R ++ +N   ++DHLAR  EW
Sbjct: 959  -----VEGALTDLTGWIARFDDETTPYESQIR-AQYTNDYGDFDHLARRGEW 1004


>gi|126738528|ref|ZP_01754233.1| hypothetical protein RSK20926_08687 [Roseobacter sp. SK209-2-6]
 gi|126720327|gb|EBA17033.1| hypothetical protein RSK20926_08687 [Roseobacter sp. SK209-2-6]
          Length = 982

 Score =  337 bits (865), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 296/1051 (28%), Positives = 477/1051 (45%), Gaps = 110/1051 (10%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP VF +    P   +   AL +G +  N ++ P N   LA V + + T R  +  R+ F
Sbjct: 8    KPRVFAL----PLGVDFPKALASGLIQRNAKHSPEN---LARVELILNTARMARRTRNLF 60

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
                   + +LP ++ L  +VE    ADL       P +  ++R LEL++LI     KL 
Sbjct: 61   ---EAGPALLLPRMRLLSSLVETGVIADL------PPALPPLRRRLELSQLI----AKLL 107

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            +   DL   S L           L+ +LA +ID +++E    E +  L        W  A
Sbjct: 108  ETQPDLAARSSL---------FDLSDSLAGLIDEMQSEGVNTEAIRNLDVSDMSGHWARA 158

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-----TKGPIIIAGSTGSI 239
              F+ I  ++     ++L+  + V  Q A  R    HL++       + PI++AGSTGS 
Sbjct: 159  QQFIGIVDQF-----IDLHEGA-VDAQ-ARQRQLVHHLIESWEISPPQHPILLAGSTGSR 211

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
              T  LM  +A  P GA++LPG D   P  +W+ + +  ++          HPQY  AKL
Sbjct: 212  GTTHILMEAIAKLPQGAVILPGYDFDQPLTVWSHLRDALSS--------EDHPQYRFAKL 263

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN-KIPNIQKCFSD 358
            +  LD+  ED++     +     R+ ++S +  P   + + N  + E  ++ ++    + 
Sbjct: 264  ISDLDLDPEDIRPWTKTAPVSPARNRLVSLALRP---APVTNAWMQEGPELQDLDSACAQ 320

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
            + L+EA + R EA++IA+ LR +  E+ + +ALI+ DR L R+V   L R+ I  D SAG
Sbjct: 321  ITLVEAPSPRAEALAIALRLRQAA-EDGQTAALISPDRMLTRQVSAALDRWDILPDDSAG 379

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            +PL  T     L  +     K     A+ TL+KHPL   G P               L  
Sbjct: 380  LPLQLTPPGRFLRHVAELFCKPLTSDALLTLLKHPLTHDG-PNAERGEHLRHTRDFELNI 438

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
             +N     D  S    + AT ++   +P W   L+  D   A  + D   Q +T  V   
Sbjct: 439  RRNGPPFPDADSFY--QFATGRD--LLPGWVDWLA--DNFAAQEVSDR--QALTNWVALL 490

Query: 539  TNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSC 597
              +       S            QN+   E   L   W ++ G+T  +LF  +  +    
Sbjct: 491  RQRAEAIAAGS------------QNLAAGETGPL---WEKKAGQTALALFEDLEAQALHG 535

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
             + +A ++ D++  ++    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP+ 
Sbjct: 536  GEMSARDFADLLGAILSQGEVRDRDAPYGSIMIWGTLEARVQGADLVILGGLNEGSWPEA 595

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
               +P+L+R ++    L   E+ IG AAHDF+ A     +  TR+ R +   T+ SRWL 
Sbjct: 596  AKPDPWLNRQLRHQAGLLLPERRIGLAAHDFQQAIAAPEVWLTRAARTDEADTVPSRWLN 655

Query: 718  RLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            RL  L       GG      +  RGQ +LDW   L+        KRP P PP+ ++PR  
Sbjct: 656  RLTNLLAGLPDQGGKAALTGMLDRGQVWLDWAEALEAPAPADPAKRPSPQPPVPSRPRRL 715

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            + +EI +LI DPYA+YA+ +L+L  +    ++PD   RG + H +  + IK     N   
Sbjct: 716  TITEIPRLIRDPYAIYAKHVLRLRPLDPLVQEPDALLRGIVVHEVFEKFIKT-CQDNPEG 774

Query: 831  INHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +       +     +E++P P   ++W     K++  F+  E++ Q+    +      + 
Sbjct: 775  LTAANLTAMADELLQEHVPWPVARLLWHSRIEKLAEDFVTGEKERQNRARPVAFEAKGEA 834

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             +E +   +   ADRID  + GF+ + DYKTG  P  E  QK  + QL +EAA  + G+F
Sbjct: 835  RLEPLDFTIACRADRIDQDERGFLHLYDYKTG-APPSEAQQKKFEKQLLIEAAMAEEGAF 893

Query: 950  SQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSE-------KSLKNLIEIVTLLQ 1002
              +    VA+  ++ +              K  A  LSE       + LK LIE      
Sbjct: 894  KDLGPADVASAAFLGIGSSL----------KEVAAPLSEEPPAKIWEELKKLIEAYFDPN 943

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             G     S  R+  + ++  +YDHLAR  EW
Sbjct: 944  QG----YSSRRMVHRDDLAGDYDHLARFGEW 970


>gi|146278984|ref|YP_001169143.1| exonuclease-like protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557225|gb|ABP71838.1| RecB family exonuclease-like protein [Rhodobacter sphaeroides ATCC
            17025]
          Length = 1000

 Score =  337 bits (864), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 297/1054 (28%), Positives = 449/1054 (42%), Gaps = 120/1054 (11%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
               P +F + P   F     PA L   L       P  P  +A V +YV T+R    +R 
Sbjct: 10   GPGPRLFGLPPGVDF-----PAALVRGLRARMAGAP--PEAMARVELYVNTQR----MRR 58

Query: 63   EFIEI-TGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRN 121
              +E+ T + +  LP I+            +L     L  PV  ++R LELA+L+     
Sbjct: 59   RVVELMTAEGAGFLPRIR---------LVTELPPVPGLPAPVPPLRRRLELAQLVARLIE 109

Query: 122  KLPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              PDI              +P +A++ L+ +LAD+ID ++ E    E +  L    +   
Sbjct: 110  AQPDI--------------APRSALFDLSDSLADLIDEMQGEGVPPEAIARLDVADHSAH 155

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAE---AEHLMKGTKGPIIIAGSTG 237
            W     F+ I +           A +P    +A M  E   A         P+I+AGSTG
Sbjct: 156  WQRTQAFMAIVAPM-------FGADAPDAQALARMTVERIAARWAEAPPDHPVIVAGSTG 208

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            S   TA  M  VA  P GA+VLPG D  +P  +W+ + +          T   HPQ+   
Sbjct: 209  SRGTTALFMQAVARLPQGALVLPGFDFDLPAEVWDGLGDA--------LTAEDHPQFRFH 260

Query: 298  KLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFS 357
            +L+  +      V R  +       R+ +IS S  P   +D   T+    ++ ++     
Sbjct: 261  RLMGLVGAAPSQVHRWTDEDPPSPARNRLISLSLRPAPVTDQWLTE--GQRLTDLALAAE 318

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
             +ALIEA   R EA+++AI LR +  E+ +++ALIT+DR L R+V   L R+GI  D SA
Sbjct: 319  GMALIEAAGPRAEALAVAIILRKAA-EDGRRAALITSDRGLTRQVAAALDRWGIVPDDSA 377

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G PL+ +     L  +     +     A+ TL+KHPL   G       R    LEL   R
Sbjct: 378  GRPLALSAPGRFLRHVARLFGQRLTGEALLTLLKHPLTATGSDRGNHLRWTRDLELHLRR 437

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVL----LVDHILQCITP 533
                     DL     D  A  + +  V  W   L    + L  +    L DH+   +  
Sbjct: 438  KGPPFPTGGDL-----DLWAGARPDDGVADWARWLGGLIEGLDAVGNRPLSDHVAAHLAL 492

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT----LSSLFS 589
                      T                              LW +E G+     +  L  
Sbjct: 493  AEALAAGPAGTGTG--------------------------ELWLKEAGEAARAAVEELRR 526

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            +    G    A+  +  D I  L  GE V+  ++    L I GTLE+R+   D +ILGGL
Sbjct: 527  EAPHGGELTTADYTDLFDAI--LARGE-VREAVQAHPGLMIWGTLEARVQGADLVILGGL 583

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            N+G WP+    +P+L+R M+    L   E+ IG +AHD+  A     ++ TR+ R     
Sbjct: 584  NDGTWPQLPPPDPWLNRQMRLRAGLLLPERRIGLSAHDYSQAVAAPEVVLTRATRNAEAE 643

Query: 710  TIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQ-PHYKRPKPFP 761
            T+ SRWL RL+ L       GG +  + ++ RG+ +L     L+      P   RP P P
Sbjct: 644  TVPSRWLNRLMNLMSGLKAQGGPEALEAMRARGRGWLALASALEQPEAPVPLAARPAPQP 703

Query: 762  PLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK 821
            P+ A+P   + + I+ LI DPYA+YAR IL+L  +    + PD   RG++ H I+ E +K
Sbjct: 704  PVSARPDRLAVTGIRTLIRDPYAIYARHILRLYPLDPLHRAPDARLRGSILHRILEEFVK 763

Query: 822  KRI--NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
             R        E   LM+ I ++    E   P    +W     + +  FLE E     +  
Sbjct: 764  DRAPGTDRAAERARLMR-IAETVLTDEVPWPAARALWLARLDRAADFFLETEAAHGGT-- 820

Query: 880  KIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
             + +    ++ +  +   LT   DRID L  G + I DYKTG  P ++  Q+  D QL L
Sbjct: 821  PVVLEEEGRVDLAPLRFTLTAKPDRIDRLPDGRLHILDYKTGTPPTRKQ-QEQFDKQLLL 879

Query: 940  EAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVT 999
            EAA  + G F ++    VA + YI L    K++ +  D        L  +  + L  +V 
Sbjct: 880  EAAMAEHGGFRKLGPTDVARISYIGLGSSPKVESVETDAA------LLGQVWEGLHALVG 933

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                 EQ ++S  R         +YDHLAR  EW
Sbjct: 934  RYLRREQGYVSR-RAMFGERFPGDYDHLARFGEW 966


>gi|260575781|ref|ZP_05843777.1| double-strand break repair protein AddB [Rhodobacter sp. SW2]
 gi|259021934|gb|EEW25234.1| double-strand break repair protein AddB [Rhodobacter sp. SW2]
          Length = 979

 Score =  337 bits (863), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 293/1052 (27%), Positives = 470/1052 (44%), Gaps = 113/1052 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P VF +AP   F     PA L   L +  +  P  P  +A V +YV T R  + +  
Sbjct: 8    DPGPRVFAMAPGVDF-----PAQLVAGLRQRLQGQP--PEAMARVQLYVNTTRMARRITG 60

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F   T   +  LP I  + D+ +    A +  +    PP   ++R L+L +L+     +
Sbjct: 61   LF---TATGAGFLPHIGLVTDLSQHVALAGIPAAI---PP---LRRRLQLTQLV----AR 107

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            L D   DL P + L           L+ +LA ++D ++ E    E + AL    +   W 
Sbjct: 108  LLDAQPDLAPRAALYD---------LSDSLATLLDEMQGEGVSPETIAALDVSDHSAHWQ 158

Query: 183  LAADFLKIASKYWTERLVELNASSP---VGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
                F+ I   ++       + S P      ++ +    AE       GP+I+AGSTGS 
Sbjct: 159  RTQKFMAIVLPFFA------STSRPDAETRQRLVVQALAAEWQKNPPPGPVIVAGSTGSR 212

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
              TA  M  VA  P GA+VLPG D  +P A+W  + +  T           HPQY   +L
Sbjct: 213  GTTALFMQAVARLPQGALVLPGFDFDMPAAVWQGLGDALTG--------EDHPQYRFHRL 264

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENK-IPNIQKCFSD 358
            L  LD+   DV+    V+     R+ +IS S  P   +D     ++E K + ++ +  + 
Sbjct: 265  LSGLDLSPTDVQPWTAVNAPSPARNRLISLSLRPAPVTDQW---LIEGKRLHDLAQATAA 321

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
            + LI A   R EA++IA+ LR +  E  K +AL++ DR L R+V   L R+GI  D SAG
Sbjct: 322  MTLIAAPTPRAEALAIALILRQAA-EQGKVAALVSPDRGLTRQVTAALDRWGILPDDSAG 380

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
             PL+ +    +L  +     +     A+ TL+KHPL   G       R    LEL  LR 
Sbjct: 381  RPLALSAPGRLLRHVAALFGQRMTCEALLTLLKHPLTASGTDRGEHLRFTRDLEL-KLRK 439

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLL-VDHILQCITPLVTY 537
                +                 +   +  W +R S+     AVLL  D ++Q +      
Sbjct: 440  YGPPF----------------PSAAMLTDWAARQSDP----AVLLWADWLVQAL------ 473

Query: 538  KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEH-RKLP------NLWFEEEGKT-LSSLFS 589
              +     GN  ++D         Q++ L E   + P       LW ++ G+  L+++  
Sbjct: 474  --DGVEDVGNRPLAD------HVAQHLALTEALARGPAGLGTGELWLKKPGEAALAAVQE 525

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
               E          ++ D+   ++    V+  ++    + I GTLE+R+   D +ILGGL
Sbjct: 526  LAREAPYGGDLTPADYRDLFEAILAKGEVREDVQSHPQIMIWGTLEARVQGADLVILGGL 585

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            N+G+WP+    +P+L+R M+    L   E+ IG +AHD++ A     ++ T + R     
Sbjct: 586  NDGIWPQMPPPDPWLNRQMRQKAALLLPERRIGLSAHDYQQAIAATEVVLTHATRNAEAE 645

Query: 710  TIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQ-PHYKRPKPFP 761
            T+ SRWL RL  L       GG      ++ RG  +L     L+      P   RP P P
Sbjct: 646  TVPSRWLNRLQNLLRGLPGQGGPQALAAMQARGATWLRLAEALETPAATVPAANRPAPRP 705

Query: 762  PLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK 821
            P+EA+P   + + I+ LI DPYA+YAR IL+L  +   ++ PD   RG+L H I+   ++
Sbjct: 706  PVEARPAQLAVTGIRTLIRDPYAIYARTILRLKKLDPLRQTPDARLRGSLLHAILQRFVQ 765

Query: 822  KRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKI 881
            +R  +   E    + +I D    ++   P    +WR    + +  FL  +     +   +
Sbjct: 766  ERPAETRAEARLRLLEISDQVMAEQAPWPAARALWRARLERAADFFLAADAAQGGT--SV 823

Query: 882  FVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEA 941
             +     +A+  +  +LT   DRID L  G + I DYKTG  P  E  Q   + QL LEA
Sbjct: 824  ILESGGAIALAPLPFNLTAKPDRIDALPDGRLHILDYKTG-TPPTEKQQAQFEKQLLLEA 882

Query: 942  AALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLL 1001
            A  + G+F+ I  R+VA + Y+ L    K+       +    +EL  K  ++L +++   
Sbjct: 883  AMAERGAFAPIGARQVARISYVGLGTSPKL------VETEVTEELLGKVWEDLHKLIARY 936

Query: 1002 QNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                Q + +   + E+     +YDHLAR  EW
Sbjct: 937  LTRAQGYAARRAVFEE-RFPGDYDHLARYGEW 967


>gi|260431945|ref|ZP_05785916.1| double-strand break repair protein AddB [Silicibacter
            lacuscaerulensis ITI-1157]
 gi|260415773|gb|EEX09032.1| double-strand break repair protein AddB [Silicibacter
            lacuscaerulensis ITI-1157]
          Length = 975

 Score =  337 bits (863), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 300/1046 (28%), Positives = 473/1046 (45%), Gaps = 108/1046 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF + P + F + ++  L         R D   P  LA V + + T+R  + +R  F 
Sbjct: 8    PRVFAVPPGADFPQALVRGL-------RARSDGHPPEALARVQLVLNTRRMARRVRELFD 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            +       +LP I  + D+ E   + DL     + P V  ++R LEL +L+     +L D
Sbjct: 61   Q---GPPCLLPRISLVTDLGE---SVDL---DQVPPAVPPLRRRLELTQLV----ARLLD 107

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL   S L           L+ +LA +I+ ++ E    E +  L        W  A 
Sbjct: 108  QQPDLAARSSL---------FGLSDSLAALIEEMQGEGVPPEAIRQLDVTDLSGHWARAQ 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-----GTKGPIIIAGSTGSIP 240
             F+ IA ++       L+         A  R   E+L+        + P+I+AGSTGS  
Sbjct: 159  AFIGIADQFLKTEDGSLDVQ-------ARQRRVVENLIARWQDAPPQHPVILAGSTGSRG 211

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
             T  LM  VA  P GA++LPG D   P  +W  +         S  T   HPQY   KL+
Sbjct: 212  TTLMLMQAVARLPQGALILPGYDFDQPAHVWERL--------DSAMTSEDHPQYRFRKLM 263

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              L I +  +            R+ ++S +  P   +D   ++    ++ ++     D+ 
Sbjct: 264  TELGIGQAQIAAWTPDQPPSPARNRLVSLALRPAPITDAWMSE--GPQLRDLDAATRDIT 321

Query: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
            L+EA + R EA++IA+ LR +  E  + +ALIT DR L R+V   L R+ I  D SAG+P
Sbjct: 322  LVEAQSPRAEALAIALRLRQAA-ETGQTAALITPDRMLTRQVSAALDRWNILPDDSAGLP 380

Query: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLA-KFGFPEKYLSRAKNALELVALRGN 479
            L  +     L  +        D  A+ TL+KHPL    G    +L  +++ LEL  LR N
Sbjct: 381  LQLSPPGRFLRHVAGLFAHRLDAEALLTLLKHPLCHSAGDRGAHLLHSRD-LEL-HLRRN 438

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
               +      S  L   A +K+   VP   +R                      L+    
Sbjct: 439  GPPFP----DSASLSGFAVEKD---VPDTWARW---------------------LIRNFC 470

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII-ETGSCI 598
            ++    G L ++DW +      + +          LW +  G+   ++ S +  E     
Sbjct: 471  DRQ-ISGTLPLTDWVQRLRDLAEAIAGAGTGDAGELWDKNAGQAALAVISDLADEAEHGG 529

Query: 599  KANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNT 658
            +  A+++ D++  L+ G+ V+ +      + I GTLE+R+   D LILGGLNEG WP+  
Sbjct: 530  EMTALDFADLLGALLAGQEVRDRDAPHPRIMIWGTLEARVQGADLLILGGLNEGSWPEAP 589

Query: 659  AKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQR 718
            A +P+L+R M+    L   E+ IG +AHDF+ A G   +  TR++R ++  T+ SRWL R
Sbjct: 590  APDPWLNRQMRDRAGLLLPERRIGLSAHDFQQAIGAPEVWLTRAVRSDDAETVPSRWLNR 649

Query: 719  LLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYS 771
            L  L       GG    + ++ RG+ +L W+  L+   +     RP P PP+ A+PR  S
Sbjct: 650  LTNLLQGLPDQGGRAALEQMRDRGKTWLRWSEMLEQAPRIAAAPRPSPRPPVAARPRRLS 709

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI-NKNTPE 830
             +EIK+LI DPYA+YA+ IL+L  +    + PD   RG + H I+   +K  + +     
Sbjct: 710  VTEIKKLIRDPYAIYAKHILRLKPLDPLVQAPDALLRGIVIHEILEHFVKDSVLDGALLT 769

Query: 831  INHLMKQ---IIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA 887
             ++ +K+   ++D H       P    +W     +I+  FL  E   +S    I      
Sbjct: 770  RDNFLKRAEALLDQHVAW----PTARKLWLARLERIADDFLRAEITRRSDGGPIAFEAKM 825

Query: 888  KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAG 947
            ++ +E +G  L G ADRID    G + I DYKTG  P  E+ Q   D QL +EAA  + G
Sbjct: 826  RLTLEPLGFTLNGRADRIDRNSRGALTIIDYKTG-APPSESQQAKFDKQLLIEAAMAEQG 884

Query: 948  SFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQP 1007
                 D   VA+  +I +   +K      DK      E  +K L  L E+++     +Q 
Sbjct: 885  GIDGFDPMAVASAVFIGMGGTYKEVPAPLDK------EPPDKVLAELKELISAYLEPDQG 938

Query: 1008 FISHLRLSEKSNIQSEYDHLARVAEW 1033
            F S   + + S++  +YDHLAR  EW
Sbjct: 939  FSSRRMMHKDSDV-GDYDHLARFGEW 963


>gi|126460954|ref|YP_001042068.1| putative helicase/exonuclease [Rhodobacter sphaeroides ATCC 17029]
 gi|126102618|gb|ABN75296.1| putative helicase/exonuclease [Rhodobacter sphaeroides ATCC 17029]
          Length = 997

 Score =  335 bits (859), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 290/1041 (27%), Positives = 449/1041 (43%), Gaps = 100/1041 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F + P   F   ++  L         R     P  +A V +YV T+R    +R    
Sbjct: 7    PRLFGLPPGVDFPAALVRGL-------RARMAGAAPEAMARVELYVNTQR----MRRRIT 55

Query: 66   EI-TGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            E+ T + +  LP I+            +L     L  PV  ++R LELA+L+       P
Sbjct: 56   ELMTAEGTGFLPRIR---------LVTELPPVPGLPAPVPPLRRRLELAQLVARLIEAQP 106

Query: 125  DIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            DI              +P +A++ L+ +LA++ID ++ E    E +  L    +   W  
Sbjct: 107  DI--------------APRSALFDLSDSLAELIDEMQGEGVPPEAIARLDVADHSAHWQR 152

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
               F+ I +  +     +  A +    ++A+ R  A         P+I+AGSTGS   T+
Sbjct: 153  TQAFMAIVAPMFGADAPDAQALA----RMAVERIAARWAEAPPDHPVIVAGSTGSRGTTS 208

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
              M  VA  P GA+VLPG D  +P A+W  + +          T   HPQ+   +L+  +
Sbjct: 209  LFMQAVARLPQGALVLPGFDFDLPAAVWEGMDDA--------LTAEDHPQFRFHRLMGLV 260

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIE 363
                 +V R  +       R+ +IS S  P   +D   T+     +  + +    + LIE
Sbjct: 261  GAGPAEVGRWTDEIPPSPDRNRLISLSLRPAPVTDQWLTE--GRHLTGLAEAARGMTLIE 318

Query: 364  ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLST 423
            A   R EA+++A+ LR + +E ++ +ALIT+DR L R+V   L R+GI  D SAG PL+ 
Sbjct: 319  APGPRAEALAVAMILRKAAEEGRR-AALITSDRGLTRQVAAALDRWGIVPDDSAGKPLAL 377

Query: 424  TLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSY 483
            +     L  +     +      + TL+KHPL   G       R    LEL   R      
Sbjct: 378  SAPGRFLRHVARLFGRRLTGETLLTLLKHPLTATGADRGNHLRWTRDLELHLRRKGPPFP 437

Query: 484  DIMDLKSLVLDRIATQKNNTHVPHWQSRLSEE-DKELAVLLVDHILQCITPLVTYKTN-K 541
               DL      R A    +     W   L E  D      L DH+   +       T   
Sbjct: 438  AAADLALWAGTRPADGVADWA--RWLGGLIEGLDAAGPRPLADHVAAHLALAEALATGPA 495

Query: 542  NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKAN 601
              T G L    W K      +    +  R+ P+                    G    A+
Sbjct: 496  GDTTGEL----WLKEAGEAARAAVEELRREAPH-------------------GGELTPAD 532

Query: 602  AIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKN 661
              +  D I  L  GE V+  ++    L I GTLE+R+   D +ILGGLN+G WP+    +
Sbjct: 533  YTDLFDAI--LARGE-VREAVQARPDLMIWGTLEARVQGADLVILGGLNDGTWPQLPPPD 589

Query: 662  PFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLV 721
            P+L+R M+    L   E+ IG +AHD+  A     ++ TR+ R+    T+ SRWL RL+ 
Sbjct: 590  PWLNRQMRLKAGLLLPERRIGLSAHDYSQAVAAPEVVLTRATRDAEAETVPSRWLNRLMN 649

Query: 722  L-------GGTDFFDNLKKRGQCYLDWTRKLDY-TTKQPHYKRPKPFPPLEAQPRTYSFS 773
            L       GG +    ++ RG+ +LD    L+   T  P   RP P PP+ A+P   + +
Sbjct: 650  LMSGLKAGGGPEALAGMRARGRDWLDLAAALEQPATPVPLATRPAPQPPVPARPERLAVT 709

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI-NKNTPEIN 832
             I+ LI DPYAVYAR IL+L  +    + PD   RG++ H I+   +K R    + P   
Sbjct: 710  GIRTLIRDPYAVYARHILRLYPLDPLHRAPDARLRGSILHRILEAFVKDRAPGGDRPAER 769

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE 892
              + +I ++   +E   P    +W     + +  FLE E     +   + +    ++ + 
Sbjct: 770  ARLMRIAEAVLAEEVPWPAARALWLARLDRAADFFLETEAAHAGT--PVVLEEEGRVDLT 827

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
             +   LT   DRID+L  G + I DYKTG  P K+  Q+  D QL LEAA  + G F  +
Sbjct: 828  PLRFTLTAKPDRIDVLPDGRLHILDYKTGTPPTKKQ-QEQFDKQLLLEAAMAERGGFRGL 886

Query: 953  DCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHL 1012
               +VA + YI L    K++ +  D        L  +  + L  ++      EQ ++S  
Sbjct: 887  GPAEVARISYIGLGTSPKVESVETDAA------LLGQVWEGLHALIGRYMRREQGYVSR- 939

Query: 1013 RLSEKSNIQSEYDHLARVAEW 1033
            R         +YDHLAR  EW
Sbjct: 940  RAMFGERFPGDYDHLARFGEW 960


>gi|77462065|ref|YP_351569.1| putative helicase/exonuclease [Rhodobacter sphaeroides 2.4.1]
 gi|77386483|gb|ABA77668.1| putative Helicase/Exonuclease [Rhodobacter sphaeroides 2.4.1]
          Length = 997

 Score =  335 bits (858), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 290/1041 (27%), Positives = 450/1041 (43%), Gaps = 100/1041 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F + P   F   ++  L         R     P  +A V +YV T+R    +R    
Sbjct: 7    PRLFGLPPGVDFPAALVRGL-------RARMAGAAPEAMARVELYVNTQR----MRRRVT 55

Query: 66   EI-TGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            ++ T + +  LP I+            +L     L  PV  ++R LELA+L+       P
Sbjct: 56   DLMTAEGAGFLPRIR---------LVTELPPVPGLPAPVPPLRRRLELAQLVARLIEAQP 106

Query: 125  DIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            DI              +P +A++ L+ +LA++ID ++ E    E +  L    +   W  
Sbjct: 107  DI--------------APRSALFDLSDSLAELIDEMQGEGVPPEAIARLDVADHSAHWQR 152

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
               F+ I +  +     +  A +    ++A+ R  A         P+I+AGSTGS   T+
Sbjct: 153  TQAFMAIVAPMFGADAPDAQALA----RMAVERIAARWAEAPPDHPVIVAGSTGSRGTTS 208

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
              M  VA  P GA+VLPG D  +P A+W  + +          T   HPQ+   +L+  +
Sbjct: 209  LFMQAVARLPQGALVLPGFDFDLPAAVWEGMDDA--------LTAEDHPQFRFHRLMGLV 260

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIE 363
                 +V R  +       R+ +IS S  P   +D   T+     +  + +    + LIE
Sbjct: 261  GAGPAEVGRWTDEIPPSPARNRLISLSLRPAPVTDQWLTE--GRHLTGLAEAARGMTLIE 318

Query: 364  ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLST 423
            A   R EA+++A+ LR + +E ++ +ALIT+DR L R+V   L R+GI  D SAG PL+ 
Sbjct: 319  APGPRAEALAVAMILRKAAEEGRR-AALITSDRGLTRQVAAALDRWGIVPDDSAGKPLAL 377

Query: 424  TLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSY 483
            +     L  +     +      + TL+KHPL   G       R    LEL   R      
Sbjct: 378  SAPGRFLRHVARLFGRRLTGETLLTLLKHPLTATGADRGNHLRWTRDLELHLRRKGPPFP 437

Query: 484  DIMDLKSLVLDRIATQKNNTHVPHWQSRLSEE-DKELAVLLVDHILQCITPLVTYKTN-K 541
               DL      R A    +     W   L E  D      L DH+   +       T   
Sbjct: 438  AAADLALWAGTRPADGVADWA--RWLGGLIEGLDAAGPRPLADHVAAHLALAEALATGPA 495

Query: 542  NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKAN 601
              T G L    W K      +    +  R+ P+                    G    A+
Sbjct: 496  GDTTGEL----WLKEAGEAARAAVEELRREAPH-------------------GGELTPAD 532

Query: 602  AIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKN 661
              +  D I  L  GE V+  ++    L I GTLE+R+   D +ILGGLN+G WP+    +
Sbjct: 533  YTDLFDAI--LARGE-VREAVQARPDLMIWGTLEARVQGADLVILGGLNDGTWPQLPPPD 589

Query: 662  PFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLV 721
            P+L+R M+    L   E+ IG +AHD+  A     ++ TR+ R+    T+ SRWL RL+ 
Sbjct: 590  PWLNRQMRLKAGLLLPERRIGLSAHDYSQAVAAPEVVLTRATRDAEAETVPSRWLNRLMN 649

Query: 722  L-------GGTDFFDNLKKRGQCYLDWTRKLDY-TTKQPHYKRPKPFPPLEAQPRTYSFS 773
            L       GG +    ++ RG+ +LD    L+   T  P   RP P PP+ A+P   + +
Sbjct: 650  LMSGLKAGGGPEALAGMRARGRDWLDLAAALEQPATPVPLATRPAPQPPVPARPDRLAVT 709

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI-NKNTPEIN 832
             I++LI DPYAVYAR IL+L  +    + PD   RG++ H I+   +K R    + P   
Sbjct: 710  GIRKLIRDPYAVYARHILRLYPLDPLHRAPDARLRGSILHRILEAFVKDRAPGSDRPTER 769

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE 892
              + +I ++   +E   P    +W     + +  FLE E     +   + +    ++ + 
Sbjct: 770  ARLMRIAEAVLAEEVPWPAARALWLARLDRAAAFFLETEAAHAGT--PVVLEEEGRVDLT 827

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
             +   LT   DRID+L  G + I DYKTG  P K+  Q+  D QL LEAA  + G F  +
Sbjct: 828  PLRFTLTAKPDRIDVLPDGRLHILDYKTGTPPTKKQ-QEQFDKQLLLEAAMAERGGFRGL 886

Query: 953  DCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHL 1012
               +VA + YI L    K++ +  D        L  +  + L  +V      EQ ++S  
Sbjct: 887  GPAEVARISYIGLGTSPKVESVETDAA------LLGQVWEGLHALVGRYMRREQGYVSR- 939

Query: 1013 RLSEKSNIQSEYDHLARVAEW 1033
            R         +YDHLAR  EW
Sbjct: 940  RAMFGERFPGDYDHLARFGEW 960


>gi|149201425|ref|ZP_01878400.1| hypothetical protein RTM1035_17407 [Roseovarius sp. TM1035]
 gi|149145758|gb|EDM33784.1| hypothetical protein RTM1035_17407 [Roseovarius sp. TM1035]
          Length = 979

 Score =  334 bits (857), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 289/1050 (27%), Positives = 469/1050 (44%), Gaps = 113/1050 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFR--YDPLNPLLLASVTIYVPTKRAIQELRSE 63
            P ++ + P   F R          LVE  R  +    P  LA V + V T+R  + +R  
Sbjct: 8    PRLYGVPPGVDFPR---------ALVEGLRAHHAGKPPEALARVQLIVNTRRMARRIREL 58

Query: 64   FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL 123
            F         +LP I  L D+ E      L    ++  PV  ++R LEL +LI    +  
Sbjct: 59   F---DAGPPCLLPRISLLTDLGE------LWDLAHIPDPVPPLRRRLELVQLIATLLDNA 109

Query: 124  PDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
            PD+              +P +AI+ L+ +LA ++D +  E    + +  L        W 
Sbjct: 110  PDL--------------APRSAIYDLSDSLAGLMDEMHGEGVAPQAIETLDITDQSGHWA 155

Query: 183  LAADFLKIASKYWTERLVELNASSP---VGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
                FL I   Y+     E+  ++P      ++ + R  A         P+I+AGSTGS 
Sbjct: 156  RIKSFLGIVRHYF-----EIGGAAPDVETRQRLVIERLAALWADTPPAHPVILAGSTGSR 210

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
             AT  LM  VA  P GA+VLPG D  +P  +W+ + +   +          HPQY   ++
Sbjct: 211  GATQHLMQAVARLPQGAVVLPGFDFEMPAPVWDALGDAMLS--------EDHPQYRFCRV 262

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCFS 357
                 I   D++   ++S     R+ ++S +  P   +D  +R+   L +    I    +
Sbjct: 263  AAGAGITPADIRPWSDISPANPARNALVSLALRPAPVTDQWLRDGPHLRD----IAGAMA 318

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
            +V L+EA ++R+EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SA
Sbjct: 319  NVTLVEAPSQRQEALAIALRLRQAA-EDGRTAALITPDRTLTRQVTAALDRWDILPDDSA 377

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G+PL  +     L  + +         ++ TL+KHPLA  G       R    LEL  LR
Sbjct: 378  GLPLHLSPPGRFLRHVADLFRTRLSAESLLTLLKHPLAHQGAERGPHLRLTRELEL-HLR 436

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTY 537
             +   Y   +  SL L   A  + +   P W +        L    V+       PL   
Sbjct: 437  RHGPPYPTEE--SLRL--WAADQKDPLAPEWVN-------WLCACFVNRDYSGEIPL--- 482

Query: 538  KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGS 596
                +S   +L +++  K+   C              LW ++ G+      +++  E   
Sbjct: 483  ---DHSVATHLDLAE--KIAQGCHGTGSG-------TLWLKDAGQEAQKAVTELRAEAHH 530

Query: 597  CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
                +A ++  +  +++    V+  ++    + I GTLE+R+   D LIL GLNEG WP+
Sbjct: 531  AGALSASDYSSLFHKILSAREVRNPVDPHPHILIWGTLEARVQGADLLILAGLNEGSWPE 590

Query: 657  NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWL 716
            +   +P+L+R ++  + L   E+ IG +AHDF+ A     +  TRS+R  +  T+ SRWL
Sbjct: 591  SPKPDPWLNRALRHQVGLLLPERRIGLSAHDFQQAIAAPEVWLTRSVRSADAETVVSRWL 650

Query: 717  QRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             R+L L       GG    ++++ RG+ +LD    L+   + P   RP P PP+  +P  
Sbjct: 651  NRILNLLSGLPDQGGQAAIEDMRNRGRLWLDRATALEDPGEVPRATRPAPAPPVAVRPDH 710

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
             + +EIK+LI DPYA+YAR ILKL  +    + PD   RGT+ H I+   I++ ++   P
Sbjct: 711  LTVTEIKRLIRDPYAIYARHILKLRPLDPLMRAPDALLRGTVLHEILEGFIRETLDH--P 768

Query: 830  EINHLMKQIIDSHFE---KENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNI 885
            E  H     +  H E    EN+P      +W     +++  F++ E + ++    +    
Sbjct: 769  E--HCDHATLMRHAETVLAENVPWAEARALWLARLDRVADWFIDTEARRRTLARPVHFEA 826

Query: 886  PAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
              +  +  +G  L+  ADR+DL   G + I DYKTG  P  +  Q   D QL LEAA   
Sbjct: 827  KGRATLPDLGFTLSAKADRLDLDDLGQLHIYDYKTGAPPSTKE-QTSFDKQLLLEAAIAT 885

Query: 946  AGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGE 1005
               F  +   +VA   +I L          ++ K+  A   +E   K   E   L+    
Sbjct: 886  RSGFEGMGPTRVARAVFIGLG---------SEPKELDAPLDTEPPEKIWAEFHALISAYF 936

Query: 1006 QPFISHL--RLSEKSNIQSEYDHLARVAEW 1033
             P + +   R    ++   +YD LAR  EW
Sbjct: 937  DPDMGYTARRAPRNADEDGDYDQLARYGEW 966


>gi|89056556|ref|YP_512007.1| hypothetical protein Jann_4065 [Jannaschia sp. CCS1]
 gi|88866105|gb|ABD56982.1| hypothetical protein Jann_4065 [Jannaschia sp. CCS1]
          Length = 986

 Score =  334 bits (857), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 289/1015 (28%), Positives = 469/1015 (46%), Gaps = 91/1015 (8%)

Query: 40   NPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNL 99
             P  LA V I+V   R  + L++ +I    +   +LP I+ +  + E   TADL     L
Sbjct: 35   GPEALARVEIHVANARMQRRLQTLYIR---RGPGLLPRIRPVLSLSE---TADL---EGL 85

Query: 100  NPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDII 159
             P +S +   LELA+LI     KL D   DL P + L           LA +LAD +  +
Sbjct: 86   PPAMSPLALRLELAQLI----GKLIDANPDLAPRAALYD---------LADSLADFMGEM 132

Query: 160  ETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAE 218
              E    + + +L   ++   W  A DFL IA +     +   +  +P G Q A++ R  
Sbjct: 133  VEEGVTPDTIASLDMGEHSEHWTRARDFLGIAQQV----IATGDRPTPEGRQAAVVDRLI 188

Query: 219  AEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKS 278
            A+  +     P+I+AGSTGS  AT RLM  VA+ P GA++LPG+D  +P AIW  + +  
Sbjct: 189  AQWRINPPTHPVIVAGSTGSRRATFRLMEAVAHLPQGAVILPGIDRDMPGAIWRGLLDGR 248

Query: 279  TNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD 338
                 S      HPQY LAKLLD + +    V   G  +  +  R+ V+S +  P   ++
Sbjct: 249  ----RSGLAGEDHPQYRLAKLLDAVGMDPATVPLWGRATPAVPARNAVVSLALRPAPVTN 304

Query: 339  MRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNL 398
               T+    K+ ++    + V L+EA + + EA +IA+ +R  +  + ++ AL+T DR L
Sbjct: 305  QWRTE--GPKLTDVSGAMAGVTLLEAPSPQMEATAIALRMRKGV-ADGQRVALVTPDRRL 361

Query: 399  ARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFG 458
            AR+V  +L R+ I  D SAG  L+ T     L  +   +       A+  L+K+PL   G
Sbjct: 362  ARKVTAQLDRWRILPDDSAGQVLAQTAPGRFLRQVAEMLCGPVTAEAMVALLKNPLCNSG 421

Query: 459  FPEK--YLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEED 516
             P++  +L R  + LEL  LR           ++ ++D  A +K++     W        
Sbjct: 422  -PDRGNHLRRTVD-LELQLLRKGLT----FPTRAALMDWAAARKDDVDTTAW-------- 467

Query: 517  KELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLW 576
                  L DH+L+ +         + +    L  S    L     Q    + +++ P   
Sbjct: 468  ---VTWLADHLLEPVETAALPLAERVA----LHKSRADALAAGVDQTTTHELYKQEPG-- 518

Query: 577  FEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLES 636
              E+ +TL      + +TG  + A   ++ D  T L     V+  +   + + I GT E+
Sbjct: 519  --EKAETLLRELQAVADTGGAMSAR--DYADFFTALAHDREVRFALRPHADVLIWGTQEA 574

Query: 637  RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRH 696
            R+   D  IL GLNEG WP+  + +P+L+R +++D  L+  ++ IG +AHDF+       
Sbjct: 575  RVQGADVTILAGLNEGTWPQAASADPWLNRPLRADAGLRLPDRVIGLSAHDFQQGIAGGE 634

Query: 697  LIYTRSLRENNIPTIASRWLQRLL-VLGG-----TDFFDNLKKRGQCYLDWTRKLDYTTK 750
            +  +R+ R++   T+ +RWL RL+ +LGG     +    +++ RG  +L     L  T  
Sbjct: 635  VWLSRAKRDDETDTVPARWLNRLVNLLGGASDASSQALTDMQARGAEWL----TLADTLS 690

Query: 751  QPHYKRPKPFPPLEAQPR-----TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDR 805
             P  +      P  A          S ++I++LI DPYA+YA R+L L  +   +  PD 
Sbjct: 691  TPDARETPAPRPAPAPQNITRLTALSVTDIERLIRDPYAIYAARMLNLRALDPLRASPDA 750

Query: 806  TDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISH 865
              RGT+FH I+ + I         +   +   +      ++   P    +WRH    I  
Sbjct: 751  RLRGTVFHRIMEQFITATPTDLPEDAGQVFMGLAGDILAQDAPWPAARHLWRHRLQTILP 810

Query: 866  SFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPK 925
             +L  E   ++  E   +       +  +G+ L+G ADRID L  G V I DYKTG+ P 
Sbjct: 811  WYLAQEASFRALAEPWVLEERKDWHVPGLGMTLSGIADRIDSLPDGRVAIYDYKTGNLP- 869

Query: 926  KETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADE 985
             +  +   + QL L A   + G+F+      VA L Y+ L  K +I     D      D 
Sbjct: 870  TDRMEIAYNKQLLLLALMGRGGAFADRPL-DVARLAYVGLGTKPEIRAQDFD------DG 922

Query: 986  LSEKSLKNLIEIVTLLQNGEQPFIS--HLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            L +++ K L E++T   +  QP +     R  +++    +YDHLAR+ EW E  D
Sbjct: 923  LLDETFKGLRELIT---HYRQPLVGFPSRRSPKQTTYAGDYDHLARLGEWDETMD 974


>gi|332559992|ref|ZP_08414314.1| putative helicase/exonuclease [Rhodobacter sphaeroides WS8N]
 gi|332277704|gb|EGJ23019.1| putative helicase/exonuclease [Rhodobacter sphaeroides WS8N]
          Length = 999

 Score =  333 bits (854), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 290/1041 (27%), Positives = 449/1041 (43%), Gaps = 100/1041 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F + P   F   ++  L         R     P  +A V +YV T+R    +R    
Sbjct: 7    PRLFGLPPGVDFPAALVRGL-------RARMAGAAPEAMARVELYVNTQR----MRRRVT 55

Query: 66   EI-TGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            E+ T + +  LP I+            +L     L  PV  ++R LELA+L+       P
Sbjct: 56   ELMTAEGTGFLPRIR---------LVTELPPVPGLPAPVPPLRRRLELAQLVARLIEAQP 106

Query: 125  DIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            DI              +P +A++ L+ +LA++ID ++ E    E +  L    +   W  
Sbjct: 107  DI--------------APRSALFDLSDSLAELIDEMQGEGVPPEAIARLDVADHSAHWQR 152

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
               F+ I +  +     +  A +    ++A+ R  A         P+I+AGSTGS   T+
Sbjct: 153  TQAFMAIVAPMFGADAPDAQALA----RMAVERIAARWAEAPPDHPVIVAGSTGSRGTTS 208

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
              M  VA  P GA+VLPG D  +P A+W  + +          T   HPQ+   +L+  +
Sbjct: 209  LFMQAVARLPQGALVLPGFDFDLPAAVWEGMDDA--------LTAEDHPQFRFHRLMGLV 260

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIE 363
                 +V R  +       R+ +IS S  P   +D   T+     +  + +    + LIE
Sbjct: 261  GAGPAEVGRWTDEIPPSPARNRLISLSLRPAPVTDQWLTE--GGHLTGLVETARGMTLIE 318

Query: 364  ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLST 423
            A   R EA+++A+ LR + +E ++ +ALIT+DR L R+V   L R+GI  D SAG PL+ 
Sbjct: 319  APGPRAEALAVAMILRKAAEEGRR-AALITSDRGLTRQVAAALDRWGIVPDDSAGKPLAL 377

Query: 424  TLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSY 483
            +     L  +     +      + TL+KHPL   G       R    LEL   R      
Sbjct: 378  SAPGRFLRHVARLFGRRLTGETLLTLLKHPLTATGADRGNHLRWTRDLELHLRRKGPPFP 437

Query: 484  DIMDLKSLVLDRIATQKNNTHVPHWQSRLSEE-DKELAVLLVDHILQCITPLVTYKTN-K 541
               DL      R A    +     W   L E  D      L DH+   +       T   
Sbjct: 438  AAADLALWAGTRPADGVADWA--RWLGGLIEGLDAAGPRPLADHVAAHLALAEALATGPA 495

Query: 542  NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKAN 601
              T G L    W K      +    +  R+ P+                    G    A+
Sbjct: 496  GDTTGEL----WLKEAGEAARAAVEELRREAPH-------------------GGELTPAD 532

Query: 602  AIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKN 661
              +  D I  L  GE V+  ++    L I GTLE+R+   D +ILGGLN+G WP+    +
Sbjct: 533  YTDLFDAI--LARGE-VREAVQARPDLMIWGTLEARVQGADLVILGGLNDGTWPQLPPPD 589

Query: 662  PFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLV 721
            P+L+R M+    L   E+ IG +AHD+  A     ++ TR+ R+    T+ SRWL RL+ 
Sbjct: 590  PWLNRQMRLKAGLLLPERRIGLSAHDYSQAVAAPEVVLTRATRDAEAETVPSRWLNRLMN 649

Query: 722  L-------GGTDFFDNLKKRGQCYLDWTRKLDY-TTKQPHYKRPKPFPPLEAQPRTYSFS 773
            L       GG +    ++ RG+ +LD    L+   T  P   RP P PP+ ++P   + +
Sbjct: 650  LMSGLKAGGGPEALAGMRARGRDWLDLAAALEQPATPVPLATRPAPQPPVPSRPERLAVT 709

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI-NKNTPEIN 832
             I+ LI DPYAVYAR IL+L  +    + PD   RG++ H I+   +K R    + P   
Sbjct: 710  GIRTLIRDPYAVYARHILRLYPLDPLHRAPDARLRGSILHRILEAFVKDRAPGGDRPAER 769

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE 892
              + +I ++   +E   P    +W     + +  FLE E     +   + +    ++ + 
Sbjct: 770  ARLMRIAEAVLAEEVPWPAARALWLARLDRAADFFLETEAAHAGT--PVVLEEEGRVDLT 827

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
             +   LT   DRID+L  G + I DYKTG  P K+  Q+  D QL LEAA  + G F  +
Sbjct: 828  PLRFTLTAKPDRIDVLPDGRLHILDYKTGTPPTKKQ-QEQFDKQLLLEAAMAERGGFRGL 886

Query: 953  DCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHL 1012
               +VA + YI L    K++ +  D        L  +  + L  +V      EQ ++S  
Sbjct: 887  GPAEVARISYIGLGTSPKVESVETDAA------LLGQVWEGLHALVGRYLRREQGYVSR- 939

Query: 1013 RLSEKSNIQSEYDHLARVAEW 1033
            R         +YDHLAR  EW
Sbjct: 940  RAMFGERFPGDYDHLARFGEW 960


>gi|254294693|ref|YP_003060716.1| hypothetical protein Hbal_2339 [Hirschia baltica ATCC 49814]
 gi|254043224|gb|ACT60019.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 1026

 Score =  332 bits (852), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 312/1072 (29%), Positives = 483/1072 (45%), Gaps = 114/1072 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +FTI P++ F      AL N TL EN      NP  L    I+ P KR+ + +   F 
Sbjct: 17   PRIFTIPPATSFLN----ALAN-TLSENLGLKD-NPAALTQTVIFCPNKRSSRAIAEAFH 70

Query: 66   EIT---GKKSTILPIIKSLGDVVEEKFTADLLLS-YNLNPPVSNIQRLLELARLILIWRN 121
            +I    G K+ + P I+ LGD+ ++   A + +S   L P +S+ QR   LA+L+  W  
Sbjct: 71   KIAMGFGHKALLAPEIRVLGDLEDDHTIAPIGVSELELGPALSSGQRRGTLAKLVQFWST 130

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIID-IIETEEKKWEDLHAL-KNEKYGM 179
            K                P+ P +AI  A  L  ++D     E   W  L  L ++     
Sbjct: 131  KA------------YGAPLPPRSAIAAADQLGSLLDQSAMGEGTDWSKLQGLVEDSDLAA 178

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEH-LMKGTKGPIIIAGSTGS 238
             W  +ADFL+I S+ W   L E  A+ P+  ++A  R  A +   +  + PIIIAGSTG+
Sbjct: 179  HWKQSADFLEIISQAWPAHLEEQGATDPMARRVAAARTLANNWAARPPQHPIIIAGSTGA 238

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
             PAT  LM    N P GAI+LPGLD  I    W  I            +  +HPQY+L +
Sbjct: 239  TPATRLLMQAAMNLPQGAIILPGLDPDISEDAWKAI-----------ASSPSHPQYTLRR 287

Query: 299  LLDFLDIKREDV-KRLGNVSN-EMYGRSMVISKSFLPPDTSD--MRNTDILENK-IPN-- 351
             L  L + +  V K  G +   +   R  +I+++  P  T+    +  + L  +  P   
Sbjct: 288  ALGKLGVDKSSVLKWPGAIETPDNTARRKLINEALAPASTTKSWTKRLEFLAGENTPEHL 347

Query: 352  IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGI 411
            +      ++LIEA++E EEA++ A+ LR +L+   K +AL++ D +L RRV   +TR+G+
Sbjct: 348  VNSGLKGLSLIEAEDEAEEALACALLLREALETPGKTAALVSPDGSLVRRVSALMTRWGV 407

Query: 412  NIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
            +I  S+G P   T H S+   +   +    D + + +L+KHPL + G+ E     A    
Sbjct: 408  DIPPSSGTPFMQTHHGSLFALMFQWLRDEGDPVQLLSLLKHPLVRVGWDEDNYHSA---- 463

Query: 472  ELVALRGNKNS------------YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKEL 519
             LV L  +KN             YD +D    + DR+  QK              +  +L
Sbjct: 464  -LVELESHKNEFREDGTVRGPRRYDTLD---ALADRLGMQKR------------AQSAQL 507

Query: 520  AVLLVDHILQC-ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFE 578
               L     QC I P     T      GN+      +L       V  +       LW  
Sbjct: 508  IRDLATAARQCEIRP----STMAQDIDGNVFARACARLAERL---VSTENEAGSTRLWRG 560

Query: 579  EEGKTLSSLFSKIIETGSCIKANAIE-WIDIITRLIDGETVKPKIEKSSTLFILGTLESR 637
             EG   +     + E  + +     + W +    +     + PK  +   L I G LE+R
Sbjct: 561  VEGAQTARYLETLAEIAAELGPVPPDLWTEFAEAIASESAIPPKGGEHPRLAIWGPLEAR 620

Query: 638  LLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHL 697
                D +IL  LNE  WP   A + FL + ++ DL L   E+ +G +AHDF        +
Sbjct: 621  QQMRDVIILASLNENSWPAAAAADSFLPKRLRKDLGLPDPEERLGLSAHDFAQLACAPDV 680

Query: 698  IYTRSLRENNIPTIASRWLQRL--LVLGGTDFFDNLKKRGQCY-----LDWTRKL----D 746
               RS R ++ P++ASRWL RL  L  GG    + ++K  +       L W R +    D
Sbjct: 681  KLVRSKRVDDKPSVASRWLWRLNTLAAGGLGSPEAVQKALEPEPKNNPLIWARSMRKARD 740

Query: 747  YTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRT 806
            YT  Q     P P PP++A+P  +S S + +LI DPYAVYA  +LKL+ +P    +    
Sbjct: 741  YTPIQ----APTPRPPVDARPTKFSVSRVARLIRDPYAVYASDVLKLNPMPAVGAESGPA 796

Query: 807  DRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHS 866
            +RGT  H  +     +R      ++  L+ + +    E +     I++  R L+ + + +
Sbjct: 797  ERGTAIHAAV-----ERYELEGGQVIDLVTKELKKAGETDTA---IELN-RPLWSRAADA 847

Query: 867  FLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNP 924
            ++    + +++I +  + I  ++  E  G    LT  ADRIDLLK     I D+KTG   
Sbjct: 848  YIAWRNERETNIREKHLEIEGELTFEISGRKYRLTAKADRIDLLKDNTFAIIDFKTGTPK 907

Query: 925  KKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKK-KYSA 983
             K+  Q  ++PQL LEAA    G F ++     + L Y+ L          N K  K   
Sbjct: 908  TKKQLQSGLEPQLPLEAAIAAGGGFPKLPTADTSQLIYVSLAPGAASTKADNGKPVKLDE 967

Query: 984  DELSE--KSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              ++E  K+ +  I++V       Q + S  R +E S   S+YD LAR  EW
Sbjct: 968  GPMAEAQKAREGFIKLVQSYATISQAYYSKPR-AEFSWDVSDYDRLARRDEW 1018


>gi|315497131|ref|YP_004085935.1| double-strand break repair protein addb [Asticcacaulis excentricus CB
            48]
 gi|315415143|gb|ADU11784.1| double-strand break repair protein AddB [Asticcacaulis excentricus CB
            48]
          Length = 1006

 Score =  332 bits (850), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 312/1066 (29%), Positives = 503/1066 (47%), Gaps = 125/1066 (11%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  ++I    PF  +     L   L E    D      L    I  PT+R  +++   F 
Sbjct: 12   PRWYSIPSGRPFLDD-----LARGLCEALGDD------LPHALILTPTRRGARQMAHAFT 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADL-LLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
            +    K+ +LP +++LGD+ E +   DL  L  +L P +S+ +R  ELA+LI        
Sbjct: 61   DQCRAKALLLPQVRALGDLEEGEPPFDLEHLGLDLPPALSSTRRRFELAKLI-------- 112

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWED-----LH---ALKNEK 176
               K  Y ES   +P++   A+ LA +LA   D +  EE +  D     +H    L ++ 
Sbjct: 113  ---KAHY-ES--DVPLNARTALELADSLAKFFDSLALEEVEASDRLDRLVHDPDLLHDDM 166

Query: 177  YGMW--WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIA 233
              M   W ++A FL IA   W +RL EL+   P    + L+    +   K     P+IIA
Sbjct: 167  GAMAEHWQVSARFLAIAVDLWPKRLAELDLMDPSQRLVTLIHRLGKQWEKTPPTHPVIIA 226

Query: 234  GSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQ 293
            G+TG+ PATARLM   +    GA+VLPGLD  +   +W  + +             +HPQ
Sbjct: 227  GTTGTTPATARLMGLASRFEQGAVVLPGLDLSLAEDVWAQVGD-------------SHPQ 273

Query: 294  YSLAKLLDFLDIKREDVKRLGNVSNEMYGRSM----VISKSFLPPDTSDMRNTDILENKI 349
             ++  LLD   + RE V     VS E          V++++  P + +    T I   K 
Sbjct: 274  GAMKALLDRHRVSREVVNTW-PVSIEADRARHARRRVLNEALRPAEATKDWRTQIAALKA 332

Query: 350  PN---IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLEL 406
             +   I+   S +  IE  N+ E A  IA+ +R +L+   K +AL+T D  L+RRV   L
Sbjct: 333  GSEAAIKDGLSGLTHIEGRNDEEVAAVIALLMREALETPGKTAALVTPDITLSRRVTARL 392

Query: 407  TRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSR 466
            +R+G+  D SAG  L  +L    L SLL+ I +  D + +  L+KHPL++F        R
Sbjct: 393  SRWGVRPDSSAGDALIHSLVGRFLHSLLDLILEPFDAVKLLALLKHPLSRFAD-----DR 447

Query: 467  AKNALELVALRGNK--NSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDK-ELAVLL 523
              N LE++ LRG K  N+ +++                       SRL++++  E A L 
Sbjct: 448  HVNILEIIGLRGAKPRNAEEVL-----------------------SRLTQKEAFEAADLW 484

Query: 524  VDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT 583
             D++  C+     ++  K        +SD+ +      ++V     R    LW    G T
Sbjct: 485  QDYMDTCLI----WQRQKTD------LSDYVRTLTVWAESVAA---RDGQALWSGAAGAT 531

Query: 584  LSSLFSKIIETGS--CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
             S+L + +I  G    ++ + + ++DI+ R +   TV+        L ILG +E+R+ + 
Sbjct: 532  ASALLADLIAEGRDFLVEDDQV-FVDILRRALRTATVRTGGHTHPRLTILGAIEARMFSA 590

Query: 642  DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF-EMANGTRHLIYT 700
            D LIL GL EGVWP+    +PFLSR M+  L L + E+  G +AHDF + A+     + T
Sbjct: 591  DRLILAGLEEGVWPQAAEIDPFLSRPMRKVLGLPSPERRTGLSAHDFVQGASQPEVWMVT 650

Query: 701  RSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTK------QPHY 754
            R  RE   P + SRWL RL  L  T   ++L  + Q +LDW R++D          +P  
Sbjct: 651  RQRREGE-PQVQSRWLWRLQTL-TTGAGEHLPTKAQ-WLDWARRMDGPLSVVPDALKP-A 706

Query: 755  KRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHN 814
             RP+P PP+EA+P     ++I+ L  DPYAVY R +L L  +    +  +   RGT  H 
Sbjct: 707  SRPQPAPPVEARPLQLPVTQIETLERDPYAVYGRYVLGLKPLDRPNEPFEALRRGTAIHA 766

Query: 815  IITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKI 874
            +  +     +      +  +   ++++    ENL      + R LF  ++  ++  E + 
Sbjct: 767  VAEKFAADDMPMGEAGVR-VFCDMLEAQLRAENLSEAQLALQRPLFPLLAREYVAFEAER 825

Query: 875  QSSIEKIFVNIPAKMAIE--SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKL 932
            ++   ++ +    K+ I+       +T  ADR+++ + G VD+ D+KTG  P  +     
Sbjct: 826  RADHPRLLIEQSGKLTIDLPRGTFTVTAKADRVEIHERG-VDVIDFKTGQPPSPKAVIAG 884

Query: 933  IDPQLSLEAAALKAGSFSQID----CRKVANLFYIRLKQKFKIDCITNDKKK-YSADELS 987
              PQL+L AA LK GSF+  +     + +  L Y+RL Q      +  DKK   SADE++
Sbjct: 885  FYPQLTLTAAILKYGSFNGFEDFHRAKGLHELVYVRLGQDVVKPRVVYDKKNPLSADEMA 944

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +++L  L   +   +N +Q ++S      +     +YD LAR+ EW
Sbjct: 945  DRALSRLKTRLMQYENPKQGYLSWRAPQYRMERGGDYDQLARLYEW 990


>gi|21328715|gb|AAM48721.1| conserved hypothetical protein [uncultured marine proteobacterium]
          Length = 972

 Score =  330 bits (847), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 287/1020 (28%), Positives = 461/1020 (45%), Gaps = 97/1020 (9%)

Query: 29   TLVENF--RYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVE 86
            TL+E    R     P   A V +YV T+R  + L   F++   +   ++P    + ++  
Sbjct: 22   TLLEGLTTRLQGAAPEDWARVEVYVNTRRMQRRLAELFLQGPAR---LMPKFHLVTNLAH 78

Query: 87   EKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAI 146
            +    DL +      PV  ++R LE+A+L+     KL   ++ L          +PA+A+
Sbjct: 79   DPLLTDLPM------PVPTLKRRLEIAQLV----RKLIQRVEGL----------APASAV 118

Query: 147  W-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNAS 205
            + LA +LA ++D ++ E    + +  L    +   W  A  F+ I  +Y+         +
Sbjct: 119  FDLANSLAGLMDEMQGEGIAPDVIEGLDISDFSGHWERALQFISIVQRYFEGGEAPDEEA 178

Query: 206  SPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCH 265
                  +AL +   E+       PI++AGSTGS   T  LM+ VA  P GA+VLPG D  
Sbjct: 179  RQRASVLALTQRWQEN---PPDHPILVAGSTGSRGTTFHLMTAVAGLPQGAVVLPGFDFD 235

Query: 266  IPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSM 325
            +P  +W  +++  T+          HPQY  ++LL+ L++  + V        +   R+ 
Sbjct: 236  MPRRVWAQLSDPKTS--------EDHPQYRFSRLLNALELTSDHVIPWTAAEPQAAARNR 287

Query: 326  VISKSFLP-PDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDE 384
            ++S +  P P T   R        +  + +   D+  +EA N+R EA +IA+ LR +  E
Sbjct: 288  LVSLALRPAPVTHHWRQEG---PHLTELDQATQDITWLEAPNQRVEAKAIALRLRQAA-E 343

Query: 385  NKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFM 444
              + +A+IT DRNL RR+   L  + I  D SAGIPL+ T     L  +L+         
Sbjct: 344  LGQTAAVITPDRNLTRRISTALAAWNITPDDSAGIPLNLTAPGRFLLHVLDLAQSQLTSE 403

Query: 445  AIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTH 504
             +  L+KHPL   G       R    LEL  LR +  ++    L +  L + A ++N  H
Sbjct: 404  TLLVLLKHPLTHSGSERGQHLRNTRELELY-LRRSGPAF----LTAQALLQWAEKEN--H 456

Query: 505  VPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNV 564
               W   ++         + D   Q   PL ++ T+       LS               
Sbjct: 457  YRPWVDWINAN-------VFDQWPQGPQPLESWITHHRKLAEGLSAG------------- 496

Query: 565  CLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWID---IITRLIDGETVKPK 621
             + E  +L   W +  G+   +    +  T     A  +E ID   I+  ++     + +
Sbjct: 497  LVGEDGEL---WEQAPGRDTKTEIENL--TRYAPAAGDVELIDYTAILRGVLSAGQTRDQ 551

Query: 622  IEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYI 681
                S + I GTLE+R+ + D +IL GLN+G WP+  A +P+L+R ++    L   E+ I
Sbjct: 552  NHVHSNILIWGTLEARVQSADLVILAGLNDGTWPEPPAPDPWLNRSLRLQAGLLLPERRI 611

Query: 682  GQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL-VLGGTD------FFDNLKKR 734
            G +AHDF+ A G + +  TRSLR ++  T+ SRWL R+  +L G +      + D+++ R
Sbjct: 612  GLSAHDFQQAIGAKTVWLTRSLRSDDAETVPSRWLNRIENLLNGLEKPDDASWMDHMRAR 671

Query: 735  GQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLD 794
            G  +L     L+     P   RP   PP+ ++P   + ++IK LI DPYA+YA+R+L L 
Sbjct: 672  GNEWLGKVEALEEPQVAPLSIRPSVAPPVASRPERLAVTDIKHLIRDPYAIYAKRVLNLR 731

Query: 795  FIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI 854
             +    K PD   RGTL H+++   +K     N       +  + +  F+     P    
Sbjct: 732  RLDPLSKSPDAPLRGTLIHDLLEAFLKTGPWTNAEAAKATLLALAEERFQSTVPWPAARR 791

Query: 855  IWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVD 914
            +W     + +  F+ HE K Q+ I      I   + +  +   L G ADRIDLL  G   
Sbjct: 792  MWLARVVRFAEWFVTHEMKRQARILSTKTEIEGDVNLPELNFTLAGTADRIDLLNDGTAH 851

Query: 915  ITDYKTGDNPKKETAQKL-IDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDC 973
            I DYKTG  P    AQ+L  D QL LE   L+ G F  +   KVA   YI L        
Sbjct: 852  IYDYKTGKPPSP--AQQLHFDKQLLLEVEILRRGGFPGLGPLKVAGATYIGLD------- 902

Query: 974  ITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              N   +  A         +  +++   Q+ EQ + +  R   K++  S+YDHLAR  EW
Sbjct: 903  --NAPSELPAPIDETDVWSDFSKLIXAYQSPEQGYAAR-RAMLKADDASDYDHLARYGEW 959


>gi|84514937|ref|ZP_01002300.1| hypothetical protein SKA53_11973 [Loktanella vestfoldensis SKA53]
 gi|84511096|gb|EAQ07550.1| hypothetical protein SKA53_11973 [Loktanella vestfoldensis SKA53]
          Length = 974

 Score =  330 bits (846), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 277/1017 (27%), Positives = 467/1017 (45%), Gaps = 110/1017 (10%)

Query: 39   LNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN 98
            + P   A V IYV T R  + +R+ F +     + +LP I+ + D+  +       +S +
Sbjct: 34   MPPEDFARVEIYVNTARMQRRIRAMFDD---GPALLLPRIRLVTDLARDP------ISKD 84

Query: 99   LNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIW-LAKNLADIID 157
            + P ++ +QR LEL++L+       PD+              +P  A++ L+ +LA ++D
Sbjct: 85   VPPAIAPLQRRLELSQLVAQLLQSEPDL--------------APRAALYDLSDSLASLMD 130

Query: 158  IIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYW-TERLVELNASSPVGYQIALMR 216
             ++ E    + +  L        W  A  FL I ++++ T    +  A   +  +    R
Sbjct: 131  EMQGEGVSPDAIAKLDVSDQSGHWARAQKFLTIIAQFFDTTTQPDTEARQRLVIETLAAR 190

Query: 217  ---AEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNT 273
               A  +H       P+I+AGSTGS  ATA  M  VA  P GAIVLPG D  +P  +W+ 
Sbjct: 191  WADAPPDH-------PVIVAGSTGSRGATALFMQAVAKLPQGAIVLPGYDTDLPDTVWSA 243

Query: 274  ITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLP 333
            + +          T+  HPQY   +L+D +     DV R  +++ +   R+ ++S S  P
Sbjct: 244  MDD--------GLTHEGHPQYRFKRLMDLIGFGPADVARWSDLAPQRPARNRLVSLSLRP 295

Query: 334  PDTSDMRNTDILENKIPNIQKCF----SDVALIEADNEREEAISIAIALRMSLDENKKKS 389
               + + N  + E   P++  C       + L+EA + R EA +IA+ LR ++ ++   +
Sbjct: 296  ---APVTNQWLQEG--PDL-GCLIAATEGLTLLEAASPRAEAEAIALRLRQAV-QDGITA 348

Query: 390  ALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATL 449
            ALI+ DR L R+V   L R+ I  D SAG PL  +     L  + +         A+ TL
Sbjct: 349  ALISPDRMLTRQVTAALDRWDIKPDDSAGTPLQLSPPGRFLRHVADLFGTQLTGEALLTL 408

Query: 450  VKHPLAKFGFPEKYLS-RAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHW 508
            +KHPL      ++    R  + LEL  LR     +   D    +L   +T+ +      W
Sbjct: 409  LKHPLCHSDNADRGDHLRMTHDLEL-DLRKYGPPFPTADT---LLGWASTRADRQPWAQW 464

Query: 509  QSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDE 568
                              + + +T L         T G+  ++D     +T  ++ C   
Sbjct: 465  ------------------VAELVTGL--------DTVGDKHLTDHLDAHLTLAESFCAGP 498

Query: 569  HRKLPN---LWFEEEGKTLSSLFSKI-IETGSCIKANAIEWIDIITRLIDGETVKPKIEK 624
               LP    LW E  G+    + + +    G+    +  ++  +  +++    V+ +   
Sbjct: 499  --ALPGAGGLWDEAAGREAQRICTDLRTHAGAGGVMSPRDYAALFGKILSAGVVRDRDAG 556

Query: 625  SSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQA 684
               + I GTLE+R+   D  ILGG+N+GVWP+  A +P+L+R+M++   L   E+ +G +
Sbjct: 557  HPQILIWGTLEARVQGADLTILGGMNDGVWPEAPAPDPWLNRMMRAQAGLLLPERRVGLS 616

Query: 685  AHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL-VLG------GTDFFDNLKKRGQC 737
            AHD++ A   R +  TR+ R ++  TI SRWL RL  +LG      G +  D ++ RG  
Sbjct: 617  AHDYQQAVAGREVWITRAKRSSDAETIPSRWLNRLTNLLGGLPDQNGPEALDRMQARGAA 676

Query: 738  YLDWTRKLDYTTKQ-PHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFI 796
            +L    KL          KRP P PP+ A+P  +S ++IK LI DPYA+YAR++L+LD +
Sbjct: 677  WLAMAAKLSAPGADVAKVKRPAPCPPVAARPNRFSVTQIKTLIRDPYAIYARKVLRLDPL 736

Query: 797  PHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW 856
                   D   RG + H I+ E +++  N    +++ L+  I   HF ++   P     W
Sbjct: 737  DPLTPSADAPLRGVIIHGILEEFVRQ--NHAPDDLDALLA-IATRHFTEKCPWPTHRAQW 793

Query: 857  RHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDIT 916
               F   + +F + E    +  +   V    K+ I  + + LT  ADRIDL  SG   + 
Sbjct: 794  MARFALAADAFCKAEVGRHALSDTRLVEQEGKLLIPDVEVTLTCKADRIDLTPSGTAILY 853

Query: 917  DYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITN 976
            DYKTG  P K   +K  D QL LE A ++ G F  +   +V +  ++ +K   K      
Sbjct: 854  DYKTGTMPTKPQQEKF-DKQLLLEVAMVERGGFEGVGPVQVDDAQFVSIKPDAKTVLAP- 911

Query: 977  DKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                  +D  ++ ++  L  +    +  +  + +   L  K ++ S YDHL+R  EW
Sbjct: 912  -----ISDNPTDTTMAELTALFEHWRRADSGYTARYALFSKKDVGS-YDHLSRFGEW 962


>gi|56698683|ref|YP_169060.1| hypothetical protein SPO3872 [Ruegeria pomeroyi DSS-3]
 gi|56680420|gb|AAV97086.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 975

 Score =  329 bits (843), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 286/1044 (27%), Positives = 463/1044 (44%), Gaps = 104/1044 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF + P   F R ++  L         R     P +LA   + V T R  + +R+ F 
Sbjct: 8    PRVFALPPGVDFPRALVQGLRQ-------RAAGQAPHVLARAQVVVNTHRMERRIRALF- 59

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                  +T+LP +  + D+        L    +L P +  ++R LEL +LI    ++ PD
Sbjct: 60   --DAGPATLLPRVSLVTDLTA------LGAVTHLPPAIPPLRRRLELVQLITRLLDQQPD 111

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
            +              + A+   L+ +LA +ID ++ E      + AL        W  A 
Sbjct: 112  LA-------------ARASIFDLSDSLAALIDEMQGEGVSPAIIRALDVSDQSGHWARAQ 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAE-AEHLMKGTKGPIIIAGSTGSIPATAR 244
             F+ IA  Y      EL+  +    Q  ++ A  AE  ++  + P+I+AGSTGS   T  
Sbjct: 159  QFIAIAEHYLRSGDDELDVQA---RQRRVVEALIAEWALRPPEHPVILAGSTGSRGTTML 215

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM  VA  P GA+VLPG D   P  +W+ + +          T   HPQ+  A+L+  L+
Sbjct: 216  LMEAVARLPQGAVVLPGYDFDQPERVWDGLEDA--------LTAEDHPQFRFARLMARLN 267

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            +  + +    +       R+ ++S +  P   +D   ++    ++  I     D+ LIEA
Sbjct: 268  LTPDQIAPWSDDVAPCPARNRLVSLALRPAPVTDAWMSE--GPQLEGIDTATRDITLIEA 325

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
             + R+EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG+PL  +
Sbjct: 326  ASPRDEALAIALRLRQAA-EDGQSAALITPDRMLTRQVSAALDRWNILPDDSAGLPLHLS 384

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
                 L  +        D  A+ +++KHPL   G            LEL   R       
Sbjct: 385  PPGRFLRHVAALFSARLDGEALLSVLKHPLCHTGEGRNEHLLHTRDLELDLRRNGPPFPG 444

Query: 485  IMDLKSLVLDRIATQKNNTHVPH-WQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNS 543
            + DL +    R         VP  W                + + +C             
Sbjct: 445  VGDLAAFATRR--------EVPEGW---------------TNWVARCFC--------DQH 473

Query: 544  TCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII-ETGSCIKANA 602
              G L + DW        + +         +LW ++ G+   ++ + +  E     + +A
Sbjct: 474  VTGTLPLIDWVDRLRQLAEALSAGTEGGTGSLWEQKAGQEALAIVTALADEAPHGGEMDA 533

Query: 603  IEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
             ++ D++  L+    V+ +      + I GTLE+R++  + LILGGLNEG WP++ A +P
Sbjct: 534  RDFADLLGGLLSTGEVRDRDAPYPGIMIWGTLEARVMGAELLILGGLNEGSWPESPAPDP 593

Query: 663  FLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVL 722
            +L+R M+ D  L   E+ IG +AHDF+ A G   +  TR+ R ++  T+ SRWL RL  L
Sbjct: 594  WLNRRMRHDAGLLLPERRIGLSAHDFQQAIGAPEVWLTRAKRSDDAETVPSRWLNRLTNL 653

Query: 723  -------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
                   GG      ++ RG+ +L     L+   +     RP P PPL A+PR  S +EI
Sbjct: 654  LQGLPDQGGAAALSEMRARGRRWLSMAEALEEAPRSAPAPRPSPRPPLAARPRQLSVTEI 713

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI------NKNTP 829
            K+LI DPYA+YAR +L+L  +    + PD   RG + H I+   ++  +      N++T 
Sbjct: 714  KKLIRDPYAIYARHVLRLKPLDPLVQAPDALLRGIVIHEILESFVRDSVLDMALLNRDT- 772

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
                 +K+   +  E+    P    +W     +++ +FL  EE  ++    I      + 
Sbjct: 773  ----FLKRAA-TMLEELVAWPTARALWLARLDRVADAFLLSEEARRADAGPIAFEARMRK 827

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             ++ +   LTG ADRID  + G + + DYKTG  P  E  Q   D QL +EAA  + G F
Sbjct: 828  QLDGLDFTLTGRADRIDRTERGSLCLYDYKTG-APPSEKQQAKFDRQLLIEAALAEEGGF 886

Query: 950  SQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
              ID   VA   +I +   +K      D       E   +    L +++      +Q F 
Sbjct: 887  EGIDPAPVARAVFIGMGGSYKEVPAPLDA------EPPARVWAELHQLIGAYFEPDQGFT 940

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEW 1033
            +  R+  K +   +YDHLAR  EW
Sbjct: 941  AR-RMLHKDSDAGDYDHLARFGEW 963


>gi|114328673|ref|YP_745830.1| ATP-dependent nuclease subunit B [Granulibacter bethesdensis CGDNIH1]
 gi|114316847|gb|ABI62907.1| ATP-dependent nuclease subunit B [Granulibacter bethesdensis CGDNIH1]
          Length = 976

 Score =  328 bits (842), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 285/1021 (27%), Positives = 472/1021 (46%), Gaps = 104/1021 (10%)

Query: 40   NPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNL 99
            +PL  A   I +PT+RA + L   F+ I+  +  +LP I +LG + E      L  + +L
Sbjct: 27   SPLDTADGIILLPTRRAARALADAFLRISNGRPLLLPRITALGALDETPLA--LHGALDL 84

Query: 100  NPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDII 159
             P V   +RL EL RLIL     LPD              +S  NA  LA+ LA ++D  
Sbjct: 85   PPAVDTPRRLAELTRLIL----ALPDPA------------LSADNAWMLARELAKLLD-- 126

Query: 160  ETEEKKWEDLHALKNE---KYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMR 216
            E      +   +L +     +   W     FL+I ++ W + L E   + P   Q AL+R
Sbjct: 127  EAARAGIDLATSLPDAVDPSFAAHWQTTLTFLQIVTRAWPDWLAEEGLTDPAARQAALLR 186

Query: 217  AEAEHLMKGTKGP-IIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT 275
             +A H         +  AG +G+ PA A L+ T+A    G ++LPGLD  +P   W  + 
Sbjct: 187  IQATHWQDHPPATRLWAAGISGAAPAEAMLLKTIARLKQGLVILPGLDMTMPEEAWGMLE 246

Query: 276  EKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLG--NVSNEMYGRSMVISKSFLP 333
                         ++HPQ  +  LL  +D +R+DV   G     +    RS ++ ++ LP
Sbjct: 247  -------------ASHPQAGMRDLLAMMDARRDDVAPWGLTPPPSRPADRSRLLHQALLP 293

Query: 334  PDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALIT 393
             +   +      E   P+ +  F     +EA++E++EA++IA+ LR +L+   +++ALIT
Sbjct: 294  AEALTLWR----ETTPPSSESVFR----LEAEDEQQEAVAIALILRDALETPGRRAALIT 345

Query: 394  ADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHP 453
             DR LA RV  EL RFG+  D SAG PL+ T  +  L  L   +      +++ +L+KHP
Sbjct: 346  PDRGLAVRVSTELARFGVIADDSAGEPLAETPPALFLRLLAETVRSGFSPVSLLSLLKHP 405

Query: 454  LAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLS 513
            +   G        A   LE  ALRG +    +  L++++                     
Sbjct: 406  MTALGMDRLMTLHAARGLEQHALRGPRPPPGLSGLRAVL--------------------- 444

Query: 514  EEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL-DEHRKL 572
            E  K  A  L+D + Q + PL+     +      L+  D+ +  +T  + V   D H   
Sbjct: 445  EAGKTEAAALIDRLEQVLHPLIDLVAQE-----KLAPHDYLRALLTAGEAVAASDTHSGA 499

Query: 573  PNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWI-DIITRLIDGETVKPKI--------- 622
              LW  EEG+ L+ L ++ +   + +     + +  +   +++G  V+ +          
Sbjct: 500  ERLWALEEGEALAVLLAETLPALTVLPPQPPDTLPGLFDAVLEGIAVRSRRALRRFGEND 559

Query: 623  EKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIG 682
             +   LFI G LE++L + D  +LGGL+EGVWP  T   P++SR M+S + L +AE+ IG
Sbjct: 560  AEHPRLFIWGLLEAQLQHVDVAVLGGLSEGVWPPATDPGPWMSRPMRSRVGLPSAERIIG 619

Query: 683  QAAHDFEMANGTRHL-IYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQ----- 736
            QAAHDF  A  +  + I +   R    P + +RWL R+  L        LK  G+     
Sbjct: 620  QAAHDFVQAVCSASVAILSCPARREGAPVVTARWLARIDAL--------LKGHGKHLPTH 671

Query: 737  CYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFI 796
                W   LD   +    + P+P PP  ++PR+ S +EI + ++DPY VYA RILKL  +
Sbjct: 672  PATAWAGILDQPERPAPVRPPRPCPPRRSRPRSLSVTEIGRWLSDPYRVYAERILKLKPL 731

Query: 797  PHFKKDPDRTDRGTLFHNIITELIKKRINK-NTPEINHLMKQIIDSHFEKENLPPHIDII 855
               ++D D  D G + H+ +   ++    +    ++   ++       ++ N  P +   
Sbjct: 732  DPLEQDTDAADFGMIVHDGMQCFLENAARQWPDGDLPAALRTAFRVALDRHNPRPALRSW 791

Query: 856  WRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
            W     +I+ +++   E+  + I      I    A       L G ADRI++ + G + +
Sbjct: 792  WLPRLDRIA-AWVATREQRDTKIHTETSGIWHLSAFPGGPFTLKGRADRIEIRQDGSIRL 850

Query: 916  TDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLK-QKFKIDCI 974
             DYKTG  P          PQL LEAA +KAG+F  +  +  + L Y RL   +   + I
Sbjct: 851  LDYKTGTVPSAPAILSGEAPQLPLEAAMMKAGAFPDVPAQYPSELVYWRLSGGRVAGEEI 910

Query: 975  TNDKKKYS--ADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAE 1032
               +K  +  A+E ++ + + L ++V    + + P+++       + + + Y HLARV E
Sbjct: 911  ILGRKAPAAWAEEQAQLAAEKLRDLVMRYDDPDFPYLAQPFAPGHAPMDA-YAHLARVPE 969

Query: 1033 W 1033
            W
Sbjct: 970  W 970


>gi|126724546|ref|ZP_01740389.1| putative Helicase/Exonuclease [Rhodobacterales bacterium HTCC2150]
 gi|126705710|gb|EBA04800.1| putative Helicase/Exonuclease [Rhodobacterales bacterium HTCC2150]
          Length = 975

 Score =  328 bits (841), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 289/1045 (27%), Positives = 462/1045 (44%), Gaps = 107/1045 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  F +A    F     PA +  ++++  +  P  P  +A+  IYV T R  + L+S F 
Sbjct: 8    PRFFGLAMGVDF-----PAAIVSSILDRLQNTP--PETIANTVIYVNTSRMQRRLQSLF- 59

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                + +  LP I  +  + E            L  P+  ++R L LA+L+     KL  
Sbjct: 60   --AARGAMFLPRILLITQITEHPAL------IGLPQPMPKLRRRLVLAQLV----RKLLK 107

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL P+           A  LA +LA ++D ++ E   ++DL  L    +   W  + 
Sbjct: 108  TAPDLAPQH---------AAFELADSLASLLDEMQGEGVGFDDLRELDVAHHSAHWERSL 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK-----GTKGPIIIAGSTGSIP 240
             FL I   Y  +++ E+++        A  RA  + L +       + P+++ GSTGS  
Sbjct: 159  KFLSIVETYLADQVDEMDSE-------AQQRAAVDRLSRVWEKSPPQHPVMVVGSTGSRG 211

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
            ATA+ M  VA+ P GA+VLPG D  +P + W  + +  +           HPQ+   +  
Sbjct: 212  ATAKFMHLVASLPQGAVVLPGFDVDMPQSTWAALGDALSG--------EDHPQFRFKQ-- 261

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN-KIPNIQKCFSDV 359
             F++    D  +   VS+    R+ ++S +  P   + + N  + E  K+ ++ +   D+
Sbjct: 262  -FMEHGVHDWIKATPVSST---RNRLVSLALRP---APVTNEWLSEGPKLGDLVEATKDI 314

Query: 360  ALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGI 419
             LIEA++ REE+ +IA+ALR ++ E+   +ALIT DR L+R+V   L R+ I  D SAG+
Sbjct: 315  TLIEANSRREESQTIALALRKAV-EDGVSAALITPDRELSRQVSAALDRWNIRADDSAGL 373

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL-VALRG 478
            PL  T     L  +     +     ++  L+KHPL      ++  +  +   EL + LR 
Sbjct: 374  PLHLTPPGRFLRLVAGFFGQAVTAESLLILLKHPLT-CSIKDQRGAHLRWVRELELRLRR 432

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
               ++   D     L   AT +    +  W               VD I  C        
Sbjct: 433  YGPAFPTAD----DLSAWATAQKEDGLVEW---------------VDWINACFA------ 467

Query: 539  TNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII-ETGSC 597
                +  G  S+SD     +     +          LW E+EGK  + +   +  E    
Sbjct: 468  --GCNEIGTQSLSDHLTHHLKMANQLAAGPDDSEHQLWAEDEGKAATKIMEGLQDEAHQG 525

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
             K    E+  ++  L+     +  +E    + I GTLE+R+   D +ILGGLNEG+WP +
Sbjct: 526  GKMAPFEYAALLHSLLQDGEARSSVEAHPDVMIWGTLEARVQGADLVILGGLNEGIWPGD 585

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
             A +P+L+R ++    L   E+ IG AAHDF+ A     +I TR++R     T+ SRWL 
Sbjct: 586  AAPDPWLNRSLRHQAGLLLPERRIGLAAHDFQQAIAAPKVILTRAIRNAEAETVPSRWLY 645

Query: 718  RLLVL--------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQP-HYKRPKPFPPLEAQPR 768
            RL  L         G      ++ RG+ +    + LD          RP P PP++ +P+
Sbjct: 646  RLTSLLDGLRGDQNGNAALAEMRFRGRAWQSLAQALDRPDAPVVPMTRPSPCPPIDVRPK 705

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
              S +EI+ LI DPYA+YA+ +L L  +   +  PD   RGT+ H I  +  K   +   
Sbjct: 706  LLSVTEIQTLIRDPYAIYAKHVLGLTALDPLRPTPDPRLRGTIIHEIFHKFSKATKSGMP 765

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
                 L+    D  F KE   P    IWR    + +H F+E E   +      +      
Sbjct: 766  ENAIDLLLTTTDDVFAKEIPWPATRRIWRARLARNAHWFVETEIARRKLATPTYFETKGH 825

Query: 889  MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGS 948
            + I +  + + G ADRID+   G + I DYKTG  P     Q   D QL +EAA  + G 
Sbjct: 826  IPIPNTPVAIKGTADRIDVAPDGQLIIYDYKTGSPPSPNVIQSF-DKQLLIEAAMAENGG 884

Query: 949  FSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPF 1008
            F       V+ L YI L +  K   I  D  K+S  ++       L +++   Q+  + +
Sbjct: 885  FMDSGPSPVSGLVYIGLARTPKEQKI--DLTKHSVSDV----WAGLSDLLGQYQSLTKGY 938

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEW 1033
             S  R  +K     ++DHLAR  EW
Sbjct: 939  TSR-RAMQKEADARDFDHLARFHEW 962


>gi|209965879|ref|YP_002298794.1| hypothetical protein RC1_2601 [Rhodospirillum centenum SW]
 gi|209959345|gb|ACI99981.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 1000

 Score =  328 bits (841), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 267/903 (29%), Positives = 412/903 (45%), Gaps = 71/903 (7%)

Query: 157  DIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMR 216
            D ++ E   +E L AL  + Y   W +   FL+I ++ W + L E   + P   + A + 
Sbjct: 136  DQVQAERLSFEGLRALVPDDYAGHWQVTLTFLEIVTRLWPDVLAEEGCADPAVERDARLL 195

Query: 217  AEAEHL-MKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT 275
            A A    ++   GP+I AG TGSIPATA L++ VA  P GA+VLPGLD  +  A W  + 
Sbjct: 196  ALARAWELRPPPGPVIAAGVTGSIPATADLLAVVARLPQGAVVLPGLDLGMDDATWAGLD 255

Query: 276  EKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDV--------KRLGNVSNEMYGRSMVI 327
            E             +HPQ  L  LL+ L   R DV          L         RS ++
Sbjct: 256  E-------------SHPQAGLKSLLERLGADRRDVTPWPLPATGPLAVAPRSPVARSRLL 302

Query: 328  SKSFLPPDTSDMRNTDILENKIPNIQK-CFSDVALIEADNEREEAISIAIALRMSLDENK 386
            +++  P +T++          +P +     + V+ I+A   +EEA  IA+ +R +L+   
Sbjct: 303  AEALRPAETTEAWRA------LPALSPDALAGVSRIDAPTPQEEAGVIALMMRQALETPG 356

Query: 387  KKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAI 446
            + +AL+T DR LARRV + L R+G+ +D SAG PL+ T   S L  LL         + +
Sbjct: 357  RTAALVTPDRALARRVAMALRRWGVEVDDSAGRPLALTPVGSYL-RLLADFAATPAPVGL 415

Query: 447  ATLVKHPLAKFGF-PEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHV 505
              L+KHPLA  G  P ++ + A+ ALE   LRG + +     L+  +    A +      
Sbjct: 416  LALLKHPLAAGGTDPAEFRALAR-ALERAVLRGPRPAEGFAGLRRAL---EAAEPRRFDG 471

Query: 506  PHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKL--TVTCLQN 563
            P       EE   LA  L+D + + I  L     +     G   ++DW +L      L  
Sbjct: 472  P-------EERSRLAGFLLD-LERRIGGLCAAMAD-----GPRPLADWLELHGQAAELLA 518

Query: 564  VCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK-ANAIEWIDIITRLIDGETVKPKI 622
                E   L  +W  ++G+  +    +  E           ++  ++  L+ G  V+P+ 
Sbjct: 519  ATAREPGAL-RVWAGDDGEAAARFLREAAEAARGFPDLGGADYAALVEVLMAGRAVRPRY 577

Query: 623  EKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIG 682
                 L ILG +E+RL  FD  ILGGLNEG WP     +P++SR M++   L   E+ IG
Sbjct: 578  GLHPRLHILGLMEARLQQFDLTILGGLNEGTWPPAPPADPWMSRPMRTAFGLPAPERRIG 637

Query: 683  QAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRL---LVLGGTDFFDNLKKRGQCYL 739
            Q AHDF  A G   L+ TRS R +  PT+ SRWL RL   L   G      L+  G+   
Sbjct: 638  QTAHDFAQAAGAAELVLTRSERVDGTPTVPSRWLLRLDTVLEAAGLSLAGPLRLPGRDAG 697

Query: 740  DW---TRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFI 796
             W      LD+  +      P P PP+ A+PR  S ++++  + DPYA+YAR +LKL  +
Sbjct: 698  HWLALQAALDWPERVRPCPPPAPAPPVAARPRRLSVTQVETWMRDPYAIYARHVLKLQAL 757

Query: 797  PHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLP----PHI 852
                 DP   +RG   H  +   ++       P+    +++++D+  E    P    P I
Sbjct: 758  EPVDADPGAAERGQFIHKALDAFVRTYPRTLPPDA---LERLLDAGREAFG-PLLEQPAI 813

Query: 853  DIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKS 910
               W   F +I+  FL  E + +  +  +   +   + ++       L+  ADRID L  
Sbjct: 814  RAFWWPRFERIAGWFLALEAERRGQVAVLATEVKGTLRLDGPAGPFVLSCVADRIDRLPD 873

Query: 911  GFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFK 970
            G + + DYKTG  P     +    PQL LEA   + G F  +    V  L + +L     
Sbjct: 874  GALALVDYKTGTPPTARDIELGFAPQLPLEALIAQEGGFEGLAPAPVGELAFWKLTGGEP 933

Query: 971  IDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARV 1030
               +   K     ++L E++   L  ++ L  +   P+ S  R        S+Y HLAR+
Sbjct: 934  AGEVRPVKGDL--EDLVEQARAGLSRLIALFDDPATPYRSQPRPGRAPRF-SDYGHLARI 990

Query: 1031 AEW 1033
            AEW
Sbjct: 991  AEW 993


>gi|197103667|ref|YP_002129044.1| hypothetical protein PHZ_c0201 [Phenylobacterium zucineum HLK1]
 gi|196477087|gb|ACG76615.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 1001

 Score =  325 bits (832), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 296/1051 (28%), Positives = 473/1051 (45%), Gaps = 91/1051 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  F I    PF  ++   L    L ++       P  L+   + +PT+R  + +   F+
Sbjct: 10   PRWFNIPAHRPFAEDLARGLYE-ALADD------GPEALSDALVLLPTRRGARAVADAFV 62

Query: 66   EITGKKSTILPIIKSLGDV--VEEKF-TADLLLSYNLNPPVSNIQRLLELARLILI-WRN 121
               G ++ + P ++ LGD+   E  F   DL L  +L   +  ++R  EL RL+   WR 
Sbjct: 63   RAAGGRAVLPPQMRPLGDLEAGEPPFEPGDLAL--DLPAAIDPLRRRFELTRLVAGHWR- 119

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKK-WEDLHALKNEKYGMW 180
                    L P   L+     + A+ LA  L   +D ++ EE +  E L  L        
Sbjct: 120  --------LLPGRELTA----SAALELADALGAFLDSLQIEEAEAGEKLAGLVEADLAEH 167

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAE-HLMKGTKGPIIIAGSTGSI 239
            W ++ +FL+ A   W  RL EL        ++ L+R  A+    +  +G ++ AGSTG+ 
Sbjct: 168  WRVSREFLETALTEWPRRLAELGLVDVSERRVRLLRRLADVWASRPPQGVLVAAGSTGTA 227

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PATA L++ +A  P GA+V+PGLD  +  + W  + E+             HPQ +L +L
Sbjct: 228  PATADLLAVIAAAPRGAVVVPGLDDSLAESAWREVDEQ-------------HPQGALRRL 274

Query: 300  LDFLDIKREDVKRL-GNVSNEMYGR--SMVISKSFLPP-DTSD-------MRNTDILENK 348
            L    I R+ V+     ++++  GR    VI+++  PP  T+D       +R     E  
Sbjct: 275  LARTGIDRKHVEVWPAALAHQTQGRWRRRVINEALRPPRATADWLHAIEQLRAEADAEGL 334

Query: 349  IPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTR 408
             P I +    ++L+ A  E E A   A+ LR +L+  +K +AL+T D+ LARRV  +L R
Sbjct: 335  DP-IAEGLKGLSLVSARAEEEAATVAALLLREALETPEKTAALVTPDQVLARRVTAKLAR 393

Query: 409  FGINIDISAGIPLSTTLHSSILTSLLN--AIFKLNDFMAIATLVKHPLAKFGFPEKYLSR 466
            +G+  D SAG PL+      +L  L+   A+  L     +A L+KHP  + G     L+R
Sbjct: 394  WGVVPDSSAGEPLAGC-RCGVLAGLVARAAVDPLAPVTLLA-LLKHPYVRLGLDGDDLAR 451

Query: 467  AKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKEL-AVLLVD 525
             ++ LE   LRG +  +    L++                    RL+E+ + L A+ LVD
Sbjct: 452  RRDVLERHGLRGAR-PWTWAGLRA--------------------RLAEKGRGLDALPLVD 490

Query: 526  HILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLS 585
             +   ++ L        + C    +++  +     ++ +          LW    G+ +S
Sbjct: 491  RLEDLLSAL-------QAACAEGPVAEAARAVTAAMEALAAGADGSTGELWAGHGGEAMS 543

Query: 586  SLFSKII-ETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTL 644
             L + +I ETG     +A  + D+++RL++GE+V+        L ILG +E+RL+  D L
Sbjct: 544  RLLAGLIHETGGVPPVSARGFADLLSRLMEGESVRAGGATHPRLRILGAIEARLVRADRL 603

Query: 645  ILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLR 704
            ++ GL EGVWP+    +PFLSR M+  L L   E+ +G +AHDF  A     +I   S R
Sbjct: 604  VVAGLEEGVWPRGAPLDPFLSRPMRRTLGLPPPERRVGLSAHDFAQAACAAEVILLHSER 663

Query: 705  ENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLE 764
                P + SRWL RL  L      + +  R +  L W R LD        +RP P PP+E
Sbjct: 664  REGQPAVKSRWLWRLETLARGAAVE-IPGRPEA-LAWARALDAPDDYRPARRPAPCPPVE 721

Query: 765  AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
            A+PR    + ++ L  DPYAV+AR IL L  +    +  +   RGT  H           
Sbjct: 722  ARPRELFVTRVETLTRDPYAVWARDILNLRPLERPDEPVEARARGTAIHAAFERFALDHP 781

Query: 825  NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
                P+   + + +     EK  +P         L  + +    E E + ++    I V 
Sbjct: 782  RDLPPDAAAIFEAMYVEELEKAGMPREALARESALAREAAAWVAELEARRRADGRAIHVE 841

Query: 885  IPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAA 942
               ++AI   G  + L   ADRI+    G+  I DYKTG  P ++       PQL+L AA
Sbjct: 842  KTGRLAIRVDGHEVVLGAKADRIEADPQGYGHILDYKTGRAPSQKVVDAGFSPQLTLTAA 901

Query: 943  ALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQ 1002
             L  G F  I       L Y+ +  +              + E +E++L     ++    
Sbjct: 902  ILAHGGFDAIGPLVPGELVYLEVTGRRPAGREEVRAGVGESAEAAERALDGARRLLARYF 961

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +QP++S           S+YDHLARV EW
Sbjct: 962  RPDQPYVSRTAPQFVKTYASDYDHLARVFEW 992


>gi|86136734|ref|ZP_01055312.1| hypothetical protein MED193_13707 [Roseobacter sp. MED193]
 gi|85826058|gb|EAQ46255.1| hypothetical protein MED193_13707 [Roseobacter sp. MED193]
          Length = 985

 Score =  323 bits (827), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 295/1049 (28%), Positives = 481/1049 (45%), Gaps = 106/1049 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +     F R    AL  G L+E     P  P  LA V + + T R ++  R+ F 
Sbjct: 10   PRVFAVPNGVDFPR----ALAQG-LIERSTSQP--PEGLARVDLILNTSRMMRRCRNLFE 62

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            E     + +LP ++ L D+  E     L            + +L+           KL D
Sbjct: 63   E---GPALLLPRMRLLTDLAREANLQGLPPPLPPLRRRLELSQLI----------AKLLD 109

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL   S L           L+ +LA+++D +++E    E +  L        W  A 
Sbjct: 110  AQPDLAARSSLYD---------LSDSLANLVDEMQSEGVSTEVIRNLDISDMSGHWARAQ 160

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM-----KGTKGPIIIAGSTGSIP 240
             F+ I  ++     ++L++ + V  Q A  R   E+L+     +  + P+I+AGSTGS  
Sbjct: 161  QFIGIVDQF-----IDLHSDT-VDVQ-ARQRQMVENLIAKWQVEPPQHPVILAGSTGSRG 213

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
             T  LM  +A  P GA+VLPG D   P  +W  + +  T+          HPQY  AKLL
Sbjct: 214  TTHMLMEAIARLPQGAVVLPGYDFEQPAEVWTHLRDALTS--------EDHPQYRFAKLL 265

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              LD+   +V+R          R+ ++S +  P   +    ++    K+  + K  +DV 
Sbjct: 266  SDLDMTPREVRRWSPDEPVSPARNRLVSLALRPAPVTHAWMSE--GPKLTQLDKACADVT 323

Query: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
            L+EA N R EA++IA+ LR + +E K  +ALI+ DR L R V   L R+GI  D SAG+P
Sbjct: 324  LVEAPNPRGEALAIALRLRQAAEEGKT-AALISPDRMLTRLVSAALDRWGILPDDSAGLP 382

Query: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN- 479
            L  T     L  +     +     A+ TL+KHPL   G      S A+ A      RG  
Sbjct: 383  LQLTPPGRFLRHVAELFCRPLTADALLTLLKHPLTNDG------SSAEAA------RGEH 430

Query: 480  -KNSYDI-MDLKSLVLDRIATQKNNTHVPHWQSRLS-EEDKELAVLLVDHILQCITPLVT 536
             +++ D  +DL+          +N    P  +S  +   +++L +   D + Q       
Sbjct: 431  LRHTRDYELDLR----------RNGPPFPDAESFAAFGMERDLILGWTDWLSQNFA---- 476

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN----LWFEEEGKTLSSLFSKI- 591
                       L ++DW  L     + +      +       LW ++ G     +FS + 
Sbjct: 477  ----DQQVTTPLPLTDWVALLRARAEAIAAGSQVQAEGESGTLWEKKAGIEALKIFSNLE 532

Query: 592  IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
             E     + +A ++ D+++ ++    V+ +     ++ I GTLE+R+   D +ILGGLNE
Sbjct: 533  AEAEHGGEMSARDFADLLSAILSQGEVRDRDTPYGSIMIWGTLEARVQGADLVILGGLNE 592

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTI 711
            G WP+    +P+L+R ++    L   E+ IG +AHDF+ A     +  TR+ R +   T+
Sbjct: 593  GSWPEAAKPDPWLNRQLRHQAGLLLPERRIGLSAHDFQQAVAAPEVWLTRAARSDEADTV 652

Query: 712  ASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLE 764
            ASRWL RL  L       GG    D ++ RGQ +LDW   L+  T+ P   RP P PP+ 
Sbjct: 653  ASRWLNRLTNLLSGLPDQGGKAALDAMRARGQEWLDWAEALEQPTELPSAPRPSPRPPVA 712

Query: 765  AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
            ++PR  + +EI +LI DPYA+YA+ +L+L  +    ++PD   RGT+ H I  + I+  +
Sbjct: 713  SRPRRLTITEIPRLIRDPYAIYAKHVLRLRPLNPLVQEPDALLRGTVVHEIFEDFIRDSL 772

Query: 825  NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
               +      + +   +  E++   P   ++W     +++  F+  E+  QS    + + 
Sbjct: 773  EDPSRLTADHLIETARALLERDVPWPVARLLWLSRIQRLAGDFILAEQSRQSRATPLKLE 832

Query: 885  IPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAAL 944
               +  +E +   +   ADRID  + GF+ + DYKTG  P  E  QK  + QL +EAA  
Sbjct: 833  AMGEARLEPLDFTIACRADRIDQDERGFLHLYDYKTG-APPSEAQQKKFEKQLLIEAAMA 891

Query: 945  KAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNG 1004
            + G+F +I   +VA   +I L    K      D     +D+   K  + L +++      
Sbjct: 892  EEGAFKEIGPAEVARAAFIGLGSNLK------DVPAPLSDQPPAKIWEELKQLIGAYFEQ 945

Query: 1005 EQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +Q + S  R+  + +I  +YDHLAR  EW
Sbjct: 946  DQGYSSR-RMVHRDDIAGDYDHLARFGEW 973


>gi|254451971|ref|ZP_05065408.1| double-strand break repair protein AddB [Octadecabacter antarcticus
            238]
 gi|198266377|gb|EDY90647.1| double-strand break repair protein AddB [Octadecabacter antarcticus
            238]
          Length = 981

 Score =  322 bits (826), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 282/1033 (27%), Positives = 473/1033 (45%), Gaps = 104/1033 (10%)

Query: 29   TLVENFR--YDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVE 86
            TL +  R  ++ ++P  +A V IYV T+R  + L S F +     + +LP I+ + D+ +
Sbjct: 23   TLYDGLRAAFETMSPADVAHVVIYVNTRRMQRRLTSLFHQ---GDALLLPRIRLVTDLAQ 79

Query: 87   EKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAI 146
            +       +   + P ++ ++R LE+A+L+           K L    P     S   AI
Sbjct: 80   DA------VGRAIAPSIAPLRRRLEVAQLV-----------KGLIDADPTL--ASQDAAI 120

Query: 147  WLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASS 206
             LA +L  ++  ++ E    E +  L        W  A  F+++  +++ +  ++     
Sbjct: 121  DLADSLVALMSEMQGEGVAPEAIAGLDVTDQSGHWQRALSFIQLVQQFFADDRLDGEGRQ 180

Query: 207  PVGYQIALMR---AEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLD 263
             +  +  + R      +H       PII+AGSTGS  AT+  M  VA  P GA++LPGLD
Sbjct: 181  RLVIETLVDRWADTPPDH-------PIIVAGSTGSRGATSLFMQAVAKLPQGAVILPGLD 233

Query: 264  CHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGR 323
            C +P  +W+ + +K             HPQY      D L I+  D+++ GN +N    R
Sbjct: 234  CDMPAHVWDMMEQKKGG--------EDHPQYRFKAFCDALSIQPSDIQQWGNTTNINAAR 285

Query: 324  SMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLD 383
            + +IS S  P   +     D   + + ++ +  + + LIEA   R +A +IA  LR ++ 
Sbjct: 286  TGLISLSLRPAPVTHQWIKD--GSDLGDLGEATNGITLIEAPTPRAQADAIAARLRQAV- 342

Query: 384  ENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDF 443
            E+ + +ALI+ DR L R+V   L R+ I  D SAG+PL  T     L  + +   +  D 
Sbjct: 343  EDGQTAALISPDRMLTRQVTASLDRWDITPDDSAGLPLQLTAPGRFLRHIADLFCEPLDA 402

Query: 444  MAIATLVKHPLAKFGFPEKYLSRAK-NALELVALRGNKNSYDIMDLKSLVLDRIATQKNN 502
              +  L++HPL+    P++     + NALEL  LR N   +   +     L + A   ++
Sbjct: 403  ERLLVLLRHPLSHSDRPDRGAHALRTNALEL-DLRRNGPPFPTAE----SLTKWAAATSD 457

Query: 503  THVPH--WQSRLSEEDKELAVLLVDHILQCIT---PLVTYKTNKNSTCGNLSISDWTKLT 557
             H  H  W + +       +VLL      C T   PL+ + T+       LS   +   +
Sbjct: 458  RHPEHTDWVAWVG------SVLLG----LCDTNDKPLIDHLTHHLGIAERLSAGPYLGGS 507

Query: 558  VTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI---IETGSCIKANAIEWIDIITRLID 614
                             LW +  G+    + S++    + G  + A   E+  +I  ++ 
Sbjct: 508  G---------------ELWKKPAGREALRVMSELRAHSDAGGVMSAR--EYRRLIGSVLA 550

Query: 615  GETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNL 674
            G  V+ + +    + I GTLE+R+ + D +IL GLNEG WP+    +P+L+R ++    L
Sbjct: 551  GGEVRDRDDGHPQVLIWGTLEARVQSADLVILAGLNEGTWPEAPTPDPWLNRPLRMQAGL 610

Query: 675  KTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVL-------GGTDF 727
               E+ IG +AHD++ A   R ++ +R++R +   T+ SRW+ RL  L       GG  +
Sbjct: 611  LLPERRIGLSAHDYQQAVCAREVVLSRAVRSDEAETVPSRWINRLTNLLGGLEDKGGPAY 670

Query: 728  FDNLKKRGQCYLDWTRKLDY-TTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVY 786
               +++RGQ +L     +   T       RP P PP +A+P   S ++IK LI DPYA+Y
Sbjct: 671  LKAMRERGQHWLTLAANIAAPTVTVDPAPRPSPCPPADARPDKLSVTQIKTLIRDPYAIY 730

Query: 787  ARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKE 846
            AR+IL L+ +      PD   RGT+ H ++   +K +I+         +  I  S    E
Sbjct: 731  ARKILGLNALDSLAHTPDAPLRGTIVHKVLERFVKDKIDPADSGARAALLSIA-SDVLIE 789

Query: 847  NLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRI 905
            + P P +  +W       +  FL  E+K +     +   +  ++ +  +   LTG ADRI
Sbjct: 790  HCPWPAVRALWFARIASFTPHFLIEEQKRRVFSANVDTEMRGELKLAYLPFTLTGTADRI 849

Query: 906  DLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL 965
            D+   G   I DYKT   P     QK  D QL LEAA ++ G+F  +   +     YI L
Sbjct: 850  DMSDDGEALIYDYKTSKAPTSPQ-QKYFDKQLLLEAAMVERGAFKALGRVRTKAAVYIGL 908

Query: 966  KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYD 1025
                K      D+     DE  +++      ++    +  + + S    +E  + +  YD
Sbjct: 909  GSDLK------DQPAPLDDETPDETWTRFEGLIAKWMDPTKGYTSR-SANEIMSFEGNYD 961

Query: 1026 HLARVAEWREEYD 1038
            HLAR  EW E +D
Sbjct: 962  HLARYGEWDETHD 974


>gi|126732964|ref|ZP_01748725.1| hypothetical protein SSE37_17735 [Sagittula stellata E-37]
 gi|126706581|gb|EBA05657.1| hypothetical protein SSE37_17735 [Sagittula stellata E-37]
          Length = 978

 Score =  322 bits (826), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 295/1047 (28%), Positives = 471/1047 (44%), Gaps = 111/1047 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF + P   F     PA L   L       P  P  +A V +YV T R  + LR+ F 
Sbjct: 12   PRVFALPPGVDF-----PAALIDGLRARLAGRP--PEAIARVELYVATDRMRRRLRNLF- 63

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                  +++LP I+ L D+      +D L    L  PVS ++R LEL  L+    ++L +
Sbjct: 64   --DAGPASLLPRIRLLTDL------SDPLTRAALPAPVSPLRRRLELTGLV----SRLLE 111

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL P S L           L+ +LA +++ +  E    + +  L        W  A 
Sbjct: 112  TQPDLAPRSAL---------FDLSDSLATLMEEMHVEGVSPKTVANLDVTDQSGHWQRAL 162

Query: 186  DFLKIASKYWTERLV-ELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATAR 244
             F  I   Y+ +    +  A + +  ++ L   EA+      + P+IIAGSTGS   T  
Sbjct: 163  TFFNIVQHYFDKDATPDAQAFNRMALELRLEAWEAQP----PRHPVIIAGSTGSRGTTHA 218

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM  VA  P GAIVLPG D  +P A+W+ + +    +TS +     HPQY  AKL+  L+
Sbjct: 219  LMKAVARLPQGAIVLPGFDTDMPPAVWSKLEDP---LTSED-----HPQYRFAKLMRELE 270

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            I   DV+           R+ VIS +  P   +    ++     +PN+     DV L+EA
Sbjct: 271  ITARDVRPWTYGQPPSAARNRVISLAMRPAPVTHQWLSE--GPNLPNLPDAMQDVTLLEA 328

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
            +++REEA++IA+ LR +  EN   +ALIT DR L R+V   L R+ I  D SAG P   T
Sbjct: 329  NSQREEALAIALRLREAA-ENGTTAALITPDRMLTRQVTSALDRWDILPDDSAGTPAQLT 387

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
                +L  +            + +L+KHPL   G            LEL      K    
Sbjct: 388  PPGRLLRLVAELFTAPLTAELLLSLLKHPLTHAGQDRGPHLLTTRELEL---HIRKTGLP 444

Query: 485  IMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNST 544
              D ++L     AT ++      W + L +  +                           
Sbjct: 445  YPDAETLTA--WATARDADRWGAWAATLCDRQQ--------------------------- 475

Query: 545  CGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSCIKANAI 603
             G L ++DW +  ++  + +          LW E  G+ L +L   +  E        A 
Sbjct: 476  TGTLPLADWIERHLSLAEALTAGPDGDPAPLWAENAGRKLRALTETLQFEAEHGTDMTAR 535

Query: 604  EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPF 663
            ++ D+   L+  E V+ +      + I GTLE+R++  D LIL GLNEG WP++ A +P+
Sbjct: 536  DYADLFGALVSREEVRDRDAPHPKILIWGTLEARVMGADLLILAGLNEGAWPESPAADPW 595

Query: 664  LSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVL- 722
            L+R M++   L   E+ IG +AHDF+ A     +  TRSL+ +   T+ SRW+ RL  L 
Sbjct: 596  LNRSMRAQAGLLLPERRIGLSAHDFQQAAAAPEIWLTRSLKSDEAETVPSRWINRLTNLL 655

Query: 723  ------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIK 776
                   G    + +++RG  +       +   +    +RP P PP  ++P+    + I+
Sbjct: 656  NGLPDRNGRKALEEMRERGAHWAALAAAAETPIEADPARRPSPAPPTISRPQELWVTSIR 715

Query: 777  QLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI---NKNTPE-IN 832
            +L+ DPYA+YAR IL+L  +    + PD   RG + H +I   I++ +   ++ TP+ + 
Sbjct: 716  RLVRDPYAIYARYILRLKALDPLMQAPDALMRGVVTHKVIETFIRETVADPDRLTPDRLM 775

Query: 833  HLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA- 890
             + + ++D      ++P P +  +W     + +  F E E   +        N   + A 
Sbjct: 776  QIARVLLD------DVPFPTVRALWLARVARFAPWFCESEADRRQRAAPHLDNFETEGAA 829

Query: 891  -IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             I ++G  L   ADRID+       + DYKTG  P  +  Q   D QL LEAA L+  +F
Sbjct: 830  SIPALGFTLKARADRIDIAPDAGAHVYDYKTGSAPSAKE-QLYFDKQLLLEAAMLQQSAF 888

Query: 950  SQIDCRKVANLFYIRLKQKFKIDCITNDKKKYS---ADELSEKSLKNLIEIVTLLQNGEQ 1006
              I  R VA   YI+LK          D K+ +   AD   +K+ +    ++    + ++
Sbjct: 889  PNIAPRYVAAATYIQLK--------PGDPKEVAAPLADSPPQKTWEEFCALIAAYLDEDK 940

Query: 1007 PFISHLRLSEKSNIQSEYDHLARVAEW 1033
             + +   L + ++I ++YDHL+R  EW
Sbjct: 941  GYTARRALMKDTDI-ADYDHLSRFGEW 966


>gi|254477674|ref|ZP_05091060.1| double-strand break repair protein AddB [Ruegeria sp. R11]
 gi|214031917|gb|EEB72752.1| double-strand break repair protein AddB [Ruegeria sp. R11]
          Length = 977

 Score =  322 bits (824), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 294/1045 (28%), Positives = 463/1045 (44%), Gaps = 105/1045 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F++     F R    AL+ G ++E     P  P  LA   + V T R  + +R  F 
Sbjct: 9    PRLFSVPCGVDFPR----ALVQG-MIERASGQP--PEALAKAELIVNTSRMARRVRDLFD 61

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSY-NLNPPVSNIQRLLELARLILIWRNKLP 124
                  S +LP I  L D+       DL  +   L P +  ++R LEL++L+     KL 
Sbjct: 62   R---GPSVLLPKISLLTDL-------DLRATLRGLPPALPPLRRRLELSQLV----AKLL 107

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLA 184
            +   DL   S L           L+ +LA + D ++ E    + + AL        W  A
Sbjct: 108  EAQPDLAARSSLYD---------LSDSLAALFDEMQGEGVSTDTIRALDVSDMSGHWARA 158

Query: 185  ADFLKIASKYWTERLVELNASSPVGYQ-IALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
              F+ IA  + T      NA  P   Q  A++   AE      + PII+AGSTGS   T 
Sbjct: 159  QQFIAIADDFAT---THENAMDPQERQRQAVLDLIAEWDETPPQHPIILAGSTGSRGTTL 215

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
             LM  +A  P GA+VLPG D   P  +W T+++  ++          HPQY   KL+  L
Sbjct: 216  LLMEAIAKLPQGAVVLPGFDEDQPDHVWQTLSDALSS--------EDHPQYRFFKLMQDL 267

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCFSDVAL 361
            ++   DV+R  + +     R+ ++S +  P   +D  MR    L +    I    S++ L
Sbjct: 268  EMGPRDVRRWTDANPASTPRNRLVSLALRPAPVTDAWMREGPQLRD----IDSATSEITL 323

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPL 421
            +EA   R EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG PL
Sbjct: 324  VEAPGPRAEALAIALRLRQAA-EDGQTAALITPDRMLTRQVSAALDRWDILPDDSAGQPL 382

Query: 422  STTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKN 481
              +     L  +     K     A+ TL+KHPL   G       R    LEL   R    
Sbjct: 383  QLSPPGRFLRHVAELFCKPLQTDALLTLLKHPLCHDGAGRGDHLRHTRDLELRLRRYGPP 442

Query: 482  SYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNK 541
              D     +  + R         +P W                D +  C           
Sbjct: 443  FPDHDSFAAFAVGR-------DLMPGW---------------TDWLASCFA--------D 472

Query: 542  NSTCGNLSISDWTKLTVTCLQNVCLDEH-RKLPNLWFEEEG----KTLSSLFSKIIETGS 596
             +T G   +S+W        + +       +   LW ++ G    K + +L ++    G+
Sbjct: 473  KTTQGERHLSEWVSQLRDLAETISKGSQPAEAGGLWDKKAGREALKVIENLQAEAPYGGA 532

Query: 597  CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
                 A ++ D++  L+    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP+
Sbjct: 533  M---TARDFADLLRALLSQGEVRDRDAPYGSILIWGTLEARVQGADLVILGGLNEGTWPE 589

Query: 657  NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWL 716
              A +P+L+R ++    L   E+ IG +AHDF+ A     +  TR+ R +   T+ SRWL
Sbjct: 590  AAAPDPWLNRQLRHKAGLLLPERRIGLSAHDFQQAIAAPEVWLTRAERTDEADTVPSRWL 649

Query: 717  QRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             R+  L       GG      +K RGQ +L     L+        +RP P PP+ A+P+ 
Sbjct: 650  NRMTNLLSGLPDQGGPGALSAMKARGQMWLGRAEALEAPKPLAPAQRPAPRPPIAARPKR 709

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI-NKNT 828
             + +EI +LI DPYA+YA+ +L+L  +    ++PD   RG + H I+ + +K  + +  T
Sbjct: 710  LTITEIPRLIRDPYAIYAKHVLRLRPLDPLVQEPDALLRGIVLHKILEDFVKGTLEDPKT 769

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
              ++H +    +   E +   P    +W+    +I+  F+  E   Q+        +  K
Sbjct: 770  LTVDHFLTCAAE-QLEAQVPWPVARALWQARLERIAEDFIAGERNRQARARPSGFEVSGK 828

Query: 889  MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGS 948
            + +      + G ADRID+ + G + + DYKTGD P  E  QK  + QL +EAA  + G+
Sbjct: 829  VRVTPHDFEIAGTADRIDVDERGGLHLFDYKTGD-PPSENQQKAFEKQLLIEAAMAEHGA 887

Query: 949  FSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPF 1008
            F      +V    ++ LK   K      +      DE   K  + L +++      EQ +
Sbjct: 888  FETYGEGRVERALFLGLKAPLK------EVPAPLQDEPPAKVWEELSKLIGAYFEPEQGY 941

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEW 1033
             S   + + S I  +YDHLAR  EW
Sbjct: 942  SSRRMVFQDSQI-GDYDHLARYGEW 965


>gi|114769725|ref|ZP_01447335.1| hypothetical protein OM2255_09161 [alpha proteobacterium HTCC2255]
 gi|114549430|gb|EAU52312.1| hypothetical protein OM2255_09161 [alpha proteobacterium HTCC2255]
          Length = 985

 Score =  320 bits (820), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 296/1056 (28%), Positives = 477/1056 (45%), Gaps = 115/1056 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +     F R  +  L +       R     P  LA V +++ T+RA ++L+  FI
Sbjct: 8    PRVFKVPVGVDFSRVFLDGLKS-------RLHEKEPHELARVIVFINTRRAERKLKELFI 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            E     S++LP    + D+ +     D L   NL     +  R++ L +LI         
Sbjct: 61   E---SGSSLLPQFHLITDLSD-----DPLKLCNLPAQAPSHHRMINLGQLI--------- 103

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
              + L    P   PIS      LA++L+ ++D  + E  +  D+  L   ++   W  + 
Sbjct: 104  --RKLLLTEPDLAPISATYD--LAESLSALMDEAQGEGIQMTDVLNLDVGEHSAHWNRSK 159

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGSIPATAR 244
             FL I + +W +  +    + P      ++   A+H  +  T   I+IAGSTGS  ATA 
Sbjct: 160  KFLSILATHWKQNAL----TDPEDRMRHVVETYAKHWDINPTNQTILIAGSTGSRGATAL 215

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
             M  +A  PNGA++LPG+D  +P  +W+ +  K   +         HPQ   AKL D L 
Sbjct: 216  FMKAIAKLPNGAVILPGVDDDLPKDVWSALKTKKFTLD--------HPQAGFAKLFDLLK 267

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCFSDVALI 362
            I  +DV      +     R+ +IS +  P   ++  +    +L+   P + K   D+ LI
Sbjct: 268  IDFDDVDPWHKANIRNIDRNKLISLALRPAPITNQWLEYGPLLK---PYLNKATQDLELI 324

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
            EAD  +EEA++IA  LR +  E  + + LI+  RNL RRV   L R+ I  D SAG PL 
Sbjct: 325  EADTIKEEALAIATRLRFAT-EQGQAAVLISPSRNLTRRVNANLARWNIEADDSAGTPLQ 383

Query: 423  TTLHSSILTSLLNAIFKLN---DFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR-- 477
             +     L S+           DF+A   L+KHPL   G       + +N   L+ +   
Sbjct: 384  LSTTGIFLRSIAQCFGNSTLSYDFLA---LLKHPLTHSG-------KGRNIHNLMTMEIE 433

Query: 478  -GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
             G  N   I+      +D        T  PH              + V  + +   PL  
Sbjct: 434  VGQFNGAKILRGGPPFIDFDILSGWATKDPH------------KTIWVKWLTRIFQPLRD 481

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL-PNLWFEEEGK----TLSSLFSKI 591
             K         + +S+W  L     + +       +   +W ++ GK    TL  +  + 
Sbjct: 482  AK--------EMELSEWLNLLKKTAETLSSSPENDIDAKVWEKDSGKAALKTLDQILHQS 533

Query: 592  IETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLF-ILGTLESRLLNFDTLILGG 648
            + +G  S I+ NA        R I  + ++ + + ++ L  I GTLE+R+ + D +ILGG
Sbjct: 534  VSSGIMSNIEFNAF------LRSILSQELRSETQSANPLISIWGTLEARVQSKDLVILGG 587

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            LNE  WP     + +L+R M+  L+L   E+ IG +AHDF+ A    +++ +RSLRE + 
Sbjct: 588  LNEDTWPSKPNHDMWLNRDMRKQLSLLLPERRIGLSAHDFQQAVSAHNVVLSRSLREGDT 647

Query: 709  PTIASRWLQRL--LVLG----GTDFFDNLKKRGQCYLDWTRKLDY---TTKQPHYKRPKP 759
            P+  SRWL R+  L+ G    G +  D ++  G  +L + R LD    T K P   RP P
Sbjct: 648  PSTPSRWLIRITNLMQGLKNEGPNALDEMRNNGNQWLTYARSLDRVDETKKIPFETRPSP 707

Query: 760  FPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITEL 819
             PP  A+    S ++IK L+ DPY +YA  ILKL  +    K  D  +RG   H I+ E 
Sbjct: 708  IPPENARLEKLSVTQIKDLVRDPYKIYASVILKLKKLDPLGKQADAIERGNTIHTILEEF 767

Query: 820  IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
            I++  N+     ++L  +I +   +K+   P    +W      IS SF+E E K ++   
Sbjct: 768  IRQTQNELPENASNLFMKITNEVLKKDVPWPAAQRLWLARMQAISSSFIEEEIKRRAVGI 827

Query: 880  KIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
             I +    ++  + +   LT  ADRID  K+G + + DYK    P     Q   D QL L
Sbjct: 828  NIALERYGEIDFQDLKFKLTAKADRIDQGKNG-LRLYDYKASKPPSLGDIQ-YFDKQLQL 885

Query: 940  EAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVT 999
            EA       F++I  + + +L YI L  + K   +  D ++ S      K +     ++ 
Sbjct: 886  EAMIAFHDGFNKIRKQSIEHLEYISLGPELKKQPLDIDDQEIS------KIVDEFRNLIL 939

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWRE 1035
               +  + F +  ++   ++I S+YD L+R  EW++
Sbjct: 940  TYNDPSKGFTARDKIQFLNHI-SDYDQLSRKGEWQD 974


>gi|163738015|ref|ZP_02145431.1| hypothetical protein RGBS107_06374 [Phaeobacter gallaeciensis BS107]
 gi|161388631|gb|EDQ12984.1| hypothetical protein RGBS107_06374 [Phaeobacter gallaeciensis BS107]
          Length = 977

 Score =  320 bits (820), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 294/1043 (28%), Positives = 465/1043 (44%), Gaps = 101/1043 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F +     F R    AL++G +    R +  +P  LA V   V T R  + +R  F 
Sbjct: 9    PRLFAVPCGVDFPR----ALVDGLVA---RSENTSPEELAKVEFIVNTSRMARRVRDLFD 61

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            +     + +LP I  L D+      A L     L P +  ++R LEL++LI     KL +
Sbjct: 62   Q---GPALLLPRISLLSDL---DMRATL---RGLPPALPPLRRRLELSQLI----AKLLE 108

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL   S L           L+ +LA + D ++ E    E + +L        W  A 
Sbjct: 109  AQPDLAARSSLYD---------LSDSLAALFDEMQGEGVSPETIRSLDVSDMSGHWARAQ 159

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARL 245
             F+ IA ++       ++A +    Q+ L   E E      + P+I+AGSTGS   T  L
Sbjct: 160  QFIAIADEFAETHEHAMDAQA-RQRQVVLDLIE-EWQDSPPQHPVILAGSTGSRGTTLML 217

Query: 246  MSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDI 305
            M  +A  P GA++LPG D   P  +W  + +   +          HPQY   K++  LD+
Sbjct: 218  MEAIARLPQGAVILPGFDDQQPGHVWEHLDDPLMS--------EDHPQYRFFKIMRDLDM 269

Query: 306  KREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCFSDVALIE 363
              + V+   +       R+ ++S +  P   +D  MR    L +    I +  +DV+L+E
Sbjct: 270  TPDQVRPWVDAIPASMARNRLVSLALRPAPVTDAWMREGPELRD----IDQATADVSLVE 325

Query: 364  ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLST 423
            A N R EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG PL  
Sbjct: 326  APNPRAEALAIALRLRKAA-EDGQTAALITPDRMLTRQVAAALDRWDILPDDSAGQPLQL 384

Query: 424  TLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSY 483
            +     L  +     K      + TL+KHPL   G       R    LEL   R  +   
Sbjct: 385  SPPGRFLRHIAELFCKPLACDTLLTLLKHPLCHDGAGRGDHLRHTRELEL---RLRRYGP 441

Query: 484  DIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNS 543
               D  S      A +     +P W + L+               QC             
Sbjct: 442  PFPDPDSFA----AFEIGRELMPGWTAWLT---------------QCFA--------DKP 474

Query: 544  TCGNLSISDWTKLTVTCLQNVCLDEHRKLPN-----LWFEEEGKTLSSLFSKI-IETGSC 597
              G   +S W    V  L+N+     R   N     LW ++ G+    + + +  E G  
Sbjct: 475  ISGTQPLSQW----VDALRNLAEAISRGSQNAADGGLWDKKAGRKALEIVNNLQAEAGYG 530

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
             +  A ++ D++  L+    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP+ 
Sbjct: 531  GQMTARDFADLLRALLSQGEVRDRDAPYGSILIWGTLEARVQGADLVILGGLNEGSWPEA 590

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
               +P+L+R ++    L   E+ IG +AHDF+ A     +  TRS R +   T+ SRWL 
Sbjct: 591  ATPDPWLNRQLRHQAGLLLPERRIGLSAHDFQQAVAAPEVWLTRSERSDEADTVPSRWLN 650

Query: 718  RLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            R+  L       GG     +++ RGQ +L W   L+  T  P  KRP P PP+ A+PR  
Sbjct: 651  RMTNLLSGLPGQGGPAALADMRARGQEWLGWAEVLEAPTSLPPAKRPAPRPPVAARPRRL 710

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            + +EI +LI DPYA+YA+ +LKL  +    ++PD   RG + H I+ + IK  +      
Sbjct: 711  TITEIPRLIRDPYAIYAKHVLKLRPLDPLVQEPDALLRGIVLHKILEDFIKASVTDPKRL 770

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
                      +H E +   P    +W     +I+  F+  E++ Q+  +     +   + 
Sbjct: 771  TVPDFLTTATAHLEAKVPWPVARSLWLARLERIAEDFITGEQQRQAIAQPSGFEVSGTVR 830

Query: 891  IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
            +  +   + G ADRID+ + G + + DYKTGD P  E+ QK  + QL +EAA  + G+F 
Sbjct: 831  VAPLDFEIAGTADRIDVDERGGLHLFDYKTGD-PPTESQQKTFEKQLLIEAAMAERGAFE 889

Query: 951  QIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFIS 1010
            +    +V    ++ LK   K      +      DE   K  + L ++++     +Q + S
Sbjct: 890  RYGEGRVERALFLGLKSPLK------EVAAPLLDEPPSKVWEELTKLISAYFEPDQGYSS 943

Query: 1011 HLRLSEKSNIQSEYDHLARVAEW 1033
              R+  +     +YDHLAR  EW
Sbjct: 944  R-RMVFQDTQTGDYDHLARYGEW 965


>gi|294011635|ref|YP_003545095.1| putative helicase [Sphingobium japonicum UT26S]
 gi|292674965|dbj|BAI96483.1| putative helicase [Sphingobium japonicum UT26S]
          Length = 992

 Score =  319 bits (818), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 282/1053 (26%), Positives = 463/1053 (43%), Gaps = 96/1053 (9%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P +F I    P  R    AL+ G L ++      +P+ LA   I +P  RAI+ +   F
Sbjct: 6    RPALFNI----PAHRAFSDALVTGVLTQHGD----DPMRLAQGMILLPNNRAIRSVSDAF 57

Query: 65   IEITGKKSTILPIIKSLGD--VVEEKFTADLLLSYN---LNPPVSNIQRLLELARLILIW 119
            +  +G    +LP + +LGD  + E+   A   L  +   + P ++ ++R + LAR++   
Sbjct: 58   VRKSGG-GLLLPRLVALGDPDLGEQVGGALDPLGEDDDPIPPAIAPMRRQMILARMV--- 113

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALK-NEKYG 178
                         +   + P+    A+ LA+ L  ++D I+ E      L  L  +++  
Sbjct: 114  -------------QQASAHPVDAGQALKLAQALGAVLDQIQVERLSVAALADLTLSDELS 160

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTG 237
              W  +     I    W + L  L        +  L+   A    K   +G +I+AG + 
Sbjct: 161  RHWQTSLKLFGILLAQWPQELSRLGCIDLADRRNRLLERVAARWAKAPPEGFVIVAGMST 220

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNT--TYSTHPQYS 295
            + PA A L+  +A  P GA+V  GLD  +    W+ I     +  +      + THPQY+
Sbjct: 221  TAPAIAGLLRRIALMPKGAVVFAGLDQEMDRDAWDAIGPFDADPLTGRAPAGHETHPQYA 280

Query: 296  LAKLLDFLDIKREDVK--RLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPNI 352
            L +LLD +   R+DV   R G+  +    R   IS + LPP  TS  R+       +   
Sbjct: 281  LKRLLDRMSATRDDVALWRWGSEHDARAVRGRNISNAMLPPRLTSRWRD-------LKTA 333

Query: 353  QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
             +  + V  +E     EEA +IAIALR +++   + +AL+T DR LA RV   L R+GI 
Sbjct: 334  DRSLAGVEALEVATPGEEAQAIAIALREAVETPGRTAALVTPDRQLATRVSAHLRRWGIE 393

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
             D SAG+PLS     ++L ++  A+ +    +A+ TL+KHPL   G            L+
Sbjct: 394  ADDSAGLPLSRLPPGTLLIAMAEALAERFAPVALLTLLKHPLVMRGEERLGWLEGVRGLD 453

Query: 473  LVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532
            L+ LRG +    I+ L  L+ +R    ++   V   ++RL   +    +  ++       
Sbjct: 454  LL-LRGPRPQAGIVGLDLLLAER--DGEDRQCVLRGRTRLWWAEARALLEPLEQAFLAAP 510

Query: 533  PLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII 592
             L           G LS                         +W   +G   + LF+++ 
Sbjct: 511  DLAAQLAAIREHAGRLSHD----------------------AVWAGHQGHAAADLFAEME 548

Query: 593  ETGS--CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLN 650
            E  S    +A+      +   L+ G +V+P       + ILG +E+RL+  D +ILGGLN
Sbjct: 549  EAASEGPRQADIRALPALFDHLLGGVSVRPPQGGHPRIAILGLIEARLVQTDLIILGGLN 608

Query: 651  EGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPT 710
            EG WP   A +P+L+  ++ ++ L   E  IG AAHDF  A G   ++ TR+ R +  P 
Sbjct: 609  EGTWPGLPAPDPWLAPRIRREIGLPGLESRIGLAAHDFASALGAPQILITRARRGSGGPA 668

Query: 711  IASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            +ASR+  RL  + G  +     K    Y    + +D+  +     RP P PPL  +P+  
Sbjct: 669  VASRFWLRLKAMAGPQW-----KSAGRYAALAQAIDHAAEHRPAGRPAPVPPLSVRPKVI 723

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
              +++ +L  DPYA YARRIL+L  +     D     RGT  H    E++++     + +
Sbjct: 724  PVTDVDRLKADPYAFYARRILRLARLDPVDADAGPAWRGTAVH----EILQQWAEAGSGD 779

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWR-HLFHKISHSFLEHEEKIQSSIEKIFVNIPAKM 889
            +  L  +   + F++ ++ P +  +W+  L   I     E    + +  + + V I  + 
Sbjct: 780  LADLEAR-ARAMFDRPDVHPLLKALWQPRLIEAIRWIAAEVASDLAAGRKILAVEIEGRA 838

Query: 890  AIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSF 949
             I   G+ LTG ADRIDLL  G + I DYKTG  P     +     QL L     +   F
Sbjct: 839  EIA--GVTLTGKADRIDLLPDGKLGIVDYKTGKPPSARQVKAGYALQLGLLGLIAEHDGF 896

Query: 950  SQIDCRKVANLF-YIRLKQKFK--------IDCITNDKKKYSADELSEKSLKNLIEIVTL 1000
                   VA  F Y  L +K          +D +    K  +AD  + +      ++   
Sbjct: 897  PGTHPAPVAGGFEYWSLAKKGDSFGYRESPVDPLGKRDKIVTAD-FTSQVYSQFEDVAAA 955

Query: 1001 LQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
               G+ PF + +   E +N   +YD L R+ EW
Sbjct: 956  WLTGQAPFDAQVN-PEVANY-GDYDQLMRLEEW 986


>gi|163742589|ref|ZP_02149975.1| hypothetical protein RG210_06869 [Phaeobacter gallaeciensis 2.10]
 gi|161384174|gb|EDQ08557.1| hypothetical protein RG210_06869 [Phaeobacter gallaeciensis 2.10]
          Length = 977

 Score =  319 bits (818), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 293/1043 (28%), Positives = 466/1043 (44%), Gaps = 101/1043 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F +     F R    AL++G +    R    +P  LA V + V T R  + +R  F 
Sbjct: 9    PRLFAVPCGVDFPR----ALVDGLVA---RSQNTSPEELAKVELIVNTSRMARRVRDLFD 61

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            +     + +LP I  L D+      A L     L P +  ++R LEL++LI     KL +
Sbjct: 62   Q---GPALLLPRISLLSDL---DMRATL---RGLPPALPPLRRRLELSQLI----AKLLE 108

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL   S L           L+ +LA + D ++ E    E + +L        W  A 
Sbjct: 109  AQPDLAARSSLYD---------LSDSLAALFDEMQGEGVSPEIIRSLDVSDMSGHWARAQ 159

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARL 245
             F+ IA ++       ++A +    Q+ L   E E      + P+I+AGSTGS   T  L
Sbjct: 160  QFIAIADEFAETHEHAMDAQA-RQRQVVLDLIE-EWQDSPPQHPVILAGSTGSRGTTLML 217

Query: 246  MSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDI 305
            M  +A  P GA++LPG D   P  +W  + +   +          HPQY   K++  LD+
Sbjct: 218  MEAIARLPQGAVILPGFDDQQPGHVWEHLDDPLMS--------EDHPQYRFFKIMRDLDM 269

Query: 306  KREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCFSDVALIE 363
              + V+   +       R+ ++S +  P   +D  MR    L +    I +  +DV+L+E
Sbjct: 270  TPDQVRPWVDAIPASMARNRLVSLALRPAPVTDAWMREGPELRD----IDQATADVSLVE 325

Query: 364  ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLST 423
            A N R EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG PL  
Sbjct: 326  APNPRAEALAIALRLRKAA-EDGQTAALITPDRMLTRQVAAALDRWDILPDDSAGQPLQL 384

Query: 424  TLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSY 483
            +     L  +     K      + TL+KHPL   G       R    LEL   R  +   
Sbjct: 385  SPPGRFLRHIAELFCKPLACDTLLTLLKHPLCHDGVGRGDHLRHTRELEL---RLRRYGP 441

Query: 484  DIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNS 543
               D  S      A +     +P W + L+               QC          +  
Sbjct: 442  PFPDPDSFA----AFEIGRELMPGWTAWLT---------------QCFA--------EKP 474

Query: 544  TCGNLSISDWTKLTVTCLQNVCLDEHRKLPN-----LWFEEEGKTLSSLFSKI-IETGSC 597
              G   +S W    +  L+N+     R   N     LW ++ G+    + + +  E G  
Sbjct: 475  ISGTQPLSQW----IDALRNLAEAISRGSQNAADGGLWDKKAGRKALEIINNLQAEAGYG 530

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
             +  A ++ D++  L+    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP+ 
Sbjct: 531  GQMTARDFADLLRALLSQGEVRDRDAPYGSILIWGTLEARVQGADLVILGGLNEGSWPEA 590

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
               +P+L+R ++    L   E+ IG +AHDF+ A     +  TRS R +   T+ SRWL 
Sbjct: 591  ATPDPWLNRQLRHQAGLLLPERRIGLSAHDFQQAVAAPEVWLTRSERSDEADTVPSRWLN 650

Query: 718  RLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            R+  L       GG     +++ RGQ +L W   L+  T  P  KRP P PP+ A+PR  
Sbjct: 651  RITNLLSGLPGQGGPAALADMRARGQEWLGWAEVLEAPTSLPPAKRPAPRPPVAARPRRL 710

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            + +EI +LI DPYA+YA+ +LKL  +    ++PD   RG + H I+ + IK  +      
Sbjct: 711  TITEIPRLIRDPYAIYAKHVLKLRPLDPLVQEPDALLRGIVLHKILEDFIKASVTDPKRL 770

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
                      +H E +   P    +W     +I+  F+  E++ Q+  +     +   + 
Sbjct: 771  TVPDFLTTATAHLEAKVPWPVARSLWLARLERIAEDFITGEQQRQAIAQPSGFEVSGAVR 830

Query: 891  IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
            +  +   + G ADRID+ + G + + DYKTGD P  E+ QK  + QL +EAA  + G+F 
Sbjct: 831  VAPLDFEIAGTADRIDVDERGGLHLFDYKTGD-PPTESQQKTFEKQLLIEAAMAERGAFE 889

Query: 951  QIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFIS 1010
            +    +V    ++ LK   K      +      DE   K  + L ++++     +Q + S
Sbjct: 890  RYGEGRVERALFLGLKSPLK------EVAAPLLDEPPSKVWEELTKLISAYFEPDQGYSS 943

Query: 1011 HLRLSEKSNIQSEYDHLARVAEW 1033
              R+  +     +YDHLAR  EW
Sbjct: 944  R-RMVFQDTQTGDYDHLARYGEW 965


>gi|329847171|ref|ZP_08262199.1| double-strand break repair protein AddB [Asticcacaulis biprosthecum
            C19]
 gi|328842234|gb|EGF91803.1| double-strand break repair protein AddB [Asticcacaulis biprosthecum
            C19]
          Length = 999

 Score =  318 bits (815), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 302/1058 (28%), Positives = 473/1058 (44%), Gaps = 116/1058 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  FTI    PF  ++   L   +L ++          L    I  PT+R  + +   F 
Sbjct: 12   PRWFTIPSGRPFLDDLARGLCR-SLGKD----------LPEAQILTPTRRGARAMARAFS 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADL-LLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
              T   + +LP I+++GD+ E +   DL  L  +L   +S+++R  ELARLI        
Sbjct: 61   TQTRGGALLLPQIRAIGDLDEGEPPFDLEALGLDLPSAISSLRRRFELARLIT------- 113

Query: 125  DIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWED-LHALKNEKYG----- 178
            +  K L   +     +S   A+ LA +LA   D +  EE    D LH+L   + G     
Sbjct: 114  EHYKGLEGRN-----VSGKLALELADSLAKFFDSLALEEVDATDRLHSLVTGQGGDQYSL 168

Query: 179  -MW---WLLAADFLKIASKYWTERLVELNASSPVGYQIALMR----AEAEHLMKGTKGPI 230
              W   W ++A FL IA + W +RL EL    P   Q+ L+R       EH     K P+
Sbjct: 169  DSWAQHWQVSAQFLAIAVEAWPKRLSELGMMDPSQRQVTLIRRLINQWTEH---PPKTPL 225

Query: 231  IIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYST 290
            I+AG+TGS P+TA L   VA    GA+VLPGLD  +    W+ I +             +
Sbjct: 226  ILAGTTGSAPSTADLAKVVAAASMGAVVLPGLDLSLADDAWDQIED-------------S 272

Query: 291  HPQYSLAKLLDFLDIKREDVK----RLGNVSNEMYGRSMVISKSFLPPD-TSDMRN--TD 343
            HPQ ++ ++LD  ++ R  V+     L +   +   R  +++++  P + T D R+    
Sbjct: 273  HPQGTMKRMLDRHNVARATVRVWPVSLEDDRRKANARRRLLNEALRPAEATKDWRDQIAA 332

Query: 344  ILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVK 403
            +       I      +  I A  + E A  IA+ +R +L+   K  AL+T D  LARRV 
Sbjct: 333  LRAESDTAIDDGLDGLTEINAARDEEAATVIALLMRETLETPGKTVALVTPDLTLARRVS 392

Query: 404  LELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKY 463
              LTR+G+  D SAG PL+ +     L  LL  +    D +AI +L  HP   F      
Sbjct: 393  ARLTRWGLQADSSAGEPLANSPTGRFLLDLLTLLQTPCDPVAILSLWGHPACLFA----- 447

Query: 464  LSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLL 523
                +  +E+  LRG   +    D+ S+   R A  + N     W               
Sbjct: 448  TDPGRTHVEMYGLRGATPN----DMDSV---RAALIERNRATDLW--------------- 485

Query: 524  VDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT 583
             D     I P+        S  G  +    T++T    +++ LD+ + L   W    G +
Sbjct: 486  -DRYAAAILPVAEMPI---SDLGEAA----TRITRLA-ESLSLDDGQAL---WTGAAGAS 533

Query: 584  LSSLFSKIIETGSCIKANAIEWI-DIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFD 642
             + L + +I  G+    + +  + DI+ +LI    V+        L ILG +E+R++  D
Sbjct: 534  AAELLAGLIREGAGYTVDTLRDVADILGQLIRNGKVRTGGNTHPRLLILGAIEARMVTAD 593

Query: 643  TLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF-EMANGTRHLIYTR 701
             LIL GL EGVWP+    +PFLSR M++ L L + E+  G +AHDF + A+     + TR
Sbjct: 594  RLILAGLEEGVWPQAPDLDPFLSRPMRAALGLPSPERRTGLSAHDFVQAASAPECFLVTR 653

Query: 702  SLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLD--YTTKQPHYK---R 756
              RE   P + SRWL RL  L      D +   G+ +LDW R LD   + K    K   R
Sbjct: 654  HRREGE-PQVQSRWLWRLQTLCKGAKVD-IPSDGR-WLDWARALDRGLSDKPAALKPAVR 710

Query: 757  PKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNII 816
            P P PP+EA+P+  S +E++  I DPYA+YA+ +L L  +    +  +   RGT  H  +
Sbjct: 711  PNPKPPVEARPKKLSVTEVEVFIRDPYAIYAKHVLALRPLDRPNEPVEGRQRGTAIHKSL 770

Query: 817  TELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQS 876
               + +        I+ L   ++        L P    + + L   ++  F+  E   ++
Sbjct: 771  ERFVTEDTPLGKAGIDRLC-DLLHEELAATRLSPAQMALQKPLLPGMAAEFIRFEADRRA 829

Query: 877  SIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQ 936
               K+ +    ++ I      L   ADRI+L   G VDI D+KTG  P  +       PQ
Sbjct: 830  HRPKLHIEQRGELKIGD--FTLVAKADRIELRDDG-VDILDFKTGAAPSAKAVAAGFYPQ 886

Query: 937  LSLEAAALKAGSFSQIDC-RKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLI 995
            L+L AA LK G F+ I   R + +L Y+R+            K  ++ D L++ +L +L 
Sbjct: 887  LTLTAAILKQGGFADIRADRPLGDLLYVRVSPDVTKPQSAVQKGLFAHD-LADAALNSLR 945

Query: 996  EIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +      ++ ++S            +YD LAR+ EW
Sbjct: 946  RRIFAYAEADKGYLSWTAPQFLKTRAGDYDQLARLYEW 983


>gi|307292810|ref|ZP_07572656.1| double-strand break repair protein AddB [Sphingobium chlorophenolicum
            L-1]
 gi|306880876|gb|EFN12092.1| double-strand break repair protein AddB [Sphingobium chlorophenolicum
            L-1]
          Length = 991

 Score =  317 bits (813), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 284/1055 (26%), Positives = 462/1055 (43%), Gaps = 101/1055 (9%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P +F I    P  R    AL+ G L ++      +P+ LA   I +P  RAI+ +   F
Sbjct: 6    RPALFNI----PAHRAFSDALVAGVLAQHGD----DPMRLAQGMILLPNNRAIRSVSDAF 57

Query: 65   IEITGKKSTILPIIKSLGD--VVEEKFTA-DLLLSYNLNPP-VSNIQRLLELARLILIWR 120
            +  +G    +LP + +LGD  + E+   A D L      PP ++ ++R + LAR++    
Sbjct: 58   VRKSGG-GLLLPRLVALGDPDLGEQVGGALDPLGEDEAVPPAIAPMRRQMILARMV---- 112

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALK-NEKYGM 179
                        +   + P+    A+ LA+ L  ++D I+ E      L  L  +++   
Sbjct: 113  ------------QQASAHPVDAGQALKLAQALGAVLDQIQVERVSVAALADLTLSDELSQ 160

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIIIAGSTGS 238
             W  +     I    W + L  L        +  L+ R  A       +G +I AG + +
Sbjct: 161  HWQTSLRLFGILLAQWPQELARLGYIDLADRRNRLLDRVAARWAKAPPEGFVIAAGMSAT 220

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNT--TYSTHPQYSL 296
             PA A L+  +A  P GA+V  GLD  +    W  I     +  +      + THPQY+L
Sbjct: 221  APAIAGLLRRIALLPKGAVVFAGLDQEMDGDAWEAIGPFDADPLTGRAPAGHETHPQYAL 280

Query: 297  AKLLDFLDIKREDVK--RLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPNIQ 353
             +LLD +   R+DV   R G+  +    R   IS + LPP  TS  R+       +    
Sbjct: 281  KRLLDRMSATRDDVALWRWGSEHDARAVRGRNISNAMLPPRLTSRWRD-------LKTAD 333

Query: 354  KCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINI 413
            +  + V  +E     EEA +IAIALR +++   + +AL+T DR LA RV   L R+GI+ 
Sbjct: 334  RSLAGVEALEVATPGEEAQAIAIALREAVETPGRTAALVTPDRQLATRVSAHLRRWGIDA 393

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D SAG PLS     ++L ++  A+ +    +A+ TL+KHPL   G            L+L
Sbjct: 394  DDSAGQPLSRLPPGTLLIAMAEALAERFAPVALLTLLKHPLVMRGEERLGWLEGVRGLDL 453

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
            + LRG +    I+ L  L+ +R    ++   V   ++RL   +    +  ++        
Sbjct: 454  L-LRGPRPQAGIVGLDLLLAER--EGEDRQRVLRARTRLWWAEARALLEPLEQAFLAAPD 510

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
            L           G LS                         +W   +G   + LF+++ E
Sbjct: 511  LAAQLAAIREHAGRLSHD----------------------AVWAGHQGHAAADLFAEMEE 548

Query: 594  TGS--CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
              S    +A+      +   L+ G +V+P       + ILG +E+RL+  D +ILGGLNE
Sbjct: 549  AASEGPRQADIRALPALFDHLLGGVSVRPPQGGHPRIAILGLIEARLVQTDLMILGGLNE 608

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTI 711
            G WP   A +P+L+  ++ ++ L   E  IG AAHDF  A G   ++ TR+ R +  P +
Sbjct: 609  GTWPGLPAPDPWLAPRIRREIGLPGLESRIGLAAHDFASALGAPQILITRARRGSGGPAV 668

Query: 712  ASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYS 771
            ASR+  RL  + G  +     K    +    + +D+  +     RP P PPL  +P+   
Sbjct: 669  ASRFWLRLKAMAGPQW-----KSADRHAALAQAIDHAAEHRPASRPAPVPPLSVRPKVIP 723

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEI 831
             +++ +L  DPYA YA+RIL+L  +     D     RGT  H    E++++     + ++
Sbjct: 724  VTDVDRLKADPYAFYAKRILRLARLDPVDADAGPAWRGTAVH----EILQQWAEAGSSDL 779

Query: 832  NHLMKQIIDSHFEKENLPPHIDIIWR-HLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
              L  +   + F++ ++ P +  +W+  L   I     E    + +  + + V I  +  
Sbjct: 780  TDLEAR-ARAMFDRPDVHPLLKALWQPRLIEAIRWIAAEVASDLAAGRKILSVEIEGRAD 838

Query: 891  IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEA--------- 941
            I   G+ LTG ADRIDLL  G + I DYKTG  P     +     QL L           
Sbjct: 839  IA--GVTLTGKADRIDLLPDGKLGIVDYKTGKPPSARQVKAGYALQLGLLGLIAEHDGFP 896

Query: 942  ---AALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIV 998
               AA  AG F      K  + F  R   +  +D +    K  +AD  + +      ++V
Sbjct: 897  GTHAAPVAGGFEYWSLAKKGDAFGYR---ESPVDSMGKRDKIITAD-FTSQVYAQFEDMV 952

Query: 999  TLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                 G  PF + +   E +N   +YD L R+ EW
Sbjct: 953  AAWLTGSAPFDAQVN-PEVANY-GDYDQLMRLEEW 985


>gi|259417393|ref|ZP_05741312.1| double-strand break repair protein AddB [Silicibacter sp. TrichCH4B]
 gi|259346299|gb|EEW58113.1| double-strand break repair protein AddB [Silicibacter sp. TrichCH4B]
          Length = 977

 Score =  317 bits (813), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 296/1050 (28%), Positives = 475/1050 (45%), Gaps = 105/1050 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F +     F R    AL++G L++ F   P  P  LA V + + T+R  + +R  F 
Sbjct: 9    PRLFAVPCGVDFPR----ALVDG-LIQRFADQP--PEALARVELILNTERMQRRVRQLF- 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                  + +LP +  L  + ++   A+L     L P +  ++R LEL++LI     KL D
Sbjct: 61   --DSGPARLLPRVSLLSGLSKQ---ANL---RGLPPALPPLRRRLELSQLI----AKLLD 108

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL   S L           L+ +LA++ID +++E    + + AL        W  A 
Sbjct: 109  AQPDLAARSSLYD---------LSDSLAELIDEMQSEGVTTDQIRALDVSDMSGHWKRAQ 159

Query: 186  DFLKIASKY--WTERLVELNASSPVGYQIAL-MRAEAEHLMKGTKGPIIIAGSTGSIPAT 242
            DF+ IA ++    E  +++NA      Q+ L +  E EH     + PII+AGSTGS   T
Sbjct: 160  DFIGIADQFVEMHEGALDVNARQ---RQVVLDLITEWEH--TPPQHPIILAGSTGSRGTT 214

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDF 302
              LM  +   P GA+VLPG D   P  +W+++ +              HPQY   KL+  
Sbjct: 215  LLLMEAITRLPQGAVVLPGFDFDQPEDVWDSLND--------GLVAEDHPQYRFFKLMRD 266

Query: 303  LDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALI 362
            LD++  D++   +       R+ +IS +  P   +D   T+     + ++ +    + LI
Sbjct: 267  LDLRPRDIRAWVDTKPVSPPRNKLISLALRPAPVTDAWMTE--GPHLTDLDQATDALTLI 324

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
            EA + R EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG+PL 
Sbjct: 325  EAASPRSEALAIALRLRQAA-EDGQTAALITPDRMLTRQVSAALDRWNILPDDSAGLPLQ 383

Query: 423  TTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNS 482
             +     L  + +   +      + TL+KHPL+  G            LEL   R     
Sbjct: 384  LSPPGRFLRHVADLFCRPLQADMLLTLLKHPLSHSGEERGLHLLHTRDLELHMRRYGPPF 443

Query: 483  YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKN 542
             D   L +    R          P W   L++                     ++   + 
Sbjct: 444  PDHESLSTFGTTRDLQ-------PGWSDWLAQ---------------------SFAGREQ 475

Query: 543  STCGNLSISDWTKLTVTCLQNVCLDEHRK-LPNLWFEEEGKTLSSLFSKI-IETGSCIKA 600
            +  G  ++SDW     T  + +           LW ++ G+    +F ++  E     + 
Sbjct: 476  T--GLRALSDWVADLRTTAEFIAAGSQTGGAGELWDKKAGRKALEIFQELEAEAPHGGEM 533

Query: 601  NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAK 660
             A +  D++  L+    V+ +     ++ I GTLE+R+   D +ILGGLNEG WP+  + 
Sbjct: 534  TARDLADLLGALLSQGEVRDRDAPYGSIMIWGTLEARVQGADLVILGGLNEGSWPEAASP 593

Query: 661  NPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLL 720
            +P+L+R ++ +  L   E+ IG +AHDF+ A     +  TR++R     T+ SRWL R+ 
Sbjct: 594  DPWLNRKLRHEAGLLLPERRIGLSAHDFQQAVAAPEVWLTRAIRSEEADTVPSRWLNRMT 653

Query: 721  VL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFS 773
             L       GG      ++ RGQ +LDW   LD     P   RP P PP+ A+PR  + +
Sbjct: 654  NLLGGLPDQGGQAALSAMRMRGQVWLDWASVLDAPLPSPLSPRPSPRPPVAARPRRLTVT 713

Query: 774  EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH 833
            EI +LI DPYA+YA+ +L+L  +    + PD   RGT+ H ++ + IK    +  PE   
Sbjct: 714  EIPKLIRDPYAIYAKHVLRLKPVDPLLQKPDALLRGTIIHKVLEDFIKS--AQEQPETLT 771

Query: 834  LMKQIIDSH--FEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAI 891
                I  S    E E   P    +W     K++  F+  E + Q            ++ +
Sbjct: 772  ARAFIEQSQRVLEAEVPWPVARTLWLTRLKKVAEDFVAGERERQLRARPSGFEKSGQVRL 831

Query: 892  ESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQ 951
            + +   +   ADRID+ + G + + DYKTGD P  E  QK  + QL +E A  + G+F  
Sbjct: 832  DPLDFEIAAKADRIDVDERGMLHLYDYKTGD-PPSEKQQKSFEKQLLIETAMAEQGAFED 890

Query: 952  IDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQ---NGEQPF 1008
                +V    YI LK            K+ +A  L E   K   E+ +L++   + EQ +
Sbjct: 891  YGAARVERSLYIGLKPPV---------KEVAAPILDEPPAKVWEELRSLIEAYFDAEQGY 941

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
             S  R+  + +   +YDHLAR  EW    D
Sbjct: 942  SSR-RMVHRDDFAGDYDHLARYGEWDRSSD 970


>gi|163745130|ref|ZP_02152490.1| hypothetical protein OIHEL45_06065 [Oceanibulbus indolifex HEL-45]
 gi|161381948|gb|EDQ06357.1| hypothetical protein OIHEL45_06065 [Oceanibulbus indolifex HEL-45]
          Length = 985

 Score =  317 bits (812), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 298/1042 (28%), Positives = 468/1042 (44%), Gaps = 90/1042 (8%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F +AP   F R     L+ G L +    DP  P  +A V + V T R  + LR +F 
Sbjct: 8    PRIFGLAPGVDFPR----GLVRG-LCDRLENDP--PEAMARVELIVNTNRMARRLRHDF- 59

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                  +  LP I+ + D+        L     L  P   +QR LEL +L+    ++L D
Sbjct: 60   --DAGPAGFLPRIRLITDLDA------LAPGVALPAPTPPLQRRLELIQLV----SRLLD 107

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL P   L           L+ +LA +ID ++ E    E +  L        W  A 
Sbjct: 108  AAPDLAPRESLYA---------LSDSLAGLIDEMQGEGVSPETVAGLDVGHLSAHWERAQ 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARL 245
             FL IA  Y  +     +A +     +A +    +      + P+I+AGSTGS   TA L
Sbjct: 159  RFLAIAHDYLGQTTTRPDAEARRRQLVARIIVRWQD--NPPQHPVILAGSTGSRGTTALL 216

Query: 246  MSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDI 305
            M  VA  P GAI+LPG D  +PTA+WN + +              HPQY   KL++ L +
Sbjct: 217  MEAVARLPQGAIILPGFDFEMPTAVWNELDQA--------LLAEDHPQYRFRKLMNMLGV 268

Query: 306  KREDVKRLGNVSNEMYGRSMVISKSFLP-PDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
             R  ++   ++      R+ ++S S  P P T    N      K+ ++    +D+ LIEA
Sbjct: 269  SRGAIEPWCDMPAVSMARNTLLSLSLRPAPVTHAWLNEG---PKLNDLHGATADITLIEA 325

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
               R EA++IA+ LR +  E+  K+ALIT DR L R+V   L R+ I  D SAG+PL  +
Sbjct: 326  PTPRVEALAIALRLRQAA-EDGVKAALITPDRMLTRQVTAALDRWNILPDDSAGMPLQLS 384

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
                 L  +     +  D  A+ TL+KHPL   G    +       LE   +R +   Y 
Sbjct: 385  PPGRFLRHVAALFLRKLDAEALLTLLKHPLTHSGAGRNFHQLYTQRLE-AEIRRHGLPYP 443

Query: 485  IMDLKSLVLDRIATQ-KNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNS 543
              +  + + +R A + ++ +    W + + E           H      PL       + 
Sbjct: 444  DAEGLTEIAERTAKRMEDPSGFRDWIAWVGET-------FPGHDAPGERPL------PDC 490

Query: 544  TCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKA-NA 602
               +L++++     +   Q    D       LW    G     +   + E      A NA
Sbjct: 491  VAAHLALAN----RIAAGQPADPDHL-----LWQHGAGIAAQGVMENLTEHAVHGGAMNA 541

Query: 603  IEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
             ++ D++  L+  E V+        + I GT+E+R+   D +ILGGLNEG WP+    +P
Sbjct: 542  ADYADLLGALLSQEEVREADTPHPDIMIWGTMEARVQGADLVILGGLNEGTWPEAPPPDP 601

Query: 663  FLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVL 722
            +L+R M+    L   E+ +G +AHD++ A  +  +  TR++R +    + SRWL RL  L
Sbjct: 602  WLNRQMREKAGLLLPERRVGLSAHDYQQAIASPEVWITRAIRSDEAEMVPSRWLNRLGNL 661

Query: 723  GGT-------DFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
             G        + +  +++RG  +LD  R L+   +     RP P PP  A+PR  S +EI
Sbjct: 662  LGGLGETGGPEAWKAMQQRGSYWLDQVRALEAVERTAPAPRPSPRPPRAARPRKLSVTEI 721

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINH-L 834
            K LI DPYAVYA+  LKL  I    + PD   RG + H I+ + +K  + ++   + H  
Sbjct: 722  KTLIRDPYAVYAKHSLKLRAINPLVQSPDAPVRGIVLHRIMEDFVKL-VARDPARLTHEA 780

Query: 835  MKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA--IE 892
            + ++     E+E   P    +W     +I+  F+  E         +     A+ +    
Sbjct: 781  LLEVAAQVLEEEAPWPAARAMWLARIDRIADWFIARERTRAEFSSPVAFEQGARGSHTFA 840

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
             +G  L+GFADRID    G V I DYKTG  P K+  Q+L D QL +EAA ++ G F ++
Sbjct: 841  DLGFTLSGFADRIDQTDDGDVLIYDYKTGTPPGKKE-QRLFDKQLLIEAAMVERGGFPEV 899

Query: 953  DCRKVANLFYIRLKQK-FKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISH 1011
                VA+  +I L  K  ++    +       +E  ++ L  L  +++   +  Q F + 
Sbjct: 900  GVAHVAHAAFIGLGSKPVEVPAPLD-------EESPQEVLAGLHALLSRYLDEGQGFTAR 952

Query: 1012 LRLSEKSNIQSEYDHLARVAEW 1033
             R+ +       YD LAR  EW
Sbjct: 953  -RMVQSDAFAGNYDQLARFGEW 973


>gi|254438249|ref|ZP_05051743.1| double-strand break repair protein AddB [Octadecabacter antarcticus
            307]
 gi|198253695|gb|EDY78009.1| double-strand break repair protein AddB [Octadecabacter antarcticus
            307]
          Length = 977

 Score =  316 bits (809), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 279/1052 (26%), Positives = 464/1052 (44%), Gaps = 108/1052 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +    P  ++   AL +G       ++P+ P  +A V IYV T+R  + L S F 
Sbjct: 8    PRVFGV----PLGQDFSRALYDGLKAS---FEPMAPTDVACVEIYVNTRRMQRHLTSLFH 60

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
            +     + +LP I+ + D+ ++    D+       P ++ ++R LE+A+L+         
Sbjct: 61   Q---GDALLLPRIRLITDLAQDAVGRDI------PPAIAPLRRRLEVAQLV--------- 102

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
              K L    P     S   AI LA +L  ++  ++ E    E +  L        W  A 
Sbjct: 103  --KGLIDADPTL--ASQDAAIDLADSLVALMSEMQGEGVAPETVANLDVTDQSGHWQRAL 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIIIAGSTGSIPATAR 244
             F+++  +++ +  ++       G Q  ++    E         P+I+AGSTGS  AT+ 
Sbjct: 159  SFIQLVQQFFVDDRLDGE-----GRQRHVIETLVERWADAPPNHPVIVAGSTGSRGATSL 213

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
             M  VA  P GA++LPGLD  +P  +W+ + +K             HPQY      D L 
Sbjct: 214  FMQAVAKLPQGAVILPGLDHDMPAHVWDMMEQKKGG--------EDHPQYRFKAFCDALG 265

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            I+  D++  G+ +     R+ +IS S  P   +     D     + ++ +    + LIEA
Sbjct: 266  IRPSDIRTWGDKTKINVARTGLISLSLRPAPVTHQWIND--GPDLGDLGEATKGITLIEA 323

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
               R +A +IA  LR ++ E+++ +ALI+ DR L R+V   L R+ I  D SAG+PL  T
Sbjct: 324  PTPRAQADAIAARLRQAV-EDRQTAALISPDRMLTRQVTAALDRWDITPDDSAGLPLQLT 382

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYD 484
                 L  + +   +  D   +  L++HPL         L    NALEL   R       
Sbjct: 383  APGRFLRHIADLFCEPLDAERLLVLLRHPLCNSERGNHGLH--TNALELEVRRNGPPFPT 440

Query: 485  IMDLKSLVLDRIATQKNNTHVPHW--QSRLSEED---KELAVLLVDHILQCITPLVTYKT 539
               L +          +     HW   + L+ +D    EL   L +H+   I+  +    
Sbjct: 441  DESLTNWADGTKDKHPDRVAWVHWIGATLLNLKDPRPHELGTFLDEHV--KISERLAAGP 498

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI---IETGS 596
            N + +                              LW +  G+    L S++    + G 
Sbjct: 499  NTDGSG----------------------------ELWKKGAGREAFRLMSELRTHADAGG 530

Query: 597  CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
             + A     + + + L DGE  + + +    + I GTLE+R+ + D +IL GLNEG WP+
Sbjct: 531  VMTARDYRQL-VGSTLADGED-RDRDQGHPQVLIWGTLEARVQSADLVILAGLNEGTWPE 588

Query: 657  NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWL 716
                +P+L+R ++    L   E+ IG +AHD++ A   R ++ +R++R +   T+ SRW+
Sbjct: 589  TPTPDPWLNRPLRMRAGLLLPERRIGLSAHDYQQAVCAREVVLSRAVRSDEAETVPSRWI 648

Query: 717  QRLL-VLGGTD------FFDNLKKRGQCYLDWTRKL---DYTTKQPHYKRPKPFPPLEAQ 766
             RL  +LGG D      + D +++RGQ +L  T  +    +T        P P    + +
Sbjct: 649  NRLTNLLGGLDEKGGPAYLDAMRERGQHWLTLTASIAAPPFTVDPAPRPSPCPP--TDVR 706

Query: 767  PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK 826
            P   S ++IK LI DPYA+YAR+IL L+ +      PD   RGT+ H ++   +K  I+ 
Sbjct: 707  PDRLSVTQIKTLIRDPYAIYARKILGLNSLDSLAHTPDAPLRGTIVHKVLERFVKANIDP 766

Query: 827  NTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIP 886
                    +  I     E+    P +  +W       +  FL  E+K ++    +   I 
Sbjct: 767  TNAGAAGALLAIATDVLEERCPWPAVRALWFARIASFTPHFLAEEQKRRAYSANVDTEIR 826

Query: 887  AKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKA 946
             ++ + ++   LTG ADRID+   G   I DYKTG  P     QK  D QL LEAA ++ 
Sbjct: 827  GELKLANLPFTLTGTADRIDMSNDGEALIYDYKTGKTPSP-AQQKYFDKQLLLEAAMVER 885

Query: 947  GSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQ 1006
            G+F+ +   +     YI L    K      D+     DE  +++      ++    +  +
Sbjct: 886  GAFTALGSVRTKAAVYIGLGSDLK------DQSAPLNDETPDETWARFEGLIAKWMDPSK 939

Query: 1007 PFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
             + S    +E  + +  YDHLAR  EW E +D
Sbjct: 940  GYTSR-SANEIVSFEGSYDHLARYGEWDETHD 970


>gi|254420230|ref|ZP_05033954.1| hypothetical protein BBAL3_2540 [Brevundimonas sp. BAL3]
 gi|196186407|gb|EDX81383.1| hypothetical protein BBAL3_2540 [Brevundimonas sp. BAL3]
          Length = 1031

 Score =  315 bits (808), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 285/1071 (26%), Positives = 469/1071 (43%), Gaps = 119/1071 (11%)

Query: 16   PFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTIL 75
            P +R  +  L  G L        L P  L+  TI +P +RA +       +++  +  +L
Sbjct: 18   PAYRPFLEDLAAGVLAW---LGDLPPETLSDATILLPNRRAARAFTGALSKLSQGRPILL 74

Query: 76   PIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPE 133
            P ++ LGD+ E++  FT   L   +L P +  + R  E+AR+I+           + +  
Sbjct: 75   PQVRPLGDLEEDEPPFTPGAL-GLDLPPAIPALTRRFEMARMIV-----------EQFDN 122

Query: 134  SPLSLPISPANAIWLAKNLADIIDIIETEE-KKWEDLHALKNEKYGMWWLLAADFLKIAS 192
            S     ++P  A+ LA  L   +D  + EE    E +  L + +    W  +A+FL +A 
Sbjct: 123  S-----LTPMRALDLADALGGFLDSCQLEEVPNPERIATLVDGEMAEHWERSAEFLGLAV 177

Query: 193  KYWTERLVELNASSPVGYQIALMRAEAE---HLMKGTKGPIIIAGSTGSIPATARLMSTV 249
            + W +RL EL    P   +  L+R  AE   H        +I AGSTG++PA   ++  V
Sbjct: 178  EAWPKRLAELGLVDPAWRRATLLRRLAELWDHTPPTQA--VIAAGSTGTVPAAGDVLKAV 235

Query: 250  ANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKRED 309
            A  P G +VLPGLD  +  A+W+ + E+             HPQ ++ +LLD +++ R D
Sbjct: 236  ARAPLGCVVLPGLDLDLDAAVWDRLDEQ-------------HPQSAMKRLLDRVEVARAD 282

Query: 310  VKRLGNVSN------EMYGRSMVISKSFLPPDTSD--------MRNTDILENKIPN-IQK 354
            V+     S           R  +++++  P + +D        +R+T     +  + I +
Sbjct: 283  VRPWFAPSQPPAALARGQARQRLVNEALRPAEATDDWRRAIRDLRSTAAARGEARDPIAE 342

Query: 355  CFSDVALIEADNEREEAISIAIALRMSL-----DENKKKSALITADRNLARRVKLELTRF 409
                ++L+    E E A +IA+ +R +L     D   +  AL+T D+ L RRV   L R+
Sbjct: 343  GLQGLSLLTVRAEEEAAAAIALMMRETLETPNPDGTGRTCALVTPDQALGRRVAARLERW 402

Query: 410  GINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKN 469
            G+  D SAG+PLS     +++      I        +  +VKHPL +F   +   + A  
Sbjct: 403  GVIPDSSAGVPLSRLPAGALVDLCARWIADPVQPHLLLAIVKHPLVRFDLGDAPQAAAVA 462

Query: 470  ALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHW-QSRLSEEDKELAVLLVDHI- 527
            ALE  ALRG +   D   ++  +L+ +   +     P W + RLS      A  LV+ + 
Sbjct: 463  ALEEHALRGPR-PRDFAAIRRRLLEAVEPDRRGKAPPEWKRERLSA-----ATRLVERLQ 516

Query: 528  --LQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLS 585
              ++  T +   +T +N    N + S +T+L  T              + W   +G+  +
Sbjct: 517  TAIEAATAVFLPQTERNGADLNAAASAFTRLIETLAGQ----------DAWAGPDGEAAA 566

Query: 586  SLFSKIIETGSCI-KANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTL 644
            +L S +IE G+ + + +  +  ++ T L+    V+       +L ILG +E+RL+  D +
Sbjct: 567  ALLSGLIEGGASLGRIDQTDLAELTTSLVRETVVRTGGATHPSLRILGAIEARLVRADRM 626

Query: 645  ILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLR 704
            IL GL EGVWP+    +PFLSR M+  L L   E+ +GQ A DF  A     +I   S R
Sbjct: 627  ILAGLEEGVWPQAAPTDPFLSRPMRKALGLPPPERRLGQTAQDFVQAACADEVILVHSER 686

Query: 705  ENNIPTIASRWLQRL--LVLGGTDFFDNLK-KRGQCYLDWTRKLDYTTKQPHYKRPKPFP 761
                P + SRWL RL  L  G       ++  R +  LDWTR LD          P P P
Sbjct: 687  RGGQPAVRSRWLWRLEMLTRGAHSAETPIELPRPRTVLDWTRALDA---------PPPGP 737

Query: 762  PLEAQPR-----------TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGT 810
            P  A+             +   + I++ + DPYA+YA  +L L+ +       +   RG 
Sbjct: 738  PRFAKRPEPRPPVHRRPRSLYVTRIERWVRDPYAIYALWVLGLEAMERPGASAEALARGN 797

Query: 811  LFHNIITELIKKRINKNTPEI-----NHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISH 865
              H  I  L     +    +      +HL++++    FE   +          L    + 
Sbjct: 798  AVHAAIERLTLDWPDDLPDDCEAVLHDHLLRELGARGFEDAAMAREA-----PLARNCAR 852

Query: 866  SFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLT--GFADRIDLLKSGFVDITDYKTGDN 923
               + E + ++    I V     M  ++     T   FADRI+L   G   + D+KTG  
Sbjct: 853  WLTDFERRRRARGIDILVEQQGTMTFDAPAGPFTVKAFADRIELASDGAA-VMDFKTGAA 911

Query: 924  PKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVAN-LFYIRLKQKFKIDCITNDKKKYS 982
            P  +  +    PQL+L AA L  G F + +     + L Y+R+  +     +        
Sbjct: 912  PSAKQVKSGFAPQLTLTAAILADGGFERTNGPVTPDELTYVRVVGRKTAGEVITRASGAE 971

Query: 983  ADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            A +L++ +L  L   V    +   P++S        N    YDHLARV EW
Sbjct: 972  AADLAQAALDGLKRRVARFDDENTPYVSWAAPQFMGNQGGNYDHLARVWEW 1022


>gi|296117284|ref|ZP_06835875.1| hypothetical protein GXY_15752 [Gluconacetobacter hansenii ATCC
            23769]
 gi|295976177|gb|EFG82964.1| hypothetical protein GXY_15752 [Gluconacetobacter hansenii ATCC
            23769]
          Length = 1049

 Score =  315 bits (806), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 278/1042 (26%), Positives = 457/1042 (43%), Gaps = 92/1042 (8%)

Query: 40   NPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNL 99
            +P    +  I +P++RA + L   F+     ++ +LP I  +  + E         + +L
Sbjct: 52   DPQRTGAGLILLPSRRAARALTEAFLRRADGRALLLPRIAPIAALDEAALALSGEAALDL 111

Query: 100  NPPVSNIQRLLELARLILIWRNKLPDI--IKDLYPESPLSLPISPANAIWLAKNLADIID 157
             P V  ++RL  L RL+L       D+  +   +P               LA+ LAD++D
Sbjct: 112  PPAVEPMRRLATLTRLVLQAGEAFGDVRTVDQAWP---------------LARALADLMD 156

Query: 158  IIETEEKKW-EDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMR 216
              E  E    E L    +  +   W L   FL I +  W   L E    +PV  Q+AL+ 
Sbjct: 157  EAEWAECDLRERLPDAADGDFAQHWHLTLKFLSIVTGVWPAWLEEQGVMNPVARQVALLH 216

Query: 217  AEAEHLMK-----GTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIW 271
            A+A H  +     G +  +  AG + ++P+T  ++ TV + P G +VL  +D  +    W
Sbjct: 217  AQAAHWRESPPPAGHR--LWAAGFSDAVPSTVAVLRTVLDLPGGRLVLTPVDMDMDARTW 274

Query: 272  NTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVK-----RLGNVSNEMYGRSMV 326
            + +                HPQ   A++L  L + R+ ++       G+ + +M G SM 
Sbjct: 275  SDLPPG-------------HPQAGTARMLADLGVGRDGLEVWDDLPAGSKAGDMAG-SMA 320

Query: 327  ISKSFLPPDTSDMRNTDILENKI------PNIQKCFSDVALIEADNEREEAISIAIALRM 380
                  PP  + + +  +L          P        ++++   +++EEA +IA+ LR 
Sbjct: 321  GGMVGAPPGRAALLSHALLPASALGQWLDPAPAPQLDGLSVLHTADQQEEAAAIALILRQ 380

Query: 381  SLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKL 440
            ++++  + +AL+T DR LA RV  EL R+G+  D SAG  L+TT  ++ L  ++ A+   
Sbjct: 381  AIEQPGRPAALVTPDRALAGRVATELARWGVVADDSAGEGLATTPQATFLRLIVQAVDGG 440

Query: 441  NDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQK 500
               +A+ +L+KHPLA  G        +   LE   LRG      I  L++  L R ATQ 
Sbjct: 441  LSPVALLSLLKHPLAACGLSPGNCRASARLLERAILRGPAPPPGIAGLRA-ALSR-ATQD 498

Query: 501  NNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLS--ISDWTKLTV 558
             +  +    +   +  +EL+  L D + + + PL++  +        LS  +     L  
Sbjct: 499  EHGAL----ADAPDAPQELSAFL-DRLERALDPLLSRASGMEEVVDLLSALVEVAQALAT 553

Query: 559  TCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWID-IITRLIDGET 617
            T               LW  EEG  L +  ++++     + A  +  +D ++   + G T
Sbjct: 554  TDAHADTEGGGDGASRLWSGEEGNALGAHLAELLTWCDVLPAQRVGALDGLLASSLAGVT 613

Query: 618  VKPKI-----EKSST---LFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQ 669
            V  +      E+++    +FI G LE+RL    T++LGGL E VWP  T   P++SR M+
Sbjct: 614  VHGRRALRGREQAAVHPRVFIWGLLEARLQTAGTIVLGGLVETVWPPATDPGPWMSRPMR 673

Query: 670  SDLNLKTAEKYIGQAAHDF-EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFF 728
            + + L + E  IGQAAHDF   A     ++ +   R    P +A+RWL RL      D +
Sbjct: 674  TRICLPSPECAIGQAAHDFIACACAAPEVVLSVPGRRQGAPAVAARWLVRL------DAY 727

Query: 729  DNLKKRGQCY-----LDWTRKLDYTTKQPHYKRPKPFPPLEA-QPRTYSFSEIKQLINDP 782
              L  RGQ       L W  +LD  +  P    P    P  A +PR+ S +EI+  + DP
Sbjct: 728  --LSGRGQALATHPALSWLERLDRPSGAPAPVAPPRPCPPVALRPRSLSVTEIEIWMRDP 785

Query: 783  YAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSH 842
            YA+YARRIL L  +   ++  D  D G + H  +     +  +    +    M ++ +  
Sbjct: 786  YAIYARRILGLKPLAGLEEMADAADYGEIVHEALDRWFTRYPDHWPRDGEEEMVRVFEQV 845

Query: 843  FEKENLPPHIDIIWRHLFHKISH--SFLEHEEKIQSSIEKIFVNIPAKMAIESIGIH--- 897
                 L P +   W     +I+   +  E   +   +   +   +  KM +         
Sbjct: 846  LHDARLRPALAAWWAPRLGRIARWCAMTEEARRAGGASCSVMTELSGKMELSGFSFGTFV 905

Query: 898  LTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKV 957
            L G ADRID    G + + DYKTG  P + +       QL LEAA ++AG F+     +V
Sbjct: 906  LRGRADRIDRDGEGGLSLFDYKTGTLPTRASVLAGWQSQLVLEAAMIEAGGFAPTVAGRV 965

Query: 958  ANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEK 1017
              L Y RL        + +  +     +L  K    L + V    N   P++SH    E+
Sbjct: 966  TELVYWRLTGGHVPARVLDIARGEELSDLIAKCRAGLYKRVADYDNPHMPYLSHPHPGEE 1025

Query: 1018 SNIQSEYDHLARVAEW---REE 1036
                ++Y HLARVAEW   REE
Sbjct: 1026 PRF-ADYAHLARVAEWSAAREE 1046


>gi|94496378|ref|ZP_01302955.1| helicase [Sphingomonas sp. SKA58]
 gi|94424124|gb|EAT09148.1| helicase [Sphingomonas sp. SKA58]
          Length = 989

 Score =  312 bits (800), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 284/1059 (26%), Positives = 457/1059 (43%), Gaps = 107/1059 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
              +P +FTI    P  R    AL+ G L ++ R D +    LA   + +P  RAI+ +R 
Sbjct: 4    RSRPALFTI----PAHRAFADALVTGLLAQH-RGDVMA---LAQAMVLLPNNRAIRAVRD 55

Query: 63   EFIEITGKKSTILPIIKSLGD--VVEEKFTA-DLLLSYNLNPP-VSNIQRLLELARLILI 118
             F+  +G    +LP + ++GD  + E+   A D L      PP +  ++R + LAR++  
Sbjct: 56   AFVRQSGG-GLLLPRLVAIGDPDLGEQVGGALDPLGEEEPIPPAIDPMRRQMLLARMV-- 112

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALK-NEKY 177
                     +D+ PE      +    A+ L + L  ++D ++ E      L  +  +   
Sbjct: 113  ---------QDVRPE------VDAGQALQLGQALGTVLDQMQVERISPRALRDIDLSADL 157

Query: 178  GMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIIIAGST 236
               W ++    +I    W   L  +        +  L  R  A   +    GP++ AG +
Sbjct: 158  SRHWQVSLTLFEILITRWPAELARIGCIDLADRRNRLFDRLTARWALHPPSGPVVAAGIS 217

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTT--YSTHPQY 294
             + PA ARL+  +A  PNG +V  GLD H+    W+ I     +  +      + +HPQY
Sbjct: 218  TTAPAIARLLRCIAETPNGMVVFAGLDQHMDADAWDAIGPFDPDPATGQRVPGHESHPQY 277

Query: 295  SLAKLLDFLDIKREDVK--RLGNVSNEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPN 351
            +L +LLD +   R+DV   R G+  +    R   IS + LPP  TS  R+       +  
Sbjct: 278  ALKQLLDRMSATRDDVAQWRWGSEHDARAVRGRNISNAMLPPRLTSRWRD-------LKT 330

Query: 352  IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGI 411
              +  + V  +E     EEA +IAIALR  L+   + +AL+T DR LA RV   L R+GI
Sbjct: 331  ADRSLAGVEALEVATPGEEAQAIAIALREVLETPARTAALVTPDRQLATRVSAHLRRWGI 390

Query: 412  NIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL 471
            + D SAG PLS     ++L ++  A+ +    + + TL+KHPL   G            L
Sbjct: 391  DADDSAGQPLSRLPPGTLLIAMAQAVAERFAPVPLLTLLKHPLVMRGDARIAWLDGVRGL 450

Query: 472  ELVALRGNKNSYDIMDLKSLVL-----DRIATQKNNTHVPHWQSRLSEEDKELAVLLVDH 526
            +L+ LRG +    +  +  LVL     DR  T ++      W +  +             
Sbjct: 451  DLL-LRGPRPQAGLHGI-DLVLRARDDDRQRTLRDQVRA-WWPTARA------------- 494

Query: 527  ILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSS 586
                + PL T         G L+     +   + L    +         W    G   + 
Sbjct: 495  ---LLEPLETAFATTTGLAGQLAA---LREAASLLSAEAI---------WAGHHGHAAAD 539

Query: 587  LFSKIIETG--SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTL 644
            LF+ +         +A+A     ++  ++ G +V+P       L ILG +E+RL   D +
Sbjct: 540  LFADMESAAPEGPRQADARALPALLDDMLSGLSVRPPQGGHPRLSILGLIEARLTQADVM 599

Query: 645  ILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLR 704
            ILGGLNEGVWP   A +P+L+  ++ DL L   E  IG AAHDF  A G   ++ TR+ R
Sbjct: 600  ILGGLNEGVWPGLPAPDPWLAPRIRRDLGLPGLETRIGLAAHDFAGALGAPRVLITRARR 659

Query: 705  ENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLE 764
             +  P +ASR   RL  + G  +     K    Y    R +D        +RP P PP+ 
Sbjct: 660  GSGGPAVASRLWLRLKAMAGPQW-----KTADRYAAMARAIDAPLVYGPTRRPAPSPPIA 714

Query: 765  AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
             +P     +++ +L  DP+A YARRIL+L  +     D     RGT  H    E++++  
Sbjct: 715  VRPHVIPVTDVDRLKADPFAFYARRILRLARLDPVDADAGPAWRGTAVH----EVLQRWA 770

Query: 825  NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWR-HLFHKISHSFLEHEEKIQSSIEKIFV 883
               T +   L  +   + F++  + P +  +W+  L   I   ++  E     S  +  +
Sbjct: 771  EAGTLDPTDLEVR-ARAMFDQPEVHPLLKALWQPRLIESI--RWIAAEVARDKSEGRTII 827

Query: 884  NIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
            ++  +   +  G+ L G ADR+D L  G + I DYKTG  P     +     QL L    
Sbjct: 828  SVEQEGRADVAGVTLMGKADRLDRLADGRIGIIDYKTGKPPSARQVKAGFSLQLGLLGVI 887

Query: 944  LKAGSFSQIDCRKVANLF-YIRLKQKF--------KIDCITNDKKKYSADELSEKSLKNL 994
             + G F  +    VA  F Y  L +K          +D +   + K    E +  +  + 
Sbjct: 888  AEMGGFDGLGPAPVAGDFEYWSLAKKGDQFGYRERPVDPL-GKRDKIITQEFTAHAHAHF 946

Query: 995  IEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +      G  PF++ L   E +N   +YD L R+ EW
Sbjct: 947  EGLANDYLLGSAPFVAQLN-PEVANY-GDYDQLMRLEEW 983


>gi|159045977|ref|YP_001534771.1| double-strand break repair helicase AddB [Dinoroseobacter shibae DFL
            12]
 gi|157913737|gb|ABV95170.1| double-strand break repair helicase AddB [Dinoroseobacter shibae DFL
            12]
          Length = 988

 Score =  311 bits (796), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 282/1045 (26%), Positives = 459/1045 (43%), Gaps = 96/1045 (9%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +     F  E +  LL        R     P  LA V I V T R +Q    E +
Sbjct: 11   PRVFGVPIGLDFPAETVAGLLE-------RLGSQPPHALAQVEILVNTGR-MQRRLQEVL 62

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
               G+ +  LP I+ + D+  E  T        L+P    +     +  L+        +
Sbjct: 63   SDRGR-AGFLPKIRLITDLGTEAGTDPA--PATLSPLRRMLDLRRLVLGLL--------E 111

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL P S          A+ L  +L  +++  E E    E L AL  E     W  A 
Sbjct: 112  TTPDLAPRS---------AALDLTISLVSLLEECEGEGVSLEQLAALDVEDLSAHWQRAL 162

Query: 186  DFLKIASKYWTERLVELNASSPVGYQ-IALMRAEAEHLMKGTKGPIIIAGSTGSIPATAR 244
             F+ I   +  +      A  P G Q  A++R  A+      + PI+IAGSTGS   TA 
Sbjct: 163  AFISIIGPFLKD---SGGAVGPEGRQRAAVLRKIAQWQDTPPRHPILIAGSTGSRGTTAL 219

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM+ VA  P GA++LPG D   P  +W    E S  +   +     HPQ+  A+LL  LD
Sbjct: 220  LMTAVARLPQGALLLPGFDTDQPPKVW---AEMSDALIGED-----HPQFRFARLLQALD 271

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            +    +    + +    GR+ ++S +  P   +D    +  + +  ++ +  ++  LIEA
Sbjct: 272  LDPASLPLWTDTAPPAPGRNRLVSLALRPAPVTDQWRAEGPDLR--DLPEALANTTLIEA 329

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
             ++REEA+SIA+ALR S    K+ +ALIT DR L R+V   L R+ I  D SAG PL  +
Sbjct: 330  ASQREEALSIAVALRDSAAAGKR-AALITPDRGLTRQVTAALDRWRIEPDDSAGRPLVLS 388

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEK--YLSRAKNALELVALRGNKNS 482
                 L+ +   +       A+  L+KHPL     P++  +L  +++ LEL   +     
Sbjct: 389  APGRFLSHVAAMMGAELSASALLILLKHPLTHSERPDRGDHLRHSRD-LELHLRKAPFVE 447

Query: 483  YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKN 542
                 L++      A+  + T  P   +R +          +D +L  + PL T +    
Sbjct: 448  LSEARLRAWA----ASSPSRTDSPADPARAA---------WMDWVLATVGPLTTLEDAPL 494

Query: 543  STCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSCIKAN 601
             T   +  +   +L                  LW +  G+   ++   + +E        
Sbjct: 495  DTLATVHRNASERLAAGPGAEGAG-------GLWDKTAGEKAKAVLDALALEAAHGGSFA 547

Query: 602  AIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKN 661
            + ++  ++ R++  E V+  +     + I GTLE+R+   D +IL GLN+G+WPK    +
Sbjct: 548  SGDFAALLARMLAQEEVRDPVRPDPRIMIWGTLEARVQGADVVILAGLNDGIWPKRPDPD 607

Query: 662  PFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRL-- 719
            P+++R M+ +  L   E+ +G +AHDF+ A G R +I TR+ R++   T+ SRWL R+  
Sbjct: 608  PWMNRKMRHEAGLLVPERQVGLSAHDFQQAMGAREVILTRATRDSEAETVPSRWLNRITN 667

Query: 720  LVLGGTD----FFDNLKKRGQCYLDWTRKLDYTTK-QPHYKRPKPFPPLEAQPRTYSFSE 774
            L+ G +D        ++ RG   +   R LD      P  KRP P P     P   S S 
Sbjct: 668  LLEGLSDESRAALAGMRTRGAAIVTRARGLDRPAAVMPLAKRPSPIPAPGQFPPRISASR 727

Query: 775  IKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHL 834
            ++ LI DP+ +Y   +L L  +    +  D   RGT+ H ++ E    ++   T     L
Sbjct: 728  VETLIRDPFEIYCGTVLGLRPLDPLDRPADAALRGTVLHKVL-ETALSQVMAGTEMTATL 786

Query: 835  MKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIE- 892
            ++QI  +    E++P P +   WR  F   +    E E      + ++    PA +    
Sbjct: 787  LRQIA-ARVLDEHVPWPEVRTQWRARFESYATQLAEAE------VARLRRATPAALERRG 839

Query: 893  ----SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGS 948
                + G+ LT  ADRID+   G   I DYKTG  P ++  +     QL LEA   +AG 
Sbjct: 840  ELTLASGVRLTCEADRIDIAPDGTAIIYDYKTGTVPGEKEVEAFTK-QLHLEAVIAEAGG 898

Query: 949  FSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPF 1008
            F  +    V+ + Y+++ +  KI  +T +           ++     +I+    +GE+ F
Sbjct: 899  FEDLPPLTVSEIAYLQINKDLKIRALTFEPGDVG------RARDEFAKIMDDFLSGERSF 952

Query: 1009 ISHLRLSEKSNIQSEYDHLARVAEW 1033
             +  R+       S+YDHL+R  EW
Sbjct: 953  TAR-RMPRDMKYVSDYDHLSRFGEW 976


>gi|294675595|ref|YP_003576210.1| double-strand break repair protein AddB [Rhodobacter capsulatus SB
            1003]
 gi|294474415|gb|ADE83803.1| double-strand break repair protein AddB [Rhodobacter capsulatus SB
            1003]
          Length = 977

 Score =  309 bits (792), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 285/1058 (26%), Positives = 452/1058 (42%), Gaps = 118/1058 (11%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M    P VF + P   F RE++  L     V+  R +P  P  +A V + +   R  + +
Sbjct: 1    MPPADPQVFALPPGVDFARELVQGL-----VQRMRDEP--PEAMARVRLILNAGRMSRRV 53

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            R EF    G  +  LP I+ + D+              L  PV  ++R LELA L+    
Sbjct: 54   REEF---DGLGTRFLPRIELISDLARVPMP-------GLPAPVPALRRKLELACLVDRLA 103

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALK-NEKYGM 179
              LP                  +    L  +L  ++  +++E    E    L     +  
Sbjct: 104  RGLPGFETG-------------SGVFSLTDSLLALLAEMQSEGVHPEVFERLDIQASHAE 150

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM-KGTKGPIIIAGSTGS 238
             W  +  F++I S+Y+     +L+A    G Q  ++   A     +  +  II+AGSTGS
Sbjct: 151  HWRQSLAFIRIVSRYFE---TDLDAE---GRQRRVVETMARTWADRPPQERIILAGSTGS 204

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
              AT  LM  VA  P GA+VLPG D  +P   W        ++ S       HPQ+    
Sbjct: 205  RGATRLLMQAVAALPRGALVLPGFDFDMPEPAW-------ASLCSGPIPIEDHPQFRFRA 257

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD--MRNTDILENKIPNIQKCF 356
            LLD L +    V R      E  GR+ ++S +  P   +D  MR    L +    +    
Sbjct: 258  LLDGLTLSPAQVARWTETLPEAPGRNALVSLALRPAPVTDQWMREGQALAD----LPAAC 313

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
            ++V LIEA + R+E+++IA+ LR ++   KK +ALI+ DR L RRV   L R+ I  D S
Sbjct: 314  ANVTLIEATDPRQESLAIALVLREAVFRGKK-AALISPDRMLTRRVAAALDRWSILPDDS 372

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLS-RAKNALELVA 475
            AG PL  T    ++  L     +     ++  ++KHPL   G   +    R     EL  
Sbjct: 373  AGQPLPLTAPGRLIRHLARLPGRKIPMESLLVILKHPLVATGSALRGAHLRLTREFELSL 432

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
             R      D   L+    D   T        HW   L+         L+D +        
Sbjct: 433  RRKGPAFPDAEALR----DWGGTADPERQ--HWSDWLAA--------LIDAV-------- 470

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLP--NLWFEEEG----KTLSSLFS 589
                      GN  +S W +     L          +    LW  E G    +TLS L +
Sbjct: 471  -------PAGGNHPVSAWLETLSALLDGFAAGPGGSVAASELWLGEAGQAAFRTLSDLAA 523

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGL 649
            +  ETG  +  +A  + D+I  L++   V+  +     +  LGTLE+R    + ++L GL
Sbjct: 524  QD-ETGLTV--SAANFADLIDTLLNEGQVRSTLAAHPLVTFLGTLEARAHGAELVVLAGL 580

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NE  WP+  + +P+LSR M+ D  L   E+ IG +AHDF+ A     ++ +R+ R++   
Sbjct: 581  NEKSWPEAPSPDPWLSRKMRLDAGLLLPERQIGLSAHDFQQAIAAPEVVLSRARRDSEAE 640

Query: 710  TIASRWLQRLLVLGGT-------DFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPP 762
            T+ SRWL RLL L G        +    ++ RG  +LD   +LD   ++          P
Sbjct: 641  TVPSRWLNRLLNLAGGLTAAQGPEALAQMRARGARFLDLASQLDLPQERLAPAPRPAPRP 700

Query: 763  LEAQPRT-YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI- 820
                       + IK LI DPYA+YA RIL+L  +   K  P+   RG   H ++   + 
Sbjct: 701  PAEARPRQLPVTAIKTLIRDPYAIYAARILRLRPLDPLKPGPNPRLRGEALHRVVELFVT 760

Query: 821  ----KKRINKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQ 875
                K  ++     ++ L + ++     +E +P P    +W H   +I+   +  E + +
Sbjct: 761  GFDPKNSLDSGQKHLSELAETVL-----QEMIPWPSTQRLWLHRLLRIAPQLVAQEAQRR 815

Query: 876  SSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDP 935
            +      +   A + +   G  LT   DRIDL   G   + DYK+G  P KE   +  D 
Sbjct: 816  AEATPAVIETSASIELGPTGFTLTARPDRIDLQHDGTALVYDYKSG-TPPKEAEVRHFDK 874

Query: 936  QLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLI 995
            QL LEAA ++ G+F+QI  R+VA + Y+ L    +   +   ++  +      ++   L 
Sbjct: 875  QLLLEAAMIERGAFAQIGPRQVAGMSYVHLGGSGECRMLALGREDVA------QTWTRLQ 928

Query: 996  EIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            E++       Q F +   +    +I  +YDHL+R  EW
Sbjct: 929  ELIARYLARSQGFAARRAMQMSRDI-GDYDHLSRFGEW 965


>gi|258543654|ref|YP_003189087.1| nuclease [Acetobacter pasteurianus IFO 3283-01]
 gi|256634732|dbj|BAI00708.1| nuclease [Acetobacter pasteurianus IFO 3283-01]
 gi|256637788|dbj|BAI03757.1| nuclease [Acetobacter pasteurianus IFO 3283-03]
 gi|256640842|dbj|BAI06804.1| nuclease [Acetobacter pasteurianus IFO 3283-07]
 gi|256643897|dbj|BAI09852.1| nuclease [Acetobacter pasteurianus IFO 3283-22]
 gi|256646952|dbj|BAI12900.1| nuclease [Acetobacter pasteurianus IFO 3283-26]
 gi|256650005|dbj|BAI15946.1| nuclease [Acetobacter pasteurianus IFO 3283-32]
 gi|256652995|dbj|BAI18929.1| nuclease [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656049|dbj|BAI21976.1| nuclease [Acetobacter pasteurianus IFO 3283-12]
          Length = 1029

 Score =  302 bits (774), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 279/1055 (26%), Positives = 467/1055 (44%), Gaps = 140/1055 (13%)

Query: 49   IYVPTKRAIQELRSEFIEITGKKSTILPIIKSLG--DVVEEKFTADLL--LSYNLNPPVS 104
            I +P +RA + L   F+     +S +LP I  +G  D  E   +A +   L+ +L P V+
Sbjct: 36   IVLPGRRAARALTEAFLRHMDGQSVLLPRIVPIGALDEAELGLSAGIGGELALDLPPAVA 95

Query: 105  NIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEK 164
             + RL  LARL+L       D      P    + P        LAK LAD++D     E 
Sbjct: 96   GMTRLAVLARLVL-----QADKAFGTRPTLDQAWP--------LAKALADLMD-----EA 137

Query: 165  KW------EDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAE 218
            +W      E L     E +   W +   FL+I ++ W E L E    +PV  Q+AL+ A+
Sbjct: 138  EWSGVNLAERLPEAVQENFAEHWQIILRFLEIVTQAWPEWLKENGVMNPVARQVALLEAQ 197

Query: 219  AEHLMK----GTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTI 274
            A+   K    G   PI  AG T  +  T +++  V   P G I+LPGLD  +    + ++
Sbjct: 198  ADLWRKLAQQGEITPIWAAGFTHVMQPTVKVLQAVLECPAGKIILPGLDMMMAEETFLSL 257

Query: 275  TEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYG--RSMVISKSFL 332
             +             +HPQ  L+ LL  L+I R+ V+       E  G  R+  +++  L
Sbjct: 258  PD-------------SHPQAGLSSLLKNLEITRDKVEVW---EGEGTGSERAATLARVLL 301

Query: 333  PPDT-SDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSAL 391
            P +   D  ++   E           +V  ++A +++EEA++I++ +R ++++   + AL
Sbjct: 302  PAEALGDWSHSGGAE---------LENVYRLDAADQQEEAVAISMIMREAIEKPAHRVAL 352

Query: 392  ITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVK 451
            +T DR LA RV  EL R+G+  D SAG  L  T  + +L  +   +      +++ +++K
Sbjct: 353  VTPDRVLAARVATELARWGVLADDSAGSSLVDTPAAVLLRLVAQMVDSKFSPVSLLSVLK 412

Query: 452  HPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSR 511
            HPL   GF           LE   LRG         L  +V       K+    P+ + +
Sbjct: 413  HPLVACGFAAGVCRATARLLERAILRGPAPPPGFAALCQVV-------KSALENPNEREK 465

Query: 512  LSEE-----DKELAVLLVDHILQ----CITPLVTYKTNKNSTCGNLS---------ISDW 553
               E     D+    + +   ++    C+ P++ ++ +       ++         + D 
Sbjct: 466  AKLEGGVTADRPFGPVALSVFMERLEFCLEPVLGWELDAAEAGMQIAQDLEQHCAPVPDL 525

Query: 554  -TKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWID-IITR 611
               L  T  + V  DE      LW  EEG  L+S  ++++     +       +D ++T 
Sbjct: 526  LAALIATVERLVATDEESASERLWRGEEGNLLASQLTELMLASEVLPPQPPVVLDGLLTA 585

Query: 612  LIDGETVK------PKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLS 665
            ++  E V       PK      + I G  ESRL   +T+ILGGL+EGVWP      P++S
Sbjct: 586  VLAPERVAMRRGGDPK-SLHPRVLIWGLFESRLQTAETVILGGLSEGVWPPVVDAGPWMS 644

Query: 666  RVMQSDLNLKTAEKYIGQAAHDF---EMANGTRHLIYTRSLRENNIPTIASRWLQRL--L 720
            R M+  + L + E+ +GQA HDF     A GT  +I + + R    P + +RWL RL   
Sbjct: 645  RPMRQRMGLPSPEQAVGQAGHDFFASAAAAGT--VILSSARRREGAPVVPARWLTRLDAF 702

Query: 721  VLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPP------------LEAQPR 768
            + G      N        L W  KLD           +P  P            +  +PR
Sbjct: 703  LAGRKGHIPN-----HPALLWLNKLD-----------QPVGPAIPVAPPQPMPPVALRPR 746

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
              S +EI+  I DPYA+YA+ IL+L+ +P  ++  D +D G + H  +   +K       
Sbjct: 747  RLSVTEIETWIRDPYAIYAKHILRLEVLPELEEAADASDYGMIVHKALERWVKAYGVTWP 806

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSS---IEKIFVNI 885
                  +  +     ++  L P +   W     +I+   ++ EEK ++       I   I
Sbjct: 807  DNAEKKLCDLFSESLQEHVLRPALRAWWAPRLTRIAQWVVQAEEKRRNEHGVPRAILTEI 866

Query: 886  PAKMAI-ESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAA 942
              +++I ++ G    + G ADRI+L   G V + DYKTG  P  +       PQL LEAA
Sbjct: 867  RGRVSIMDAPGGKFDIVGRADRIELNADGHVIVQDYKTGTLPSAKDVLAGWSPQLPLEAA 926

Query: 943  ALKAGSFSQI--DCRKVANLFYIRLKQKFKI--DCITNDKKKYSADELSEKSLKNLIEIV 998
             +  G F ++    R++++L Y RL    +   + +   ++  S  +L+E++ +NL+  +
Sbjct: 927  MIIRGGFKEVPEHSREISDLIYWRLTGGAEPGEEVVVKTREALSLTDLAEQTWENLLLRI 986

Query: 999  TLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                  +QP++SH     +    ++Y  LARV EW
Sbjct: 987  AAYDQPDQPYLSHPHPGREPRF-ADYARLARVPEW 1020


>gi|110677845|ref|YP_680852.1| hypothetical protein RD1_0453 [Roseobacter denitrificans OCh 114]
 gi|109453961|gb|ABG30166.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 985

 Score =  301 bits (772), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 290/1056 (27%), Positives = 480/1056 (45%), Gaps = 110/1056 (10%)

Query: 2    HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
            H+  P VF +AP   F + +I  LL        R     P  LA V + V T R  + LR
Sbjct: 4    HSDTPRVFGLAPGVDFPKGLIEGLLA-------RVAQGAPEDLARVQLIVNTSRMQRRLR 56

Query: 62   SEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRN 121
            S F       + +LP I  + ++  ++    L +     P V  +QR LEL  L+     
Sbjct: 57   SLF---DAGPARLLPKIHLVTEL--DRLAPGLAVP----PAVKPLQRRLELIALV----A 103

Query: 122  KLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            +L +  K L P + L           L  +LA ++D ++ E    E +++L        W
Sbjct: 104  RLIEQQKGLAPRASLYD---------LTDSLAALMDEMQGEGVTAETINSLDVSDISGHW 154

Query: 182  LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEH-LMKGTKGPIIIAGSTGSIP 240
                 F++I   Y  +     +  +    Q   + A AE   ++  + P+I+AGSTGS  
Sbjct: 155  QRTQTFIRIVQDYLAQTTTTPDKEA---QQRQFVCALAERWAVEPLRHPVILAGSTGSRG 211

Query: 241  ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
             T  LM  +A  P GA++LPG D  +P   W  + +   +          HPQY   KL+
Sbjct: 212  TTMLLMEAIARLPQGALILPGFDFDMPHQQWLHLDDALLS--------EDHPQYRFYKLM 263

Query: 301  DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
              + + R D+    +       R+ ++S S  P   +D   T+    K+ ++ K    + 
Sbjct: 264  QNIGVGRSDITPWHDAPPPSPARNALVSLSLRPAPVTDAWLTE--GPKLHDLNKATDQIT 321

Query: 361  LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
            L+EA + R EA++IA+ LR +++E +K +A+IT DR L R++   L +F I  D SAG P
Sbjct: 322  LLEAPSPRSEALAIALRLRKAVEEGQK-AAVITPDRMLTRQITAALDQFDILPDDSAGAP 380

Query: 421  LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL--ELVALRG 478
            L  +     L  +     +  D  A+ TL+KHPL   G      +RA + L  + + LR 
Sbjct: 381  LHLSPPGRFLRHVAALFHRRLDAEALLTLLKHPLTHSGS-----NRAAHILNTQRLELRI 435

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTH---VPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
             ++     D  S+         N  H   V  W + + +                 T   
Sbjct: 436  RRDGLPYPDADSIGQALAGISPNADHQRGVDAWGAWVGQ-----------------TFAA 478

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNV-CLDEHRKLPNLWFEEEGKTLSSLFSKIIET 594
             Y T +        +S W +  +   + + C  + +    LW ++ G+    + + + E 
Sbjct: 479  MYSTTEQP------LSHWAQTHIALAEAISCGLDGQDTGELWKQKAGQEALKVMTNLAEL 532

Query: 595  ---GSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
               G  + A+  ++ +++  L+    V+ +      + I GTLE+R+   D +IL GLN+
Sbjct: 533  AHHGGPMTAS--DYANLVGALLSEGEVRDRDAPHPDIMIWGTLEARVQGADLVILAGLND 590

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTI 711
            G WP+  A +P+L+R ++    L   E+ IG AAHD++ A     +  TRS+R ++  T+
Sbjct: 591  GTWPEAPAPDPWLNRALRHQAGLLLPERRIGLAAHDYQQAIAAPEVWLTRSIRSDDAETV 650

Query: 712  ASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLE 764
            ASRW+ RL  L        G    + ++ RGQ +LD T  L+         RP P PPL 
Sbjct: 651  ASRWVNRLCNLLSGLKGQDGPALLEAMQDRGQYWLDQTVALEKVEPATPAARPAPRPPLA 710

Query: 765  AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
            A+P+  + ++IK LI DPY +YA+ +L+L  +    ++PD   RGT+ H+++ + +++ +
Sbjct: 711  ARPKRLAVTDIKHLIRDPYTIYAKHVLRLRKLGPLVQNPDALLRGTVSHDVMEKFVRQTL 770

Query: 825  -NKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
             +  T   +HL++  I       ++P P    +W     +IS  F+ +E   Q     + 
Sbjct: 771  RDPATLNADHLIE--IARDVLSRDVPWPAARALWLARLTRISEWFVMNERARQHIGTPVV 828

Query: 883  VNIPA--KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLE 940
                A  KM    I   LT  ADRID  + G   I DYKTG +P     Q L D QL +E
Sbjct: 829  FEDDALGKMVWPDIEFTLTARADRIDQTEDGDALIYDYKTG-SPPTVKQQTLFDKQLLIE 887

Query: 941  AAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTL 1000
            AA ++ G+F ++    VA   +I L          ++  +  A   SE   + L E+  L
Sbjct: 888  AAMVEQGAFEKLGPHHVAQATFIGLG---------SNPVEVPAPLDSEPPAQILAELRML 938

Query: 1001 L---QNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +   +  +Q F +  R+ EK    S+YD L+R  EW
Sbjct: 939  VLAYKEMDQGFTAR-RMMEKDQYGSDYDLLSRYGEW 973


>gi|310817178|ref|YP_003965142.1| exonuclease-like protein [Ketogulonicigenium vulgare Y25]
 gi|308755913|gb|ADO43842.1| exonuclease-like protein [Ketogulonicigenium vulgare Y25]
          Length = 972

 Score =  301 bits (771), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 282/1049 (26%), Positives = 451/1049 (42%), Gaps = 110/1049 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPAL---LNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQE 59
            ++   +F + P + F   +I  L   + G   E++          A VT+YV T R  + 
Sbjct: 4    DESARLFGLPPGADFPAALIAGLHDRMAGRAPEDW----------ARVTLYVNTARMQRR 53

Query: 60   LRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            LR+ F +     + ILP I+ + D+  +   ADL L      PV  +QR LEL RLI   
Sbjct: 54   LRNLFDQ---GGAMILPRIRLVTDLALDPVAADLPL------PVPALQRRLELTRLIARL 104

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
                PD+              +P  A++ LA +LA ++D ++ E    + + AL      
Sbjct: 105  LESAPDL--------------APRAALYDLADSLAALMDEMQGEGVSPDVIAALDVSDQS 150

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGS 238
              W    +FLKI S Y+ +             ++ + R  A   +     PIIIAGSTGS
Sbjct: 151  GHWQRTLEFLKIISGYFDQ---TGQPDREARQRMVIERLVAHWQIAPPTDPIIIAGSTGS 207

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
              AT  LM  VA  P GA+VLPG D  +P   W  I         S      HPQ+   K
Sbjct: 208  RGATQLLMQAVARLPQGAVVLPGFDFDMPDHAWEAI--------GSAVAAEDHPQFRFRK 259

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENK-IPNIQKCFS 357
            + D L +   D++   + +     R+ +IS S  P   +D      LE K + ++    +
Sbjct: 260  IADGLGLALHDIRPWTSSNAPDPARNRLISLSLRPAPVTDQWR---LEGKDLGDLNLATA 316

Query: 358  DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
             + L+EA + R EA +IA+ LR +LDE +  +ALIT DR L R+V   L  + +  D SA
Sbjct: 317  QMTLLEAPSPRLEAQTIALRLRAALDEGRT-AALITPDRMLTRQVAAALDLWSVKPDDSA 375

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            G PL  +    +L  +     +  D  ++ +L+KHPL          +R ++ L      
Sbjct: 376  GQPLPLSPPGRLLRQVARLFGQRLDAESLLSLLKHPLT-----HADANRGQHLL------ 424

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTY 537
               NS+D   L+  + DR       T +  W  + +  D            +     V +
Sbjct: 425  ---NSHD---LERYIRDRGMPFPTATALLKWAGQENAPDHR----------RAWAEWVIH 468

Query: 538  KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGS 596
             TN         +S      +   + +      + P LW E  G+   ++ + + +    
Sbjct: 469  FTNDLDRISTRPLSAHLAHLIDTAEEIS-----RGPALWEEAAGRKARAVIADLQLNAPH 523

Query: 597  CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
              +    ++  I+  ++ G  V+        L I GTLE+R+   D +IL GLNEG+WP 
Sbjct: 524  GGEMEPRDFTAILDGVLRGAEVRNPDTGHPNLLIWGTLEARVQGADLVILAGLNEGIWPG 583

Query: 657  NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWL 716
             +A +P+L+R +++   L   E+ IG AAHD++ A     +  +R++R ++  T+A+RW+
Sbjct: 584  ASAADPWLNRALRARAGLLLPERRIGLAAHDYQQAIAAPEVWLSRAIRSSDAETVAARWV 643

Query: 717  QRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
             RL  L        G      ++ +G  +L     +     +          P  A   T
Sbjct: 644  NRLTNLLEGLPDQNGPAALAAMRAKGDAWLARASAMSQPDTRLPAAARPAPRPPLAARPT 703

Query: 770  -YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
              S + I+ L+ DPYA+YAR +L+L+ +    +  D   RGT+ H +  + I      + 
Sbjct: 704  KLSVTGIETLLRDPYAIYARHVLRLNALGPLNQSADARMRGTVIHKVYEDFINSGTAPDA 763

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
                 L+ Q   +  +++   P     W     + +  FL+ E + Q+      +    +
Sbjct: 764  AHALALLDQFAIAALDEDCPWPVTARQWLSQIRRAAPYFLQTEGERQAKGTPTLLEKRGE 823

Query: 889  MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGS 948
            +A+      L G ADRIDL   G   I DYKTG  P  ++ Q+  D QL +EAA +  G+
Sbjct: 824  IALGRHDFTLVGKADRIDLQPDGQALIYDYKTGAPPSAKS-QRYFDKQLLIEAAMIARGA 882

Query: 949  FSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKS----LKNLIEIVTLLQNG 1004
            F QI  R VA   +I L  K               DEL        L+ LI+       G
Sbjct: 883  FQQIGPRDVAGAEFIGLGSKLAT-------VPAPLDELPPAQIWAELQQLIDAWMQYPRG 935

Query: 1005 EQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                I+   +       S+YDHLAR  EW
Sbjct: 936  YTARIAPFEM----KYASDYDHLARYGEW 960


>gi|58039097|ref|YP_191061.1| hypothetical protein GOX0628 [Gluconobacter oxydans 621H]
 gi|58001511|gb|AAW60405.1| Hypothetical protein GOX0628 [Gluconobacter oxydans 621H]
          Length = 1016

 Score =  301 bits (770), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 293/1085 (27%), Positives = 475/1085 (43%), Gaps = 131/1085 (12%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPL----NPLLLASVTIYVPTKRAIQELRS 62
             V TIA + PF        L+    E  + DP      P L     I VP++RA + L  
Sbjct: 3    GVVTIAGTEPF--------LDRVAQEWLKRDPAAGTDGPGL-----ILVPSRRAGRALME 49

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F+ +   ++ +LP I ++ DV E+   A + +   L P V   +RL  L+ LIL     
Sbjct: 50   AFLRVLDTQAALLPRIVAINDVDEDAL-ASIGIDVVLPPAVEPQRRLAVLSMLIL----- 103

Query: 123  LPDIIKDLYPESPL-SLPISPANAI---W-LAKNLADIIDIIETEEKKW-EDLHALKNEK 176
                      ++PL S+ +     I   W LAK LAD++D  E       E L     E+
Sbjct: 104  ----------QTPLVSVGVDSTKGIDRAWPLAKALADLMDEAERSGVDLAERLPDAVEER 153

Query: 177  YGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM-KGTKGPIIIAGS 235
            +   W     FL+I +  W + L E   S+PV  QIA ++A+A+    K    P+   G 
Sbjct: 154  FSDHWQQTLKFLEIVTAVWPKWLEEEGLSNPVARQIARLKAQAQAWAEKPPLTPVWGVGF 213

Query: 236  TGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYS 295
                 A + +++ VA  P G ++LPG+D  +   IW  +               +HPQ  
Sbjct: 214  ADGSAAVSDVLAVVARLPAGLVILPGVDLGMTDEIWADLP-------------PSHPQAG 260

Query: 296  LAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKC 355
            L ++L  L + R+++       +   GR +++ +  LP    +    D     I  +   
Sbjct: 261  LKEILTDLGLSRKELTDWDGGRDR--GRELMLREVLLPEHGIEHWGQDSRPRDIDGL--- 315

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
                +++ A ++++EA +IA+ LR  + E  K  AL+T DR LA+RV  EL RFGI+ D 
Sbjct: 316  ----SILPAQDQQQEAQAIALILRDVVSEAGKTCALVTPDRALAQRVGTELLRFGIHADD 371

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            SAG  LS T  +  L  +  A       +A+ +++KHPLA  G        +   LE + 
Sbjct: 372  SAGESLSQTPAAVFLRLIATAAEARLSPVALLSVLKHPLAALGRTPGDCHASARRLERLL 431

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVP-HWQSRLSEEDKELAVLLVDHILQCITPL 534
            LRG   +  I  LK+ + +   TQK   H P H  S  + ++ E     +  I Q   PL
Sbjct: 432  LRGPAPAPGIAGLKAALHEY--TQKK--HAPDHGASADAPDEPEGPAAFIARIEQAFDPL 487

Query: 535  VTYKTNKNSTCGNLSISDWTKLTV---------TCLQNVCLDEHR-KLPNLWFEEEGKTL 584
            ++ +       G + + +  +  +             +   DE R     LW  E+G+ L
Sbjct: 488  LSIE-------GAIPLPELLERLIHTAEALAATAEELDAPEDEPRHPGARLWLGEDGEAL 540

Query: 585  SSLFSKIIETGSCIKANAIEWID------IITRLIDG--------ETVKPKIEKSSTLFI 630
            S   + +I     +    +  +D      +  +++ G        E   P++       I
Sbjct: 541  SRHLAALIVNTGILPPQRLTHLDSFLNTSMAGQMLTGLRAHRGGVELAHPRVS------I 594

Query: 631  LGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF-E 689
            LG LE+RLL FD ++LGGLNEGVWP  T   P+LSR M+  + L + E+  G +AHDF  
Sbjct: 595  LGVLEARLLAFDVVVLGGLNEGVWPPATDPGPWLSRPMRVRVGLPSPERQTGVSAHDFVS 654

Query: 690  MANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCY-----LDWTRK 744
                ++  ++  S R    P + +RW+ R+      D F  L  R Q       LDW R 
Sbjct: 655  TILASKEAVFASSARREGAPGVPARWMVRM------DAF--LGGRSQSLPLHPALDWQRC 706

Query: 745  LDYT-TKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDP 803
            LD           P+P PP+  +PR  S +EI+  ++DPYA+YA+ +LKL  +   ++  
Sbjct: 707  LDQPLAGAEAVAPPEPRPPVALRPRGLSITEIETWMHDPYAIYAKHVLKLRALKPLEEGA 766

Query: 804  DRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKI 863
            +  D G + H+ +  ++     +     + +++++      K N+ P +   W     +I
Sbjct: 767  EHADFGMIVHDAMERVLSDFPERWPANASAILRRVFAEELAKANMRPALVNWWGPRLARI 826

Query: 864  SHSFLEHEEKIQSSIEKI------FVNIPAKMAIES--IGIHLTGFADRIDLLKSGFVDI 915
            +    E E   +  +E+       FV + A   +++      L G ADRID+   G   +
Sbjct: 827  ADWVAEKEAAYRLDMEESGPAQGRFVEVTASFRLQAAFAPFELRGRADRIDIGADGLATV 886

Query: 916  TDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFKID 972
             DYKTG  P  +   +    QL LE A L  G+F  +   +   L Y  L       K  
Sbjct: 887  FDYKTGQPPSGKNVAEGWSVQLVLEGALLAKGAFKDVPAVETKKLLYWHLTGGDDPGKES 946

Query: 973  CITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAE 1032
             +   +    A  L  ++++ L  +V    N +QP+ S           ++Y  LARV E
Sbjct: 947  EVPGSRSGTDAPTLIGEAMEKLRTLVDEYDNPDQPYRSQPWAGHVPRY-TDYAQLARVDE 1005

Query: 1033 WREEY 1037
            WR  Y
Sbjct: 1006 WRAAY 1010


>gi|114800509|ref|YP_760585.1| hypothetical protein HNE_1884 [Hyphomonas neptunium ATCC 15444]
 gi|114740683|gb|ABI78808.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 1017

 Score =  301 bits (770), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 289/1066 (27%), Positives = 463/1066 (43%), Gaps = 110/1066 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P + TIAP + F +E+  AL   T +         P  LA   IYVP +R+ + L     
Sbjct: 12   PRIRTIAPGTAFVKELARALAAETSLAT------KPDALADAIIYVPNRRSARALSLALY 65

Query: 66   EITGKKSTILPIIKSLGDV--VEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL 123
            +  G+++ + P I++LGD+   E    A+  LS    PP+S  ++L  LA L+   R+  
Sbjct: 66   DAAGEQTILPPDIRALGDLDSGEPPPIAEQALS-GAAPPLSGAKQLGVLATLV---RH-- 119

Query: 124  PDIIKDLYPESPLSLPISPANAIWLAKNLADIID-IIETEEKKWEDLHALKNEKYGMWWL 182
                   Y ++ +   + PA+A+  A+ L  +++    +E   W  L  L        W 
Sbjct: 120  -------YYQNAMGTELPPASALSAARELGRLLEQAAMSENADWSKLETLSLGDMAAHWS 172

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIPA 241
             +ADFLKI ++ W E L E  AS P   ++   RA A+H       GP+IIAGSTG+ P 
Sbjct: 173  RSADFLKIVTELWPEWLAEHRASDPYKERLRAARALADHWRDAPPAGPVIIAGSTGATPP 232

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLD 301
               LM  V + P G IVLPGLD  +    W ++ +              HPQ +L + L 
Sbjct: 233  GRILMRAVLDLPQGLIVLPGLDTLLNDKQWESVIKAPG-----------HPQNTLIRTLR 281

Query: 302  FLDIKREDVKRLGNVSNEMYGRSMV--ISKSFLPPD-TSDMRNTDILENKIPN------- 351
             L    E V     +S +   R+ V  I ++  P + T+D R T  LE            
Sbjct: 282  ALGRAPESVAPWPGISEDGPARARVRLIHEALAPAEETADWRAT--LEELAAASNQPIEE 339

Query: 352  -IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFG 410
             ++   + +++    NE  EA + A+ +R +L+   + +AL+T D  LARRV   L R+G
Sbjct: 340  FVRDGLTGLSIANTPNEAAEAEAAALLMRETLEREGQTAALVTPDAGLARRVSALLGRWG 399

Query: 411  INIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNA 470
            I++  SA +PL  T   S++           +   +A ++KHP     F  K +      
Sbjct: 400  IHVPPSAPVPLGRTQAGSLIGLCARWAADPGEPAVLAAVLKHP-----FVRKKMD--SGL 452

Query: 471  LELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
            L+L  LRG +    + DL   +  R    K   H P        ED++ A+LLV  + + 
Sbjct: 453  LDLYFLRGPRRWKSLDDLAHSIDIR---HKLEPHSP-----FKREDQDEAILLVQRLSEI 504

Query: 531  ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEH-RKLPNLWFEEEGKTLSSLFS 589
            +            +  + SI D         +   L     + P  W  E+G   S+L  
Sbjct: 505  M----------EESGADFSILDGVTADAAAKRVADLAGAISETPMPWAGEDGAGASNLLQ 554

Query: 590  KIIETGSCIKANAIEWIDIITRLIDGET----VKPKIEKSSTLFILGTLESRLLNFDTLI 645
            ++ E G  +   + E       L+D E+    V+    +   L I G LE+RL + D LI
Sbjct: 555  RLAELGPFLGEMSPE---AFADLVDAESSNLPVQTGEPEHPRLSIWGPLEARLQSADRLI 611

Query: 646  LGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRE 705
            L GLNE VWP+    + FL R  ++ L L   E+ +G +AHDF       H++   + R 
Sbjct: 612  LAGLNEDVWPEKPPADAFLPRRFRAPLGLNDPEERMGLSAHDFAQLAAAPHVVMLSAARR 671

Query: 706  NNIPTIASRWLQRLLVLGGTDFFDN----LKKRGQCYLDWTRKL----------DYTTKQ 751
            ++ P++ SRW+ RL  L    F D     LK      LDW   L          D++ + 
Sbjct: 672  DDSPSVESRWVWRLRTLAEGAFGDRTAELLKGETGALLDWVSALQTRGVGTLPADFSAEP 731

Query: 752  PHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTL 811
               KR     P E  P   S + + +L  DPY+++A  +L L  +           RGT 
Sbjct: 732  TPRKR----TPAE-WPTRLSVTRVDRLQRDPYSIWAESVLGLRQVDVLGAPLASNLRGTA 786

Query: 812  FHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
             H  +    K+ + K+   +  L++  +    E E+       IW      ++  +LE  
Sbjct: 787  IHAALDAFEKEGVAKDAGSLLELIRVELARTGEPESSWAGRLAIW----QDVADWYLEW- 841

Query: 872  EKIQSSIEKIFV-NIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928
             +    I   FV  +  ++++E  G    L+  ADRI+   +G + I D+KTG  P  + 
Sbjct: 842  -RASRDIGGKFVREVRGEISVEIAGHPFELSATADRIERTATGELVIVDFKTGQPPTDKA 900

Query: 929  AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKK-YSADELS 987
                 D Q+ L+A     G F  +    VA L Y+ ++ + +   I   K    + +EL 
Sbjct: 901  IDAGYDQQMPLQAIIASKGGFKNVRAAPVAALEYVAIRGRPEARRIAESKNSPKTLEELI 960

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +    + +V   ++ E  F S  R+ +       Y+ LAR AEW
Sbjct: 961  AAAADGYVRLVAAYRDPEAVFASAPRV-QFVKYDYGYNLLARRAEW 1005


>gi|329113821|ref|ZP_08242592.1| Hypothetical protein APO_0595 [Acetobacter pomorum DM001]
 gi|326696831|gb|EGE48501.1| Hypothetical protein APO_0595 [Acetobacter pomorum DM001]
          Length = 1029

 Score =  300 bits (767), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 280/1051 (26%), Positives = 467/1051 (44%), Gaps = 132/1051 (12%)

Query: 49   IYVPTKRAIQELRSEFIEITGKKSTILPIIKSLG--DVVEEKFTADLL--LSYNLNPPVS 104
            I +P +RA + L   F+     +S +LP I  +G  D  E   +A +   L+ +L P V+
Sbjct: 36   IVLPGRRAARALTEAFLRHMDGQSVLLPRIVPIGALDEAELGLSAGIGGELALDLPPAVA 95

Query: 105  NIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEK 164
            ++ RL  LARL+L       D      P    + P        LAK LAD++D     E 
Sbjct: 96   SMTRLAVLARLVL-----QADKAFGTRPTLDQAWP--------LAKALADLMD-----EA 137

Query: 165  KW------EDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAE 218
            +W      E L     E +   W +   FL+I ++ W E L E    +PV  Q+AL+ A+
Sbjct: 138  EWSGVNLAERLPEAVQENFAEHWQIILRFLEIVTQAWPEWLRENGVMNPVARQVALLEAQ 197

Query: 219  AEHLMK----GTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTI 274
            A+   K    G   PI  AG T  +  T +++  V   P G +VLPGLD  +    + ++
Sbjct: 198  ADLWRKLAQQGDSTPIWAAGFTHVMQPTVKVLQAVLECPAGKVVLPGLDMMMAEETFLSL 257

Query: 275  TEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPP 334
             +             +HPQ  L+ LL  L+I R  V+ +   + +  GR+ ++++  LP 
Sbjct: 258  PD-------------SHPQAGLSALLKNLEITRNKVQ-IWEGTGKGAGRAAILARVLLPA 303

Query: 335  DTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITA 394
            +  D       +   P   +   +V  ++A +++EEA++I++ +R ++++   + AL+T 
Sbjct: 304  EALD-------DWSHPGGAE-LENVYRLDAADQQEEAVAISMIMREAIEKPMHRVALVTP 355

Query: 395  DRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPL 454
            DR LA RV  EL R+G+  D SAG  L  T  + +L  +   +      +++ +++KHPL
Sbjct: 356  DRVLAARVATELARWGVLADDSAGSSLVDTPAAVLLRLVAQMVDSRFSPVSLLSVLKHPL 415

Query: 455  AKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLV------LDRIATQKNNTHVPHW 508
               GF           LE   LRG         L  +V      L+  A  K    +   
Sbjct: 416  VACGFSSGVCRATARLLERAILRGPAPPPGFAALCRVVNNALENLNERAKAKLEGGI--- 472

Query: 509  QSRLSEEDKELAVLLVDHILQ----CITPLVTY---------KTNKNSTCGNLSISDW-T 554
                   D+    + +   +Q    C+ P++ +         +T ++       + D   
Sbjct: 473  -----TADRPFGPVALSVFMQRLAFCLEPVLGWELDAVEASVQTAQDLEQHCAPVPDLLA 527

Query: 555  KLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWID-IITRLI 613
             L  T  + V  DE      LW  EEG  L+S  ++++     +       +D ++T ++
Sbjct: 528  ALIATVERLVATDEESASERLWRGEEGNMLASQLTELMLASEVLPPQPPVVLDGLLTAVL 587

Query: 614  DGETVK------PKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
              E V       PK      + I G  ESRL   +T+ILGGL+EGVWP      P++SR 
Sbjct: 588  APERVAMRRGGDPK-SLHPRVLIWGLFESRLQTAETVILGGLSEGVWPPVVDAGPWMSRP 646

Query: 668  MQSDLNLKTAEKYIGQAAHDFEMANGTRH-LIYTRSLRENNIPTIASRWLQRL--LVLGG 724
            M+  + L + E+ +GQAAHDF  +      +I + + R    P + +RWL RL   + G 
Sbjct: 647  MRQRMGLPSPEQAVGQAAHDFFASAAAADTVILSSARRREGAPVVPARWLTRLDAFLAGR 706

Query: 725  TDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEA------------QPRTYSF 772
              +  N        L W  KLD           +P  P               +PR  S 
Sbjct: 707  NGYIPN-----HPALVWLNKLD-----------QPLGPATPVAPPQPMPPVALRPRRLSV 750

Query: 773  SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEIN 832
            +EI+  I DPYA+YA+ IL+L+ +P  ++  D +D G + H  +   +K           
Sbjct: 751  TEIETWIRDPYAIYAKHILRLEVLPELEEAADASDYGMIVHKALERWVKAYAVAWPENAE 810

Query: 833  HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSS---IEKIFVNIPAKM 889
              +  +  +  ++  L P +   W     +I+   ++ EEK +S       I   I  ++
Sbjct: 811  KKLCDLFSASLQEHVLRPALRAWWAPRLTRIARWVVQAEEKRRSEHGVPRAILTEIRGRV 870

Query: 890  AI-ESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKA 946
            +I ++ G    + G ADRI+L   G V + DYKTG  P  +       PQL LEAA +  
Sbjct: 871  SIMDAPGGKFDIVGRADRIELNADGHVIVQDYKTGTLPSAKDVWAGWSPQLPLEAAMIIR 930

Query: 947  GSFSQID--CRKVANLFYIRLKQKFKI--DCITNDKKKYSADELSEKSLKNLIEIVTLLQ 1002
            G F ++    R++++L Y RL        + +   ++  S  +L+E++ +NL+  V    
Sbjct: 931  GGFKEVPEHSREISDLIYWRLTGGADPGEEVVVKTREALSLTDLAEQTWENLLLRVAAYD 990

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +QP++SH     +    ++Y  LARV EW
Sbjct: 991  QPDQPYLSHPHPGREPRF-ADYARLARVPEW 1020


>gi|330991805|ref|ZP_08315754.1| hypothetical protein SXCC_01710 [Gluconacetobacter sp. SXCC-1]
 gi|329760826|gb|EGG77321.1| hypothetical protein SXCC_01710 [Gluconacetobacter sp. SXCC-1]
          Length = 1016

 Score =  300 bits (767), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 273/1074 (25%), Positives = 450/1074 (41%), Gaps = 117/1074 (10%)

Query: 7    NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
             V  + P  PF  ++    L+        +DP       +  I +P++RA + L   F+ 
Sbjct: 13   RVAVVPPHVPFVDQIAARWLD-----QAGHDPRE---CGTGLILLPSRRAARALTEAFMR 64

Query: 67   ITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDI 126
                +  +LP I  +  + E         + +L P V  ++RL  L+ L++       D+
Sbjct: 65   QVDGRPLLLPRIAPIAALDEASLALSGQNALDLPPAVDPVRRLATLSLLVMQAGKAFGDV 124

Query: 127  --IKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDL-------HALKNEKY 177
              +   +P               LA+ LAD++D     E +W +        HA + + +
Sbjct: 125  QGVDQAWP---------------LARALADLMD-----EAEWAECDLRTRLPHAAEGD-F 163

Query: 178  GMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEA-----EHLMKGTKGPIII 232
               W     FL I +  W   L E    +PV  Q AL+ A+A     E    GT  PI  
Sbjct: 164  AQHWHQTLRFLSIVTSVWPAWLAEQGVMNPVARQTALLHAQAARWEREPPAPGT--PIWA 221

Query: 233  AGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHP 292
             G   ++P+T  ++  V + P+G +VLPG+D     A+W  +                HP
Sbjct: 222  VGFADAVPSTIAMLRAVLSVPDGLLVLPGVDTTCAQAVWEHLPPD-------------HP 268

Query: 293  QYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNI 352
            Q   A++L  L I R+ +++  ++       S       L          +  + + P+ 
Sbjct: 269  QAGTARMLAELGIARDGMEQWDSLPPGSTATSPAARAGLLARALLPAHALE--QWRAPDA 326

Query: 353  QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
                  ++++ + +++EEA +IA+ LR  L++  +++AL+T DR LA RV  EL R+G+ 
Sbjct: 327  PVAADGLSVLRSADQQEEAAAIAMVLRQVLEQPGRRAALVTPDRALAGRVATELVRWGVI 386

Query: 413  IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
             D SAG  L T   ++ L  ++ A+      +A+ +++KHPLA  G        +   LE
Sbjct: 387  ADDSAGESLLTIPQTAFLRLIVQAVDGGLSPVALLSVIKHPLAACGLSPGNCRASARQLE 446

Query: 473  LVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532
             + LRG      I  L+   L R A        PH     + +  E     ++ +     
Sbjct: 447  RLVLRGPAPPPGIAGLRR-ALARAADD------PHGALADAPDAPEEINAFLNRLEAAFG 499

Query: 533  PLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN---------LWFEEEGKT 583
            PL+    +             T + V  L    ++  + L           LW  EEG  
Sbjct: 500  PLLALPVS-------------TPVPVPTLLAALIEVAQDLATTGSADGAERLWAGEEGNA 546

Query: 584  LSSLFSKIIETGSCIKANAIEWID-IITRLIDGETVKPKIEKSST-------LFILGTLE 635
            L    S ++     +    +  +D ++   + G TV+ +             +FI G LE
Sbjct: 547  LGQHMSAMLAWCDVLPDARLGTLDGLLASSLAGMTVQGRRAVRGRAGAVHPRVFIWGLLE 606

Query: 636  SRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF-EMANGT 694
            +RL   DT++LGGL E VWP  T   P++SR M++ + L   E  IGQAAHDF   A   
Sbjct: 607  ARLQTADTIVLGGLVETVWPPATDPGPWMSRPMRTRVGLPAPEWVIGQAAHDFVSCACAA 666

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRG---QCYLDWTRKLDYTTKQ 751
              ++ + + R    PT+ +RWL RL      D +      G      L W   LD     
Sbjct: 667  PRVVLSVAGRRQGAPTVPARWLVRL------DAYLAGHGHGLPAHPALRWLEGLDRPAGV 720

Query: 752  PHYKRPKPFPPLEA-QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGT 810
            P    P    P    +PR+ S +EI+  + DPYA+YARRILKL+ +   ++  D  D G 
Sbjct: 721  PMPVAPPRPRPAVGLRPRSLSVTEIETWMRDPYAIYARRILKLNRLADLEELADAADYGQ 780

Query: 811  LFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISH--SFL 868
            + H  +    +        +    M+ +      +  L P +   W     +I+   +  
Sbjct: 781  IVHAALDRWFRAHPADWPADGAVRMQAVFADVLREAGLRPALAAWWAPRLERIATWCART 840

Query: 869  EHEEKIQSSIEKIFVNIPAKMAIESI---GIHLTGFADRIDLLKSGFVDITDYKTGDNPK 925
            E   +   +   +       M ++ +      L G ADRIDL   G + + DYKTG  P 
Sbjct: 841  EQARRATGAPCTVLTEQGGTMRLDDLPGGAFTLRGRADRIDLHGDGALSLFDYKTGTLPA 900

Query: 926  KETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADE 985
            + +  +    QL LEAA +++G F      +VA L Y RL        + +  +     +
Sbjct: 901  RRSVIEGWQSQLVLEAAMIESGGFPPPVAGRVAELVYWRLTGGHVPAQVLDVARGTELSD 960

Query: 986  LSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW---REE 1036
            L     + L ++V    + EQP++SH    E+    ++Y HLARVAEW   REE
Sbjct: 961  LIAHCRQGLHDLVAAYDSPEQPYLSHPWPGEEPRF-ADYAHLARVAEWSAAREE 1013


>gi|118590598|ref|ZP_01548000.1| hypothetical protein SIAM614_03446 [Stappia aggregata IAM 12614]
 gi|118437061|gb|EAV43700.1| hypothetical protein SIAM614_03446 [Stappia aggregata IAM 12614]
          Length = 590

 Score =  300 bits (767), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 197/600 (32%), Positives = 316/600 (52%), Gaps = 26/600 (4%)

Query: 4   KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLN-PLLLASVTIYVPTKRAIQELRS 62
           +   ++++ PS PF + ++  L++GTL+  FR  PL+ PLLL SVT+Y+PT+RA + L  
Sbjct: 3   RSARLWSVPPSVPFLKTLVDTLVDGTLIPGFR--PLDDPLLLPSVTLYLPTRRAARLLPE 60

Query: 63  EFIEITGKKSTILPIIKSLGDVVEEK----FTADLLLSYNLNPPVSNIQRLLELARLILI 118
            F +  G +  +LP I+ +GD  E+      +ADL     L P +  ++R L + RL+  
Sbjct: 61  LFQQRFGGRPVLLPAIRPVGDADEDAQSLTASADL---EPLPPAMPLLERHLAMTRLVKA 117

Query: 119 WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYG 178
           W+  L      L  + PL LP S A+A WLA +L  ++D +ETEE  W +L  L  E + 
Sbjct: 118 WKGMLRREALSLRSDEPLGLPASTADAAWLAADLLTLMDEVETEEADWSELSGLVPEDHA 177

Query: 179 MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKG-TKGPIIIAGSTG 237
            +W +  DFL+I  + W   L EL    P   + AL+R EAE L +   +GP+I+AG TG
Sbjct: 178 RYWQITLDFLQIVREAWPAHLAELKMMDPKARRSALIRREAERLERTPPRGPVIVAGVTG 237

Query: 238 SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNIT-------SSNTTYST 290
           S+PATA L+  V+    G +VLPGLD H+    W  + +++   +           T  +
Sbjct: 238 SVPATAELLKVVSRLEAGVVVLPGLDRHLDNRSWAVLGQRTGKASMRKGVAPKDAATLPS 297

Query: 291 HPQYSLAKLLDFLDIKREDVKRLGNVSNE-MYGRSMVISKSFLPPDTSDMRNTDILENKI 349
           HPQYSL +LLD L   RE+V  LG   ++ +  R  ++S++  P DTSD     +     
Sbjct: 298 HPQYSLKQLLDRLGAAREEVATLGPEPDQGLLLREELVSEALRPADTSDGWTAYLDTRSE 357

Query: 350 PNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRF 409
            +  +    V+++ A NE +EA+S+AIALR ++ E ++ +ALI+ DR L RRV  EL R+
Sbjct: 358 TDRARALDGVSIMTARNEADEALSVAIALREAI-ERQESAALISPDRMLTRRVAAELARW 416

Query: 410 GINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKN 469
            I +D SAG PL  T  + +            D + +  L+KHPL + G P K +  A  
Sbjct: 417 NIQVDDSAGRPLDQTAPAILAILAAKLALGGCDPIDLLALLKHPLTRLGLPVKDIRSAAR 476

Query: 470 ALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQ 529
           ALE   +RG +       L+ L +D    + +  H P W+ ++ +ED ++   LVD +  
Sbjct: 477 ALERGVVRGPRARPGTAGLR-LAVDASREEVSKAHTPRWK-KIHDEDWDVIANLVDRLAN 534

Query: 530 CITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
            + PL     +     G + ++D  +  V  ++ + +D    +  L+  E G+ L+   +
Sbjct: 535 ALKPLEELAGD----GGTILLTDLARRHVEVIEAISIDHEGSVAELYAGEAGEALAQFLT 590


>gi|163732945|ref|ZP_02140389.1| hypothetical protein RLO149_09805 [Roseobacter litoralis Och 149]
 gi|161393480|gb|EDQ17805.1| hypothetical protein RLO149_09805 [Roseobacter litoralis Och 149]
          Length = 985

 Score =  299 bits (766), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 279/1050 (26%), Positives = 467/1050 (44%), Gaps = 106/1050 (10%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P VF +AP   F + ++  LL        R     P  LA V + V T R  + LRS F 
Sbjct: 8    PRVFGLAPGVDFPKGLMQGLLE-------RVSQTAPEELARVQVIVNTSRMQRRLRSLF- 59

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                  + +LP I  +  + +      L     + P V  ++R LEL  L+     +L +
Sbjct: 60   --DAGPARLLPKIHLVTQLDQ------LAPGIAVPPAVKPLRRRLELIALV----ARLIE 107

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
              K+L P + L           L  +LA ++D ++ E    + ++ L        W    
Sbjct: 108  QQKELAPRTSLYD---------LTDSLAALMDEMQGEGVTADTINGLDVSDLSGHWQRTQ 158

Query: 186  DFLKIASKYWTERLVELNASSPVGYQIALMRAEAEH-LMKGTKGPIIIAGSTGSIPATAR 244
             F++IA  Y +      +  +    Q   + A A+   +   + P+I+AGSTGS   T  
Sbjct: 159  TFIRIAQDYLSRTTTTPDKEA---QQRQFVSALADRWAIDPPRHPVILAGSTGSRGTTML 215

Query: 245  LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
            LM  +A  P GA+VLPG D  +P   W  + +   +          HPQY   KL+  + 
Sbjct: 216  LMEAIARLPQGALVLPGFDFDMPRQQWLHLDDALLS--------EDHPQYRFYKLMQHIG 267

Query: 305  IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
            + R D+    N       R+ ++S S  P   +D   T+    K+  + +    + L+EA
Sbjct: 268  VGRSDISPWHNAPPPSPARNALVSLSLRPAPVTDAWLTE--GPKLHTLNEATQQITLLEA 325

Query: 365  DNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTT 424
             + R EA++IA+ LR ++ E+ +K+A+IT DR L R++   L +F I  D SAG PL  +
Sbjct: 326  PSPRSEALAIALRLRKAV-EDGQKAAVITPDRMLTRQITAALDQFDILPDDSAGAPLHLS 384

Query: 425  LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNAL--ELVALRGNKNS 482
                 L  +     +  D  A+ TL+KHPL          +RA++ L  + + LR  ++ 
Sbjct: 385  PPGRFLRHVAALFHRRLDAEALLTLLKHPLT-----HSSTNRAEHILNTQRLELRIRRDG 439

Query: 483  YDIMDLKSLVLDRIATQKNNTH---VPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
                D  S+ +       N  H   V  W + + +                     T+ +
Sbjct: 440  LPYPDADSIQVALSGVSPNPEHQNAVDVWGTWVGQ---------------------TFAS 478

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDE-HRKLPNLWFEEEGKTLSSLFSKIIET---G 595
             +  T G   ++ W +  +   + +           +W ++ G+    + + + +    G
Sbjct: 479  VQ--TSGEHPLTHWAQAHMALAEAISSGPFGHDTGEIWKQKAGQEALKVMTNLTDLAHHG 536

Query: 596  SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
              + A+  ++ +++  L+    V+ +      + I GTLE+R+   D +IL GLN+G WP
Sbjct: 537  GPMTAS--DYGNLVGALLSEGEVRDRDAPHPDVMIWGTLEARVQGADLVILAGLNDGTWP 594

Query: 656  KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRW 715
            +    +P+L+R ++    L   E+ IG AAHD++ A     +  TRS+R ++  T+ASRW
Sbjct: 595  EAPTPDPWLNRALRHQAGLLLPERRIGLAAHDYQQAIAAPEVWLTRSIRSDDAETVASRW 654

Query: 716  LQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
            + RL  L        G    + +K RG  +LD T  L+         RP P PPL+A+P+
Sbjct: 655  VNRLCNLLSGLKGQDGPALLEAMKNRGTFWLDQTVLLEKVEPAAPAARPAPRPPLDARPK 714

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT 828
              + ++IK LI DPY VYA+ +L+L  +    + PD   RGT+ H ++ + +++ +    
Sbjct: 715  RLAVTDIKHLIRDPYTVYAKHVLRLRKLGPLVQSPDALLRGTVSHQVMEDFVRRTLADPA 774

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQS-----SIEKIFV 883
                  +  + D    ++   P    +W     +IS  F+ +E   Q      + E+  V
Sbjct: 775  TLTAQDLVDVADEVLMRDVPWPAARALWLARLTRISEWFVVNERARQHIGMPVAFEEDAV 834

Query: 884  NIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
                KM    I   LT  ADRID  + G V I DYKTG +P     Q L D QL +EAA 
Sbjct: 835  G---KMVWPDIKFTLTARADRIDQTEDGDVLIYDYKTG-SPPTVKQQTLFDKQLLIEAAM 890

Query: 944  LKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQN 1003
            ++ G+F ++  + VA   +I L          ++       E   + L  L ++V   Q 
Sbjct: 891  VEQGAFEKLGPQHVAQATFIGLGSN------PSEVPAPLDSEPPAQILAELRKLVLAYQE 944

Query: 1004 GEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             +Q F +  R+ EK    S+YD L+R  EW
Sbjct: 945  MDQGFTAR-RMMEKDQYGSDYDLLSRYGEW 973


>gi|254462109|ref|ZP_05075525.1| double-strand break repair protein AddB [Rhodobacterales bacterium
            HTCC2083]
 gi|206678698|gb|EDZ43185.1| double-strand break repair protein AddB [Rhodobacteraceae bacterium
            HTCC2083]
          Length = 980

 Score =  299 bits (766), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 284/1056 (26%), Positives = 456/1056 (43%), Gaps = 114/1056 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
             + P +F +     F + ++  +L+       R     P  +A + I V T R  + + +
Sbjct: 5    QETPRIFALGLGVDFPKALVKGVLD-------RTQNNAPTDIAQIQIIVNTARMRRRVST 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEE-KFTADLLLSYNLNPPVSNIQRLLELARLI--LIW 119
             FI+    K+ +LP I  LG++ +  KF A       +   +S + R +E+  L+  L+ 
Sbjct: 58   LFID---GKAKLLPQITLLGNIGKHPKFHA-------IPQAISPLSRRIEIIALVDALLR 107

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
            RN        L+                LA +LA ++D ++ E    ED+  L+      
Sbjct: 108  RNPALASRSSLFD---------------LADSLAGLMDEMQGEGVPLEDISNLEVTDISG 152

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
             W  A +F+ I  ++    L ++   +    +  ++   A+  +     P+I+AGSTGS 
Sbjct: 153  HWARAQEFISIVGRFLD--LSQVRPDNEARARAVVLAQIADWQINPPTHPVILAGSTGSR 210

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNT-ITEKSTNITSSNTTYSTHPQYSLAK 298
              TA LM  ++  P GA++LPG D   P  +W   I +  T +   +     HPQY  A 
Sbjct: 211  GTTALLMEAISKLPQGAVILPGFDTDTPPEVWEELIADHPTRMDPED-----HPQYRFAN 265

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL  L +  + V    +       R+ V+S +  P   +D    D     + ++      
Sbjct: 266  LLKSLSMHPKTVPLWHDTPPVDTARNKVVSLALRPVPVTDGWLRD--GPNLGDLPSAMQH 323

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
            V L+E    REEA++IA+ LR +  E  K +ALIT DR L R+V   L R+ I  D SAG
Sbjct: 324  VTLLEPQTSREEALAIAMRLRFAA-EQGKTAALITPDRMLTRQVTAALDRWDIKPDDSAG 382

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            +PL  +     L  +L    +  D  A+ TL+KHPL   G            LEL ++R 
Sbjct: 383  LPLQLSPPGRFLRHVLELFTRPLDAEALLTLLKHPLTHTGSERGTHLLLTRELEL-SIRK 441

Query: 479  NKNSYDIMD-----LKSLVLDRIATQKN---NTHVPHW--QSRLSEEDKELAVLLVDHIL 528
            N  ++   D      K   LD   +  +   NT   H     + + E  E  + L + I 
Sbjct: 442  NGPAFPTKDSLLAWAKDNKLDGAKSWIDWVANTFCGHLCDGPQNAVELAERHIGLAERIS 501

Query: 529  QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLF 588
            Q    + T    K    G  ++S W  L         LD    LP+L      +  + LF
Sbjct: 502  QGAQDVGTGDLWKEG-AGREAMSQWVALRSN------LD---ALPDL----STRDYADLF 547

Query: 589  SKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
              ++  G     +A                         + I GTLE+R+   D LIL G
Sbjct: 548  GGVLSRGEVRNPDA---------------------GHPNVLIWGTLEARVQGADLLILAG 586

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            LNEG WP+  + +P+L+R M++D  L   E+ IG +AHDF+ A     +  TR+ R ++ 
Sbjct: 587  LNEGSWPEAPSPDPWLNRRMRADAGLLLPERRIGLSAHDFQQAIAAPEVWLTRAQRSDDA 646

Query: 709  PTIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFP 761
             T+ SRWL RL  L        G    + ++ RG  +L+   +L+        KRP P P
Sbjct: 647  QTVPSRWLNRLTNLMNGLPDQDGPVTIEQMQTRGNDWLERAHQLETPIGANPAKRPSPKP 706

Query: 762  PLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK 821
             +E +P   S +EIK L+ DPY +YA+ +L+L  +    K  D   RG   H +  + ++
Sbjct: 707  AIEVRPNQLSVTEIKTLVRDPYEIYAKHVLRLAPLDSLVKTADARLRGIAVHQVFEDFVR 766

Query: 822  KRINKNT-PEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
                  T  ++    K+I DS  +     P   ++W     +++  F+  E + Q     
Sbjct: 767  SWDKGETAADLMAHAKRIFDSDVDW----PSARLMWAARIARLADDFVAEERERQKIAMS 822

Query: 881  IFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLE 940
              + +  +  +  +G  LT  ADRIDL + G   + DYKTG  P K   Q   D QL LE
Sbjct: 823  SRLEVKGESTLPELGFTLTVKADRIDLDERGGAYLYDYKTGAIPSKPQ-QLAFDMQLLLE 881

Query: 941  AAALKAGSFSQIDCRKVANLFYIRLKQKFK-IDCITNDKKKYSADELSEKSLKNLIEIVT 999
            AA  + G F  +  R +    Y+ +    K ++   +DK        + +    L ++++
Sbjct: 882  AAMAERGDFDSLHPRHIEGATYLGVGSGTKSVEAPLDDKP-------TAQVWAELYKLIS 934

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWRE 1035
              Q   + F +  R  EKS     YD L+R  EW E
Sbjct: 935  DYQVSNKGFTAR-RAMEKSKGFGRYDQLSRFGEWDE 969


>gi|85705746|ref|ZP_01036843.1| hypothetical protein ROS217_10612 [Roseovarius sp. 217]
 gi|85669736|gb|EAQ24600.1| hypothetical protein ROS217_10612 [Roseovarius sp. 217]
          Length = 979

 Score =  297 bits (760), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 288/1051 (27%), Positives = 459/1051 (43%), Gaps = 109/1051 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
            +  P ++ I P   F R ++  L         R+    P  LA V + V T+R  + +R 
Sbjct: 5    SDAPRLYGIPPGVDFPRALVGGL-------RARHAGQPPETLARVQLIVNTRRMARRIRE 57

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
             F +       +LP I  L D+ E     DL    +  PP+     L+ L         K
Sbjct: 58   LFDQ---GPPCLLPRISLLTDLGE---LWDLAHIPDAVPPLRRRLELVRLI-------TK 104

Query: 123  LPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            L D   DL P S          AI+ L+ +LA ++D +  E      + AL        W
Sbjct: 105  LLDSAPDLAPRS----------AIYDLSDSLAGLMDEMHGEGVSPHAIEALDVSDQSGHW 154

Query: 182  LLAADFLKIASKYWTERLVELNASSP---VGYQIALMRAEAEHLMKGTKGPIIIAGSTGS 238
                 FL I   Y+     E   ++P      ++ + R  A       K P+I+AGSTGS
Sbjct: 155  ARIKSFLGIVRHYF-----EAGGAAPDVETRQRLVIERLAALWDEMPPKHPVILAGSTGS 209

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
              AT  LM  VA  P GA+VLPG D   P  +W+ + +   +          HPQY   +
Sbjct: 210  RGATQHLMQAVARLPQGAVVLPGFDFDTPAPVWDALDDAMLS--------EDHPQYRFCR 261

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            +     I   D++   +       R+ ++S +  P   +D    D     + +I    +D
Sbjct: 262  VAVGAGITPVDIRPWSDTRPANPARNALVSLALRPAPVTDQWLRD--GPHLRDITGAMAD 319

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
            V L+EA ++R+EA++IA+ LR +  E+ + +ALIT DR L R+V   L R+ I  D SAG
Sbjct: 320  VTLVEAPSQRQEALAIAMRLRQAA-EDGRTAALITPDRTLTRQVTAALDRWDILPDDSAG 378

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            +PL  +     L  + +         ++ TL+KHPLA  G       R    LEL  LR 
Sbjct: 379  LPLHLSPPGRFLRHVADLFRNRLSAESLLTLLKHPLAHQGAERGTHLRLTRELEL-HLRR 437

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
            +   Y   D     L      + +  +P W + L +         V+       PL    
Sbjct: 438  HGPPYPTED----SLRAWGAGQRDQLIPDWVNWLCD-------CFVNRDYSGEMPL---- 482

Query: 539  TNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSC 597
              +NS   +L +++  ++   C              LW ++ G+      +++  E    
Sbjct: 483  --ENSVAAHLELAE--QIAHGCHGTGS-------GTLWLKDAGQEAQKAVTELQTEAHHA 531

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
               +A ++  +  +++    V+  ++    + I GTLE+R+   D LIL GLNEG WP +
Sbjct: 532  GTLSASDYSSLFHKVLSAREVRNPVDPHPHILIWGTLEARVQGADLLILAGLNEGSWPVS 591

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
               +P+L+R ++  + L   E+ IG +AHDF+ A     +  TRS+R  +  T+ SRWL 
Sbjct: 592  PKADPWLNRALRHQVGLLLPERRIGLSAHDFQQAIAAPEVWLTRSVRSADAETVVSRWLN 651

Query: 718  RLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY 770
            R+L L       GG    D ++ RG  +LD    L+   + P   RP P PP+  +P   
Sbjct: 652  RILNLLSGLPDQGGQAAIDAMRARGHVWLDHAAALEEPGEAPRAARPAPAPPVAVRPDHL 711

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            + +EIK+LI DPYA+YAR ILKL  +    + PD   RGT+ H I+   I++ + ++  +
Sbjct: 712  TVTEIKRLIRDPYAIYARHILKLRPLDPLMRAPDALLRGTVLHEILEGFIRETL-EHPAQ 770

Query: 831  INH--LMKQIIDSHFE---KENLP-PHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
              H  LM+     H E    +N+P      +W     +++  F++ E + ++    ++  
Sbjct: 771  CTHATLMR-----HAETVLAQNVPWAEARALWLARLERVADWFIDTEAQRRALAHPVYFE 825

Query: 885  IPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAAL 944
               +  +  +G  L+  ADR+DL   G + I DYKTG  P  +  Q   D QL LEAA  
Sbjct: 826  AAGRATLPDLGFTLSAKADRLDLDDLGRLHIYDYKTGAPPSTKE-QTSFDKQLLLEAAIA 884

Query: 945  KAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNG 1004
                F  +   +VA   +I L          +  K+  A   +E   K   E   L+   
Sbjct: 885  TRSGFEGMGPTRVARAVFIGLG---------STPKELDAPLDTEPPDKIWSEFHALMSAY 935

Query: 1005 EQPFISHL--RLSEKSNIQSEYDHLARVAEW 1033
              P + +   R    +    +YD LAR  EW
Sbjct: 936  FDPDMGYTARRAPRMAEDDGDYDQLARYGEW 966


>gi|302384282|ref|YP_003820105.1| double-strand break repair protein AddB [Brevundimonas subvibrioides
            ATCC 15264]
 gi|302194910|gb|ADL02482.1| double-strand break repair protein AddB [Brevundimonas subvibrioides
            ATCC 15264]
          Length = 1013

 Score =  296 bits (759), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 286/1081 (26%), Positives = 461/1081 (42%), Gaps = 142/1081 (13%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P  F I    PF  ++   +L+  L +N       P  L+  TI +P +RA +   +   
Sbjct: 12   PRWFAIPAHRPFLEDLAAGVLD-WLGDN------PPEALSDATILLPNRRAARAFGAALA 64

Query: 66   EITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL 123
                 +  +LP ++ LGD+ E++  F+   L   +L P ++++ R  E+AR+I       
Sbjct: 65   TQAADRPVLLPQVRPLGDLEEDEPPFSPGEL-GLDLPPAIASLTRRFEMARMI------- 116

Query: 124  PDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHA-LKNEKYGMWWL 182
               ++   P       ++P  A+ LA  L   +D    EE     + A    E +   W 
Sbjct: 117  ---VEQFAPG------LAPLRALELADGLGAFLDSCHIEEVADPGMVASFGGEDFAEHWQ 167

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIPA 241
             +A+FL +A + W +RL  +        +  L+R  AE       +GP+I AGSTG++ A
Sbjct: 168  ASAEFLGLAVEAWPKRLEAMGLVDASWRRTKLLRLLAERWAGSPPQGPVIAAGSTGTVKA 227

Query: 242  TARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLD 301
             A ++  VA+ P G +VLPGLD  +    W  I E+             HPQ +L +LL+
Sbjct: 228  AADVLKAVASAPQGCVVLPGLDADLDETAWGAIEEQ-------------HPQSALKRLLE 274

Query: 302  FLDIKREDV----KRLGNVSNEMYG--RSMVISKSFLPPD-TSDMRNT-DILENKIPNIQ 353
               + R  V    +R  +   E  G  R  +I ++  P + T+D R     L  +     
Sbjct: 275  RAGVARAAVRPWFRRPVDPGVEARGLARQRLIHEALRPAEATADWREEIRGLRGRAAEAG 334

Query: 354  KCFSDVAL-------IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLEL 406
            +    +AL       +    E E A +IA+ +R SL+   +  AL+T D  L RRV   L
Sbjct: 335  QSADPIALGLQGLSVVTTRTEEEAAATIALMMRESLEMPGRTCALVTPDLALGRRVAARL 394

Query: 407  TRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIAT---LVKHPLAKFGFPEKY 463
             R+G+  D S+G  L   +   +L  L   +  + D +A  T   L+KH L     PE  
Sbjct: 395  ERWGVVADSSSGTGLG-QMPVGVLVDLC--VRWMADPLAPQTALALIKHELTT--LPEAT 449

Query: 464  LSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQ-SRLSEEDKELAVL 522
             S A   LE VA RG + + D   +++ +    A ++N      W   RL++     A  
Sbjct: 450  -SDAVVELEKVAFRGPR-TRDWTRVEARLTQAGAPRRNGQPPSDWTLGRLAQ-----ATA 502

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGK 582
            L    LQ ++   T      +            L         L E     ++W   +G+
Sbjct: 503  LAGR-LQALSGTATAPFAPRA-----------PLDAAARSLTTLIEALAGADVWAGSDGE 550

Query: 583  TLSSLFSKIIETGSCI-KANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
              +++ S++IE G+ + + +  E+ +++  L+   TV+       +L ILG +E+RL+  
Sbjct: 551  AAAAMLSQLIEGGASLGEVSPGEFAELVAGLVRDTTVRTGGATHPSLRILGAIEARLVRA 610

Query: 642  DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
            D +IL GL EGVWP+    +PFLSR M+  L+L   E+ +GQ A DF         I   
Sbjct: 611  DRMILAGLEEGVWPRGAPVDPFLSRPMRKALDLPPPERRVGQTAQDFVQGACAPEAILIH 670

Query: 702  SLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTK---QPHY---- 754
            + R    P + SRWL RL         + L +     LD   ++  T +    P +    
Sbjct: 671  TERRGGQPAVRSRWLWRL---------EMLTRGAGVDLDRPTEMQATARALDAPGFGQGG 721

Query: 755  --KRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF 812
              KRP P PP+  +PRT   + +++ + DPYAVYAR +L L  +    +  +   RG   
Sbjct: 722  LAKRPAPKPPVARRPRTLPVTGVERWVRDPYAVYARYVLNLRPMDRPGQSAEALLRGQAI 781

Query: 813  HNIITELIKKRINKNTPEI--NHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEH 870
            H  +     +R+    P++       QI+  H   E L        RH  H    + +  
Sbjct: 782  HKAV-----ERLTLAWPDVLPEDCEDQIV--HLLHEEL--------RH--HGFEDAAMAR 824

Query: 871  EEKIQSSIEKIFVNIPAKMAIESIGIH-----------------LTGFADRIDLLKSGFV 913
            E  +  +  +       +   + I I                  +T  ADRI+L  +G  
Sbjct: 825  EGPLARNAARWLTAFETRRRAQGIEIRVEEEVALTFDADAGPFTVTAKADRIELSSTGAA 884

Query: 914  DITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIR-LKQKFKID 972
             I D+KTG  P  +  +    PQL+L  A L     S     +  +L Y+R + +K   +
Sbjct: 885  -ILDFKTGAAPSAKQVKSGFAPQLTLTGAILAEAGLSDTGPVEPEDLTYVRVVGRKVAGE 943

Query: 973  CITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAE 1032
              T  +   +AD LS  +L  L   V        P++S +      N    YDHLARV E
Sbjct: 944  AKTLAQGTEAAD-LSMAALAGLKARVRRFDLETTPYLSWVAPQFMGNFGGNYDHLARVWE 1002

Query: 1033 W 1033
            W
Sbjct: 1003 W 1003


>gi|162146538|ref|YP_001600997.1| hypothetical protein GDI_0714 [Gluconacetobacter diazotrophicus PAl
            5]
 gi|161785113|emb|CAP54657.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl
            5]
          Length = 1014

 Score =  294 bits (752), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 276/1027 (26%), Positives = 445/1027 (43%), Gaps = 90/1027 (8%)

Query: 49   IYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQR 108
            I +P++RA + L   F+     +  +LP I  +G + E         + +L P V  ++R
Sbjct: 37   ILLPSRRAARALTEAFLRHADGRPMLLPRIAPIGSLDESALALSGQEALDLPPAVEPLRR 96

Query: 109  LLELARLILIWRNKLPDI--IKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKW 166
            L  L RLIL   +   D+  I   +P               LA+ LAD++D  E  E   
Sbjct: 97   LATLTRLILQAGDAFGDVRTIDQAWP---------------LAQALADLMDDAEWAECDL 141

Query: 167  -EDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEH---- 221
             E L A     +   W L   FL I +  W   L E    +P   Q+AL+ A+A      
Sbjct: 142  AERLPAAAEGDFAEHWHLTLRFLSIVTGIWPAWLAEEGVMNPAARQVALLHAQARRWHAS 201

Query: 222  -LMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTN 280
             L  G +  +   G T ++P+   ++  V   P G +VLPG+D  +  A W  + +    
Sbjct: 202  PLPGGER--LWAVGFTDAMPSVLAVLDAVLAMPGGRLVLPGVDLSLDEATWTALPDG--- 256

Query: 281  ITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEM----YGRSMVISKSFLPPDT 336
                      HPQ  +A+LL  +   R D+ + G+ S +      G +  + +  +    
Sbjct: 257  ----------HPQAGIARLLAGVGRNRADLAQWGDPSGDAGSGDAGAACPVDRGAVLARA 306

Query: 337  SDMRN--TDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITA 394
                    + L +  P      S   ++ A +++EEA +IA+ LR ++ E   ++AL+T 
Sbjct: 307  LLPAAALGEWLRDTTPVAMDGLS---VLRAADQQEEAAAIALLLRQAIAEPGHRAALVTP 363

Query: 395  DRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPL 454
            DR LA RV +EL R+G+  D SAG PL  T  +  L  ++ A       +A+ +L+KHPL
Sbjct: 364  DRGLAGRVAVELARWGVVADDSAGEPLGATPPAIFLRLVVQAATGGLSPVALLSLLKHPL 423

Query: 455  AKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSE 514
            A  G        +   LE   LRG      I  L+    DR+A  +++ H        + 
Sbjct: 424  AACGLSPGACRASARLLERALLRGPAPRPGIDGLR----DRLAVARDDAHGALADRPDAP 479

Query: 515  EDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN 574
            ED       VD + +C+ PL+T             ++D     V   + +   + R   +
Sbjct: 480  EDL---AGFVDRVERCLAPLLTLVAAPAPG----PVADLLAGLVEAAEALATTDDRAGAD 532

Query: 575  -LWFEEEGKTLSSLFSKIIETGSCIKANAIEWID-IITRLIDGETVKPKIE---KSST-- 627
             LW  E+G  L    + +I     + A     +D ++   + G+TV+ +     + +T  
Sbjct: 533  RLWAGEDGNALGQHLAALIAFCDVLPAQGATILDGLLAASMAGQTVRSRRGLRGRDATAL 592

Query: 628  ---LFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQA 684
               +FI G +E+RL   +T++LG L E VWP  T   P++SR M++ + L + E+ IGQA
Sbjct: 593  HPRIFIWGLMEARLQAVETMVLGALVETVWPPATDPGPWMSRPMRARVGLPSPERAIGQA 652

Query: 685  AHDF-EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCY----- 738
            AHDF   A     ++ +   R +  PT+ +RWL RL      D F  L  R Q       
Sbjct: 653  AHDFVACACAAPRVVLSVPGRRDGAPTVPARWLVRL------DAF--LAGRDQALAAHPA 704

Query: 739  LDWTRKLDYTT-KQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIP 797
            L W  +LD           P+P PPL A+PR  + +EI+  + DPYA++AR IL L  + 
Sbjct: 705  LSWLSRLDRPVDAPRPVAPPRPRPPLAARPRALTITEIETWMRDPYAIHARHILGLRRLK 764

Query: 798  HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWR 857
              ++  D  D GT+ H  +    ++ + + +      ++           L P +   W 
Sbjct: 765  EIEEPADAADYGTIVHAALDRWFRQPVERRSAAGEAGLRATFAEELAAARLRPALAAWWA 824

Query: 858  HLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA-IESIGIH-----LTGFADRIDLLKSG 911
                +I+   ++ E    S      V    +   +E  G+      L G ADRID    G
Sbjct: 825  PRLARIAAWVVQAEAARASGQAGAVVTRTERSGTVELSGLPGGPFVLRGRADRIDRNGDG 884

Query: 912  FVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKI 971
             + + DYKTG  P++++       QL LEAA  + G+F      +   L Y RL    + 
Sbjct: 885  GLTLIDYKTGTLPRRKSVFAGWSSQLVLEAAMAERGAFGAELAGRARELLYWRLTGGPEA 944

Query: 972  DCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVA 1031
                        D+L   S  NL  ++ +  +  QP++SH    E     ++Y  LARVA
Sbjct: 945  GEDLPVATGQELDDLIAASWDNLRGLIAMYDDPAQPYLSHPHPEEGPRF-ADYARLARVA 1003

Query: 1032 EWREEYD 1038
            EW    D
Sbjct: 1004 EWSAARD 1010


>gi|209543464|ref|YP_002275693.1| double-strand break repair protein AddB [Gluconacetobacter
            diazotrophicus PAl 5]
 gi|209531141|gb|ACI51078.1| double-strand break repair protein AddB [Gluconacetobacter
            diazotrophicus PAl 5]
          Length = 1014

 Score =  288 bits (738), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 274/1027 (26%), Positives = 444/1027 (43%), Gaps = 90/1027 (8%)

Query: 49   IYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQR 108
            I +P++RA + L   F+     +  +LP I  +G + E         + +L P V  ++R
Sbjct: 37   ILLPSRRAARALTEAFLRHADGRPMLLPRIAPIGSLDESALALSGQEALDLPPAVEPLRR 96

Query: 109  LLELARLILIWRNKLPDI--IKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKW 166
            L  L RLIL   +   D+  I   +P               LA+ LA+++D  E  E   
Sbjct: 97   LATLTRLILQAGDAFGDVRTIDQAWP---------------LAQALAELMDDAEWAECDL 141

Query: 167  -EDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEH---- 221
             E L A     +   W L   FL I +  W   L E    +P   Q+AL+ A+A      
Sbjct: 142  AERLPAAAEGDFAEHWHLTLRFLSIVTGIWPAWLAEEGVMNPAARQVALLHAQARRWHAS 201

Query: 222  -LMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTN 280
             L  G +  +   G T ++P+   ++  V   P G +VLPG+D  +  A W  + +    
Sbjct: 202  PLPGGER--LWAVGFTDAMPSVLAVLDAVLAMPGGRLVLPGVDLSLDEASWTALPDG--- 256

Query: 281  ITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEM----YGRSMVISKSFLPPDT 336
                      HPQ  +A+LL  +   R D+ + G+  ++      G +  + +  +    
Sbjct: 257  ----------HPQAGIARLLAGVGRNRADLAQWGDPPHDAGSGDAGMACPVDRGAVLARA 306

Query: 337  SDMRNT--DILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITA 394
                    + L +  P      S   ++ A +++EEA +IA+ LR ++ E   ++AL+T 
Sbjct: 307  LLPAAALGEWLRDTTPVAMDGLS---VLRAADQQEEAAAIALLLRQAIAEPGHRAALVTP 363

Query: 395  DRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPL 454
            DR LA RV +EL R+G+  D SAG PL  T  +  L  ++ A       +A+ +L+KHPL
Sbjct: 364  DRGLAGRVAVELARWGVVADDSAGEPLGATPPAIFLRLVVQAATGGLSPVALLSLLKHPL 423

Query: 455  AKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSE 514
            A  G        +   LE   LRG      I  L+    DR+A  +++ H        + 
Sbjct: 424  AACGLSPGACRASARLLERALLRGPAPRPGIDGLR----DRLAVARDDAHGALADRPDAP 479

Query: 515  EDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPN 574
            ED       VD + +C+ PL+T             ++D     V   + +   + R   +
Sbjct: 480  EDL---AGFVDRVERCLAPLLTLVAAPAPG----PVADLLAGLVEAAEALATTDDRAGAD 532

Query: 575  -LWFEEEGKTLSSLFSKIIETGSCIKANAIEWID-IITRLIDGETVKPKIE---KSST-- 627
             LW  E+G  L    + +I     + A     +D ++   + G+TV+ +     + +T  
Sbjct: 533  RLWAGEDGNVLGQHLAALIAFCDVLPAQGATILDGLLAASMAGQTVRSRRGLRGRDATAL 592

Query: 628  ---LFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQA 684
               +FI G +E+RL   +T++LG L E VWP  T   P++SR M++ + L + E+ IGQA
Sbjct: 593  HPRIFIWGLMEARLQAVETMVLGALVETVWPPATDPGPWMSRPMRARVGLPSPERAIGQA 652

Query: 685  AHDF-EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCY----- 738
            AHDF   A     ++ +   R +  PT+ +RWL RL  L        L  R Q       
Sbjct: 653  AHDFVACACAAPRVVLSVPGRRDGAPTVPARWLVRLDAL--------LAGRDQALAAHPA 704

Query: 739  LDWTRKLDYTT-KQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIP 797
            L W  +LD           P+P PPL A+PR  + +EI+  + DPYA++AR IL L  + 
Sbjct: 705  LSWLSRLDRPVDAPRPVAPPRPRPPLAARPRALTITEIETWMRDPYAIHARHILGLRRLK 764

Query: 798  HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWR 857
              ++  D  D GT+ H  +    ++   + +      ++           L P +   W 
Sbjct: 765  EIEEPADAADYGTIVHAALDRWFRQPAERRSAAGEAGLRATFAEELAAARLRPALAAWWA 824

Query: 858  HLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA-IESIGIH-----LTGFADRIDLLKSG 911
                +I+   ++ E    S      V    +   +E  G+      L G ADRID    G
Sbjct: 825  PRLARIAAWVVQAEAARASGQAGAVVTRTERSGTVELSGLPGGPFVLRGRADRIDRNGDG 884

Query: 912  FVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKI 971
             + + DYKTG  P++++       QL LEAA  + G+F      +   L Y RL    + 
Sbjct: 885  GLTLIDYKTGTLPRRKSVFAGWSSQLVLEAAMAERGAFGAELVGRARELLYWRLTGGPEA 944

Query: 972  DCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVA 1031
                        D+L   S  NL  ++ +  +  QP++SH R  E     ++Y  LARVA
Sbjct: 945  GEDLPVATGQELDDLIAASWDNLRGLIAMYDDPAQPYLSHPRPEEGPRF-ADYARLARVA 1003

Query: 1032 EWREEYD 1038
            EW    D
Sbjct: 1004 EWSAARD 1010


>gi|148555592|ref|YP_001263174.1| double-strand break repair protein AddB [Sphingomonas wittichii RW1]
 gi|148500782|gb|ABQ69036.1| Double-strand break repair protein AddB [Sphingomonas wittichii RW1]
          Length = 991

 Score =  287 bits (735), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 278/1054 (26%), Positives = 448/1054 (42%), Gaps = 102/1054 (9%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            +P VFTI    P  R    AL  G +    R+ P +PL LA   + VP  RA + +   F
Sbjct: 3    RPAVFTI----PAHRAFADALAAGLIA---RHGP-DPLGLARTVVLVPNNRAARAISDAF 54

Query: 65   IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLN-------PPVSNIQRLLELARLIL 117
            +    +   +LP + ++GD   ++    LL   + +       P +  ++R + LARL  
Sbjct: 55   VR-RAEGGLLLPRLVAIGDPELDERLGGLLDPIDADAEEEPIPPAIDPLERQMILARLTA 113

Query: 118  IWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE---KKWEDLHALKN 174
              R    D             PI    AI LA  L   +D +  E+    +  DL AL  
Sbjct: 114  EARQAAGD-------------PIDGGEAIRLAGELGRTLDQMLIEQIPAARLRDLVALP- 159

Query: 175  EKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIIIA 233
             +    W  +   L      W   L           +  L+ R       +   G +I A
Sbjct: 160  -ELSEHWQRSLAMLDTILTRWPAELAARGRIDLAERRNRLLDRVARRWRHRPPPGAVIAA 218

Query: 234  GSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTT--YSTH 291
            G + + PA ARL+  VA  P G +VLPGLD     A W  +    T    +       +H
Sbjct: 219  GISSTTPAVARLLGVVARLPEGMVVLPGLDTVSDEAEWRALGPHETGEDGARPPRPVESH 278

Query: 292  PQYSLAKLLDFLDIKREDVK--RLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKI 349
            PQY+L +LLD +D+ R +V   R G   +    R+  I+ +  P   +D        +++
Sbjct: 279  PQYALKRLLDRMDVGRGEVATWRWGGGRDARSVRARAIANAMAPAAFTDK------WHRL 332

Query: 350  PNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRF 409
            P  ++  S V  IE  N  EEA  IA+ALR +++   + +AL+T DR LARRV   L R+
Sbjct: 333  PPAERRLSGVRAIELANPAEEAQVIALALREAIETPGRTAALVTPDRVLARRVTAHLARW 392

Query: 410  GINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKN 469
            GI  D SAG PLS T   ++L ++  A  +    + +  L+KHPL + G           
Sbjct: 393  GIVADDSAGTPLSLTPAGTLLLAVAEAAAEGFAPVPLLALLKHPLVRRGAARGAWLDGAR 452

Query: 470  ALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQ 529
             L+ +ALRG +    +  +   + D       + H        +   +  A+   D +  
Sbjct: 453  KLD-IALRGPRPPAGLDGIARYLRD------GDGH--------ARRARAPAIDWWDEVRP 497

Query: 530  CITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
             + PL   K     T   L  +   + T++ L +            W   +G+  + L +
Sbjct: 498  LLEPL--EKAFSARTLAELLAA--LRETISTLADDAG---------WSGPDGRAAADLVA 544

Query: 590  KIIETGSCIKANAIEWIDI---ITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLIL 646
            ++ E  + I   A +   +   +  L+D   V+P       L I G LE+RL + D ++L
Sbjct: 545  EL-EAWAPIGPAAFDPAGLAPTLRLLMDAVAVRPPQGGHPRLSIWGLLEARLQHADLMVL 603

Query: 647  GGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLREN 706
            GGLNEGVWP   + +P+L+  ++++L L   E  IG +AHDF MA G   LI TR+ R+ 
Sbjct: 604  GGLNEGVWPALPSPDPWLAPRIRAELGLPGLETRIGLSAHDFAMALGAPELIVTRARRDA 663

Query: 707  NIPTIASR-WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEA 765
              PTIASR WL+   + GG         R     +W   +D    +    RP+P PP+  
Sbjct: 664  RAPTIASRFWLRLEAMTGGI-------TREHRLPNWAAAIDRPADRRFIARPEPAPPVAD 716

Query: 766  QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKK--- 822
            +P   + + + +L  DP+A YA  +L+L  +     DP    RGT  H +    +K+   
Sbjct: 717  RPNVIAVTRLDRLQADPFAFYADAMLRLRPLDAVDADPTPAWRGTAVHAVFEAWMKQDDC 776

Query: 823  RINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
              ++  P    +++ +      +    P +    R +  ++     +    I + ++   
Sbjct: 777  DPDRLLPRAEAMLRDMAAHPVMQALWEPRLIEALRWVADRMREERAQGRRPIAAELDG-- 834

Query: 883  VNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAA 942
                    +E  GI LTG  DRID L  G + I DYKTG  P     +     QL L   
Sbjct: 835  -------RVEVAGITLTGKVDRIDRLADGTLAIVDYKTGKPPSAAQVEAGYAMQLGLLGL 887

Query: 943  ALKAGSFSQIDCRKVANLFYIRLKQK---FKIDCITNDKKKYSADELSEKSLKNLIEIVT 999
                G F  I+   +A  ++   K +    ++      K   +  +    +   L   V 
Sbjct: 888  IADRGGFDGIEGTPLAFEYWSLAKDRDAFGQVRSPVGGKSHVAPQDFVAHAAAILASAVE 947

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                G +PF +  +L+ + +  ++YD L R+ EW
Sbjct: 948  RWLTGTEPFTA--KLAPEYSPYADYDQLMRLDEW 979


>gi|119385519|ref|YP_916575.1| putative helicase/exonuclease [Paracoccus denitrificans PD1222]
 gi|119375286|gb|ABL70879.1| putative helicase/exonuclease [Paracoccus denitrificans PD1222]
          Length = 980

 Score =  285 bits (728), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 283/1063 (26%), Positives = 453/1063 (42%), Gaps = 128/1063 (12%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M + +  VF +   + F     P      L+   R+ P  P  +A VT+Y  + +++  L
Sbjct: 1    MPDWQNGVFALPCGADF-----PGAFAEGLIRRMRHHP--PQEMARVTVYANSGQSLMAL 53

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            R   I+        L +I  LG                     + + R LEL RLI    
Sbjct: 54   RQALIQRGPLLLPRLRLIADLGGGAA----------------TTPLARRLELGRLIDAAL 97

Query: 121  NKLPDIIKDL-YPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
               PD+ +    PE              LA +LA ++  ++ E    + L  +   ++  
Sbjct: 98   RAQPDLAQGQSVPE--------------LAASLAGLMAEMQLEGLDAQALDRIDASEHAQ 143

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
             W  A  FLKIA+ Y+     +   +       AL  A A   M   +GP+++AGSTGS 
Sbjct: 144  HWGRALAFLKIAAGYYLSDPPQDREARQRAAAEALAAAWARGEML-PQGPVVVAGSTGSH 202

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
             AT   M  VA  P GA+VLPG D  +P  +W+ + ++S +          HPQ   A L
Sbjct: 203  GATRDFMRAVARLPMGAVVLPGFDADLPQGVWDGLDQRSED----------HPQARYAPL 252

Query: 300  LDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILEN-KIPNIQKCFSD 358
            +       E    L + + +   R+ +IS +  P   +D     I E  ++  +      
Sbjct: 253  VAEFGAPAE---WLADTAPD-PARNRLISLALRPAPVTDQW---IEEGPRLGPLAPATER 305

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
            + LIEA+   EEA ++A+ +R ++ E  +   LI ADR L RRV+  L R+GI  D SAG
Sbjct: 306  LTLIEAEQPGEEAEAVALIIREAV-ERGQPVTLIAADRMLTRRVQSALDRWGIIPDDSAG 364

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYL---SRAKNALELVA 475
             PL  T     L  + +         A+  L+KHP+   G    Y    +R    LEL  
Sbjct: 365  QPLPLTAPGLFLRHVADLFGAEMMLDALLVLLKHPVTATGLGSDYRREHNRHTRDLEL-H 423

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV 535
            LR N  ++                 +   +  W  R     K  A+ L   +L  I PL 
Sbjct: 424  LRRNGPAF----------------PDGAALREWADRGDASSKPWALWLAG-LLDRIVPLA 466

Query: 536  TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL--PNLWFEEEGKTLSSLFSKII- 592
              +  +        ++D  +      +++            LW +  G    S+   +  
Sbjct: 467  QDRAPR-------PLADRLRDLRALAEDLAAGPGGDAGASELWAKASGGLARSVLDHLAA 519

Query: 593  --ETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDT----LIL 646
                G  ++    E+ D++   + G+ V+  +     +   G  E+R          +IL
Sbjct: 520  HAHLGHDLRPG--EFCDLLYDELQGQAVRQDVAAHPLVRFRGPREARTEAVGKAAGLVIL 577

Query: 647  GGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLREN 706
             GLNEG WP+    +P+LSR M+    L   E+ +G AAHDF+ A G   ++ TR+ R+ 
Sbjct: 578  SGLNEGGWPQALPPDPWLSRPMRLAAGLTLPERRVGLAAHDFQQAVGAGAVVLTRARRDA 637

Query: 707  NIPTIASRWLQRLL-VLG------GTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKP 759
               TI SRWL RL+ +LG      G      +++RG+ +LD    L     +P  +    
Sbjct: 638  EAETIPSRWLNRLVNLLGGLPDQQGPQALAEMRRRGRYWLD----LAELQARPRIRLAPA 693

Query: 760  FPPLEAQP----RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNI 815
              P    P    R  S +E++ LI DPYAVYARR+L L  +   + +PD  +RG + H+I
Sbjct: 694  PRPSPIPPPPALRELSVTEVRTLIRDPYAVYARRVLGLRALDPLRPEPDAAERGNMLHHI 753

Query: 816  ITELIKKRINKNTPEINHLMK----QIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
            +   +  R   + PE    MK     I D   E E   P   + WR     I+   +  E
Sbjct: 754  MDRFL--RGLPDLPETPQAMKARLLAITDEVLEAEVPWPSARLFWRARIAGIADRLMADE 811

Query: 872  EKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNP-KKETAQ 930
             +  +      V    +  I  +   L    DR+D L  G V + DYK+G  P  K+ A 
Sbjct: 812  AERLARGTPTVVEEYGEQGIPGLDFRLIARPDRLDRLHDGQVHVYDYKSGKPPTDKQIAH 871

Query: 931  KLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKS 990
               D QL LEAA ++ G+F  +   +V  + YI+L  + +      + +++SA   +E++
Sbjct: 872  --FDKQLPLEAAMVRHGAFRTLGPAEVEGISYIQLGGEGR-----TEPREFSAG-FAEET 923

Query: 991  LKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                + ++     GE+ F + L + E+S+  S+YDHL+R  EW
Sbjct: 924  WAGFVTLIRRYLGGERGFTARLAM-ERSDHASDYDHLSRHGEW 965


>gi|83950793|ref|ZP_00959526.1| hypothetical protein ISM_06825 [Roseovarius nubinhibens ISM]
 gi|83838692|gb|EAP77988.1| hypothetical protein ISM_06825 [Roseovarius nubinhibens ISM]
          Length = 985

 Score =  285 bits (728), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 291/1054 (27%), Positives = 447/1054 (42%), Gaps = 118/1054 (11%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +F + P   +  E++  L         R +   P  +A VT+ V T++  + LR    
Sbjct: 8    PRLFGLPPGVDYSAELLAGL-------RTRLETQPPEAMARVTLIVNTRKMAKRLRQL-- 58

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPD 125
                    ILP I +L  + E  +    L   +  PP   ++R LELARLI    + L D
Sbjct: 59   -CDSGPDMILPRICTLASL-ESVWPLPGL--PDAMPP---LRRKLELARLI----SALID 107

Query: 126  IIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAA 185
               DL P S L           LA +LA ++D +  E    + + AL        W    
Sbjct: 108  RAPDLAPRSAL---------FDLADSLAGLMDEMHGEGVDMDAIDALDIADQSGHWARLK 158

Query: 186  DFLKIASKYWTER--LVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
             FL I   +  +R       A + +  +  L R +A       +GP+I+AGSTGS   T 
Sbjct: 159  SFLAITRDF-DDRDDCPGAEARNRLVTEALLARWQAAP----PQGPVILAGSTGSRGTTQ 213

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
             LM  VA  P GA+VLPG D  +  + WN + ++             HPQY    LLD L
Sbjct: 214  MLMQAVAALPQGAVVLPGFDYDMSDSAWNALEDRLGG--------EDHPQYRFRALLDQL 265

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLP-PDTSDMRNTDILENKIPNIQKCFSDVALI 362
             +    + R    +     R+ V+S +  P P T   R+   L   IP   +    V L+
Sbjct: 266  GLAPTALPRWTETAPACPPRNAVLSMALRPAPVTDQWRSEGPLLTGIP---EAMQGVTLL 322

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
            EA + R EA++IA+ LR +  E    +ALIT DR+L R+V   L R+ I  D SAG PL 
Sbjct: 323  EAPSRRTEALAIAMRLREAA-EAGTPAALITPDRDLTRQVTAALDRWRILPDDSAGTPLH 381

Query: 423  TTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNS 482
             T     L  +   + +      + TL+KHPL   G       R    LEL   R     
Sbjct: 382  RTAQGRFLRHVAALMTERLSTELLLTLLKHPLTHAGADRGAHLRLARELELHLRR----- 436

Query: 483  YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP--------- 533
                  K L         ++  +  W +   EE +     L D  L    P         
Sbjct: 437  ------KGLPF------PDHEAITTWCAAKPEERQSWCDWLGDTFLAGDLPGSHPLPALA 484

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFE-----EEGKTLSSLF 588
                   +    G+   +DW                   P  W +        ++L+ L 
Sbjct: 485  AHHSALARRIAWGSTPGADW-------------------PPSWSDPLLTPAGPQSLAVLD 525

Query: 589  SKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
               +       A+A+++ +++  L+    V+        + I GT+E+R+   + +IL G
Sbjct: 526  ELALHGPHGGPASAVDFGNLLQNLLSSGEVRSAERADPLIRIWGTIEARVQGAELIILAG 585

Query: 649  LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI 708
            LNEG WP+    +P+L+R ++    L   E+ IG AAHDF+ A     +  TR++R +  
Sbjct: 586  LNEGSWPETPGHDPWLNRALRKQAGLLLPERRIGLAAHDFQQAALGPEIWITRAVRNDEA 645

Query: 709  PTIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFP 761
             T+ SRWL RL  L       GG    D ++ RG+ +LD   +L+  T      RP P P
Sbjct: 646  ETVVSRWLNRLQNLLSGLPDQGGVAALDGMRARGKAWLDRVDQLEAVTPTAPEPRPAPCP 705

Query: 762  PLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI- 820
            P  A+P   S + IK+LI DPYA+YAR +L L  +   ++ PD   RG   H+++   I 
Sbjct: 706  PRAARPSRLSVTAIKRLIRDPYAIYARHVLGLSALNPVQRVPDALMRGNALHDVLERFIT 765

Query: 821  KKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
            + R + +   +  LM+ I D     +       + WR    +++  F+  E   ++    
Sbjct: 766  ETRDDDSGVTVARLMR-IADEELAAQVPWAQTRMQWRARLERVADGFVADELARRTVARP 824

Query: 881  IFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLE 940
              + I  +  + ++G  LT  ADR+D+   G V I DYKTG  P     Q+  D QL LE
Sbjct: 825  AALEIATRGTLPALGFTLTAKADRLDVTPDGKVMIYDYKTG-TPPSAKEQEFFDRQLLLE 883

Query: 941  AAALKAGSFSQIDCRKVANLFYIRLKQKF-KIDCITNDKKKYSADELSEKSLKNLIEIVT 999
            AA  +   +       V    YI L  K  ++D    D     AD  ++     L E++ 
Sbjct: 884  AALTENFGWENFGAAPVLRAAYIGLGAKAGELDAPLEDLSP--ADTWAQ-----LAELIG 936

Query: 1000 LLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                 ++ F+S   L +  ++  +YD LAR  EW
Sbjct: 937  AYMQPDKGFVSRRALQKAEDV-GDYDQLARYGEW 969


>gi|85708410|ref|ZP_01039476.1| helicase [Erythrobacter sp. NAP1]
 gi|85689944|gb|EAQ29947.1| helicase [Erythrobacter sp. NAP1]
          Length = 1012

 Score =  278 bits (710), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 289/1077 (26%), Positives = 463/1077 (42%), Gaps = 134/1077 (12%)

Query: 5    KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
            KP V++IA    F   ++  L+     E F         LA VT+ VP+ RA + +   F
Sbjct: 10   KPKVYSIAAHRGFADALVAGLVPRYEEEGFG--------LARVTLLVPSSRAARTMSEAF 61

Query: 65   IEITG---KKSTILPIIKSLGDV-VEEKFTA--DLLLSYNLNPPVSNIQRLLELARLILI 118
            I   G   +   ++P + ++GD+ ++E   A  D L + ++ P V   +RLLELA+L+  
Sbjct: 62   IRWCGENDRAGMLMPRMVTVGDLDLDESLGALLDPLGASDIPPAVEPTRRLLELAQLV-- 119

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHA-----LK 173
               +  D+ K          P+  A  + LA  +A  +D +  E+K+ EDL +     + 
Sbjct: 120  -EEERADLGKP---------PLPGAARMRLASEIARTMDRLLVEDKEPEDLTSDAVLDML 169

Query: 174  NEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM--RAEAEHLMKGTKGPII 231
             +    W      F ++ ++ W  RL E N       +  L+  RA         + PII
Sbjct: 170  GDLSDHWKDSLRLFARVQAR-WRSRLDE-NGEVDAATRRNLLFERASKRWREIPPETPII 227

Query: 232  IAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS-- 289
             AG T + PA AR++  +A+ P GA++LP LD  +    W+ +             +   
Sbjct: 228  AAGVTSASPALARMLRVIAHLPCGAVILPDLDLSLGDEAWDELGRAGATPEPGGEVFGQS 287

Query: 290  ---THPQYSLAKLLDFLDIKREDVK---RLGNVSNEMYGRSMVISKSFLPPDTSDMRNTD 343
               THPQY L  LL+ + I R +V+   R G  + +   RS  IS  FLPP  S  R+  
Sbjct: 288  DALTHPQYHLKLLLERMGIARAEVRAWHRSGMTAAD-PARSHAISSLFLPPKAS--RSWV 344

Query: 344  ILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVK 403
             L  +    ++  S V L+ +    EEA +IA+ +R +L+E  K+ A++TADR+LARRV 
Sbjct: 345  ELGPE----KRRLSGVKLMTSATSEEEAQAIALLVREALEEPAKRIAVVTADRSLARRVT 400

Query: 404  LELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKY 463
              L R+ I  D SAG  LS T    +L  L + +        +  L+ HPL K G  E  
Sbjct: 401  QHLERWSIMADDSAGRALSLTPAGRLLGLLADIMSHGLAPAGLVALIAHPLVKRGDGEAR 460

Query: 464  LSRAKNALEL-VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVL 522
                +N  +   ALRG   +     L+ +             V  W              
Sbjct: 461  RQWLRNVRKFDRALRGPSPAPGFEPLRQIA--------REAGVSEW-------------- 498

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL----DEHRKLPNLWFE 578
              + + + ++PLV                     T+T  Q++ +     E      +W  
Sbjct: 499  -FEEVEEILSPLVDLPE-----------------TITLAQSLDMLASSAERLAAEAVWAA 540

Query: 579  EEGKTLSSLFSKI----IETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTL 634
            E+G+ LS L   +     E  + +  + I    I+   +D   V+P       + ILG L
Sbjct: 541  EDGRALSRLLEDLRLHAREIATTVSPSDI--ASILRDRMDEVAVRPPYGGHPRVAILGLL 598

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            ESR+   D +I GGLNEG WP+    +  L+  +   L +  AE  IG AAHD   A G 
Sbjct: 599  ESRMARADLVICGGLNEGSWPQAPGSDALLAPGVLRALGVPGAEFRIGLAAHDLAGAMGA 658

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTK-QPH 753
              ++ +RS R+   PT+ SR++ R+  L G     + +KR    L     LD   +  P 
Sbjct: 659  PEVVLSRSQRDAEGPTLPSRFVLRVEALLGELAGRHREKRTPAMLPL---LDREPEPAPA 715

Query: 754  YKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDP--DRTDRGTL 811
            Y RP+P P  + +    S + + +L+ DPY  YA+ IL L  +     DP  D   RGTL
Sbjct: 716  YPRPQPTPTADQRKVRISATALDRLLGDPYQFYAQEILGLRRLDPLAADPFGDPALRGTL 775

Query: 812  FHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE 871
             H+I+    K R    T EI    +++    F +  + P    +W+         F +  
Sbjct: 776  VHDILDAWHKAREAHPTLEIAPFAERM----FAEAKVHPLFKGLWQPRLVAAMERFEQWV 831

Query: 872  EKIQSSIEKIFVN-IPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQ 930
            +        + V     +M+++  GI ++G ADRID L  G + + DYKTG        +
Sbjct: 832  DDAAKDGRTVLVTETRGEMSVD--GIPVSGRADRIDRLGDGRLVVVDYKTGGPASASQVE 889

Query: 931  KLIDPQLSLEAAALKAGSFSQID-CRKVANLFYIRLKQ-----KFKIDCI----TNDKKK 980
                 Q+ +     + G+F +     +VA   Y  L +     +F    +    T  +K 
Sbjct: 890  AGYALQMGILGLIARDGAFEKGKLSGEVATYEYWSLGRSKDDGEFGYQTVPLKMTPRQKG 949

Query: 981  YSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQ----SEYDHLARVAEW 1033
             + +E   +  + L   ++    G+ PF +      K N      S+YD L R+ EW
Sbjct: 950  LTPEEFLPRHEEFLNTAISKYLLGDAPFTA------KENPDYLGYSDYDQLMRLEEW 1000


>gi|332185717|ref|ZP_08387464.1| double-strand break repair protein AddB [Sphingomonas sp. S17]
 gi|332014075|gb|EGI56133.1| double-strand break repair protein AddB [Sphingomonas sp. S17]
          Length = 984

 Score =  275 bits (703), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 273/1051 (25%), Positives = 440/1051 (41%), Gaps = 97/1051 (9%)

Query: 4    KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
            ++P + TI    P  R    AL+ G +    R    +PL LA   I +PT R ++ +   
Sbjct: 5    RRPRLHTI----PAHRGFADALVAGLM----RRTGGDPLTLAQGMILLPTNRGVRAVTEA 56

Query: 64   FIEITGKKSTILPIIKSLGDVVEEKFTADLL----LSYNLNPPVSNIQRLLELARLILIW 119
            F+  +G    ILP + +LGD    +     L          P ++   R + LARL+   
Sbjct: 57   FVRASGG-GLILPRMVALGDPELGEAAGSALDPADAEAPPPPAIAPSARRMILARLVEEE 115

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALK-NEKYG 178
            R +                P++ A A+ LA +LA  +D +  EE +  +L AL    +  
Sbjct: 116  RKRA-------------GQPVTAAEAVRLAGDLARTLDQMLIEEVEPAELAALDLGPELT 162

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIIIAGSTG 237
              W  A     +    W   L  +        +  L  R       +   G +  AG T 
Sbjct: 163  EHWQAALQTFSVVLDRWPAILARMGRIDAARRRTLLFDRIVTRWRDQPPAGFVCAAGVTD 222

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS--THPQYS 295
            + PA AR++  V+  P G++V  GLD  +P   W+ +     +  +     S  THPQY+
Sbjct: 223  TAPAVARVLRCVSEMPGGSVVFAGLDLTMPAEEWDALGPHKPDPVTGRIRRSIETHPQYA 282

Query: 296  LAKLLDFLDIKREDVK--RLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQ 353
            L  LLD + + R++V   R G   +    R   I+ +  P D +  + TD+     P   
Sbjct: 283  LKLLLDRMGVGRDEVTIWRGGGDYDAGAARGRAIANAMAPADFTG-KWTDL-----PAED 336

Query: 354  KCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINI 413
            +  S V+ IE     EEA +IA+ALR +++E  + +AL+T DR LARRV     R+ I I
Sbjct: 337  RRLSGVSTIELATPAEEAQAIALALREAVEEPGRTAALVTPDRALARRVAAHCRRWNILI 396

Query: 414  DISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            D +AG PLS  L  + L  L  A  +    + +  L+KHPL               +L+ 
Sbjct: 397  DDTAGRPLSILLPGTFLLQLAEAAAQHFAPLPLLALLKHPLIHGDMERVDWLDGVRSLDR 456

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
              LRG + +  +  + + + DR       T    W               V  +LQ +  
Sbjct: 457  -GLRGPRPAPGLDGIAAHIADR------PTAAGFWAK-------------VAPMLQPVG- 495

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIE 593
              T+     +  G L+          C Q +C D       LW    G+  +   S   E
Sbjct: 496  -RTFGDGAQTLRGLLAC------LRECGQALCGD------ALWTGPAGRAAAEFLSGYEE 542

Query: 594  TG--SCIKANAIEWIDIITRLIDGETVK--PKIEKSSTLFILGTLESRLLNFDTLILGGL 649
                  ++ +  +   ++  L+D   V+  P+  +   L I G +E+RL   D +I  GL
Sbjct: 543  QADHGPVRIDPADLPGLMRSLLDEIAVRAIPREGQHPRLAIYGPIEARLQTADLMIAAGL 602

Query: 650  NEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIP 709
            NEGVWP   A +P+L+  +++ L L   E+ IG AAHD   A G    I TR+ R+ + P
Sbjct: 603  NEGVWPGRPAPDPWLAPRIRAQLGLVGLEQRIGIAAHDLAQAMGAPRAILTRARRDASGP 662

Query: 710  TIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            T+ASR+  RL  + G  F  +          W  +LD         RP P PP   +P  
Sbjct: 663  TLASRFWLRLQAMAGERFEGH-----PTLAAWAERLDRPDAYTPVDRPAPKPPARLRPTV 717

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
             S +E+ +L  DPYA YARR+L+L  +     DP    RGT  H+I+    K    ++  
Sbjct: 718  ISVTEVDRLKADPYAFYARRVLRLTPLDPVDADPSAAWRGTAVHDILEAWWK----EDAC 773

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWR-HLFHKISHSFLEHEEKIQSSIEKIFVNIPAK 888
             +  L  + + +    +   P +  +W+  L   I   ++  E   +++  +  ++   K
Sbjct: 774  AVEALRPRAL-AMLRDQRTHPMMRALWQPRLIEAI--DWIAAEVAAKAAEGRHVLSAEGK 830

Query: 889  MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGS 948
               +  G+ LTG  DRID    G + + DYKTG  P     ++    QL L     + G 
Sbjct: 831  GEAKLAGVTLTGRFDRIDRTPDGGLVVIDYKTGKPPSAVAVREGFSLQLGLLGLIAERGG 890

Query: 949  FSQIDCRKVANLFYIRLKQKFKIDCIT------NDKKKYSADELSEKSLKNLIEIVTLLQ 1002
            F  +  +     ++   + +  +  I         + +   DE    +  N  +      
Sbjct: 891  FEGVAGKAGGFEYWSLGRSREGLGYIATPVDPEGKRDRIRTDEFVAIAAANFADAAGQWL 950

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
             G+ PF +  +L  +    +EYD L R  EW
Sbjct: 951  TGDAPFTA--KLVPEYAPYAEYDQLMRRDEW 979


>gi|304320183|ref|YP_003853826.1| hypothetical protein PB2503_03042 [Parvularcula bermudensis HTCC2503]
 gi|303299086|gb|ADM08685.1| hypothetical protein PB2503_03042 [Parvularcula bermudensis HTCC2503]
          Length = 1015

 Score =  274 bits (701), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 290/1072 (27%), Positives = 451/1072 (42%), Gaps = 130/1072 (12%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P +FTI    PF   ++  L+       F  DP     LA +TIY+P +RA + L     
Sbjct: 17   PAIFTIPQGVPFLEALVAPLMRA-----FEGDPAG---LADLTIYLPNRRAARRLIDHLA 68

Query: 66   EITGKKSTILPIIKSLGDVVEEK--FTA-DLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
                  + ILP ++ LGD+ E+   F+A D++    +   V  + R L LA L+   +  
Sbjct: 69   ASAPTGTVILPQLRVLGDITEDDLMFSAPDMVADEEVPLAVDPMDRRLILAHLLAQRKAA 128

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNE----KYG 178
              D        +  S P  P + +  A  LA ++D    E      L ++  E    +  
Sbjct: 129  EGDTAAPARMSAAAS-PDWP-SLLAGADALASVLDSFHREALPLSALLSMTPEDLAGRAA 186

Query: 179  MWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGP-IIIAGSTG 237
              W     FL I ++ W   L +         Q  LM A A+HL     GP I+IAG+ G
Sbjct: 187  DHWHEHLRFLSILAEAWPAILSKQGCIELSDRQTRLMTALADHLSATPDGPPILIAGALG 246

Query: 238  SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA 297
            +  ATA LM +VA  P GA++LPG    +P A      ++ST +  S      HPQ +  
Sbjct: 247  ATEATAHLMESVAKSPRGAVILPGA---MPMA-----ADQSTLLPPS------HPQAAFQ 292

Query: 298  KLLDFLDIKREDVKRLGNVSN--------EMYGRSMVISKSFLPPDTSDMRNTDILENKI 349
            + L          +R+G  ++         M  R    +++FL    +    T     + 
Sbjct: 293  RWL----------RRVGGGASVDLSPWDERMTDRKQA-TRAFLSLALTPAEETGDWHRRF 341

Query: 350  PNIQKCFS-DVALIE-----ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVK 403
             + +  +S D AL       A    EEA  +A+ LR  L+   K + L+T DR+LARRV 
Sbjct: 342  ADFRDAYSLDEALAPLSFATAGTPNEEADFVALLLREVLETEGKTALLVTPDRDLARRVC 401

Query: 404  LELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKY 463
             +L ++ I +D S G PL      + +    + +   +D +A+A LV H L         
Sbjct: 402  AKLRQWDIRLDDSGGTPLYGAYRGTYIRQWAHWLGAPDDPVALAALVAHGLF-------- 453

Query: 464  LSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQS---RLSEEDKE-L 519
                        LRG   S      K  +  R+  +        WQ    RL+ E    L
Sbjct: 454  ------------LRGLTRSD-----KERLARRVDRRLRGMRPRDWQDTQRRLAGEGPSPL 496

Query: 520  AVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEE 579
               L+  +   +       T        + I+D    +    Q            LW ++
Sbjct: 497  ETELLQDLDAALRAFQAATTQHERLRALIEIADRFARSADGDQL-----------LWQDQ 545

Query: 580  EGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLL 639
            +G+ L++  S +++T          +  +   L+ G  V         L +LG +E+RL 
Sbjct: 546  DGEALAAQLSAMMQTAFLPDCPPAAFASLFEALL-GSAVIRTYGTHPRLTVLGLVEARLQ 604

Query: 640  NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIY 699
            + D +IL GL EG WPK T  +PFL   ++  L L T +  +G++A DF        +I 
Sbjct: 605  SADRVILAGLTEGTWPKLTTADPFLPHNVRLALGLPTHDAEVGRSALDFVDHALGEEVIL 664

Query: 700  TRSLRENNIPTIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKLDYTTKQP 752
             RS + +  P + SRWL RL  L         TD    L+        W   L +     
Sbjct: 665  IRSEKSDRGPALPSRWLTRLYNLIEAAKQTEATDITGRLRG-------WVGALRHPASVD 717

Query: 753  HYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF 812
                P P P     P   S S+I QLI DPY+VYARR+L+L  +    ++P   +RGTLF
Sbjct: 718  PALPPMPRPAAALLPARLSVSDIGQLIRDPYSVYARRLLRLFPLDPLAQEPAERERGTLF 777

Query: 813  HNIITELIKKRINKNTPEI-NHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSF-LEH 870
            H +   L K   ++ T E+  H + + ID        P     ++  +  +   +F +  
Sbjct: 778  HAVYERLAKVAPDRVTQEVFAHALAETIDDCL----YPSECHDLYAMMGQRAGKAFSVIS 833

Query: 871  EEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPK-KE 927
            + + +      F  I  ++ + + G  I L G ADRIDL   G   I DYK G  P  K+
Sbjct: 834  QTQRRDGATATFAEIEGELTVMAGGRSIDLYGRADRIDLYPDGTYTIIDYKGGSAPTFKQ 893

Query: 928  TAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKK---KYSAD 984
             A    +PQLS+ A    AG F  +   +V  L Y  + +K        ++K     + +
Sbjct: 894  DAS--FEPQLSVLAMMAAAGGFKDLRRGQVRRLAYTPMLRKEAWSVPFTEEKVPWMVAGE 951

Query: 985  ELSE---KSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            +L     ++ +NL  ++T   +G+  F S LR   KSN + +YDHLAR  EW
Sbjct: 952  DLKAHLLETAQNLNRMMTEFVSGQFVFHSQLR-PFKSNSEGDYDHLARRREW 1002


>gi|103485654|ref|YP_615215.1| helicase [Sphingopyxis alaskensis RB2256]
 gi|98975731|gb|ABF51882.1| helicase [Sphingopyxis alaskensis RB2256]
          Length = 991

 Score =  273 bits (699), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 276/1066 (25%), Positives = 433/1066 (40%), Gaps = 116/1066 (10%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M  ++P +F+I    P  R    AL  G L++ +    L    L    + +P+ RA   +
Sbjct: 1    MATRRPTLFSI----PVQRAFADALAAG-LIDRYADGVLG---LTEGIVLLPSNRARSAV 52

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            ++ F+   G    ++P +  +GD   ++  A  L + +++ P+      L          
Sbjct: 53   QAAFVR-AGGAGLLMPRLAVIGDADLDENVALALDAVDMDAPLPPAIEPLRRR------- 104

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
              L ++I+   P      P++ A A  LA  LA +ID +  EE     L  L    +   
Sbjct: 105  LLLAELIERYTPAG--EPPVTGAAAFQLAGGLARVIDQLHYEEIPAAALVDLDLGAFADH 162

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIIIAGSTGSI 239
            W  +   L++   +W + L           + AL+ R  A          ++ AG T + 
Sbjct: 163  WRASLARLRLLVDHWPDVLAATGHIDRAARRNALLDRVAAAWRTAAPARFVVAAGITTAA 222

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PA ARL+ TVA+   G +VLPGLD  + TA W  +     +   S     THPQY L  L
Sbjct: 223  PAIARLLRTVADMERGMVVLPGLDTAMATAEWEALGPTGPDPDRSARPLETHPQYHLKLL 282

Query: 300  LDFLDIKREDVKRLGNVS--NEMYGRSMVISKSFLPPD-TSDMRNTDILENKIPNIQKC- 355
            LD + I RE+V      S  +    RS  +S  F P D T+  +    LE     I    
Sbjct: 283  LDRMGIAREEVAEWEARSPFDGPEARSRFVSLLFAPADYTARWQAAGDLEAATAGIAGAT 342

Query: 356  FSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDI 415
            F+D A        +EA  IA+ +R +++   + +AL+T DR LA R+   L R+GI +D 
Sbjct: 343  FADDA--------QEAQGIALLMRHAVETPGRTAALVTPDRALAERIAAALARWGIAVDD 394

Query: 416  SAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA 475
            SAG PL+ T   ++   L       N    IA L+ HPL + G P      A   L+L+ 
Sbjct: 395  SAGQPLARTPPGALAMLLAELAADFNPVALIA-LLAHPLVRRGEPRTAWLDAVRQLDLL- 452

Query: 476  LRGNKNSYDIMDLKSLVLDRIATQKNNTHV------PHWQSRLSEEDKELAVLLVDHILQ 529
            LR    +     + + +    A +    H       P W              L +  + 
Sbjct: 453  LREPGLAPGWAGVSARIAALAADRDARGHALAVELAPWWHQ------------LGEAFVP 500

Query: 530  CITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFS 589
             + P        +            +L     Q +   E       W    G+ L+ LF 
Sbjct: 501  LLAPFAGPPVAPD------------RLLAALRQGL---EWLTGEAAWTGPAGRMLAELFD 545

Query: 590  K--IIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
            +  +       +    ++  ++ +L+   +V+P       LFI G LE+RL   D +ILG
Sbjct: 546  RWTLARGAGPARVAPADFPAMLGQLLGEASVRPPYGGHPRLFIWGLLEARLQRADLMILG 605

Query: 648  GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENN 707
            GL+EG WP  T  +P+L+  ++  + L   E+  G AAHDF  A G   ++ TR+LR   
Sbjct: 606  GLDEGRWPAATQPDPWLAPGIRRLIGLPATERQQGMAAHDFAGALGAGEIVVTRALRSGG 665

Query: 708  IPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTK--QPHYKRPKPFPPLEA 765
             P +ASR+  RL  L G          G    D   ++D      +P  K P P PP + 
Sbjct: 666  DPAVASRFWLRLAALAGD--LPQPALDGVPLTDLAARIDLPADDIEPAGK-PCPAPPADR 722

Query: 766  QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRIN 825
            +PR  S + + +L  DP+A YA +IL L  +      PD   RGT  H +    ++   N
Sbjct: 723  RPRRISVTAVDRLARDPFAYYANQILGLSPLAPLSAAPDPRWRGTRVHALFERWVRAGAN 782

Query: 826  -----------KNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKI 874
                       ++ P ++ + +      F    + P +    R L      + L  E   
Sbjct: 783  AAAFEAELAALRDDPALDAIARA-----FWLPRIEPALRWAARQLIEAEGRTALRAEAWG 837

Query: 875  QSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLID 934
            + +++               GI LTG ADR+D L+ G + I DYKTG  P  + A   +D
Sbjct: 838  EIALD---------------GITLTGKADRVDRLRDGRLAIVDYKTGGAPNAKAAFDKLD 882

Query: 935  PQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKY-------SADELS 987
             QL L     + G  + +D  ++A L Y  L+   K          Y       SA E  
Sbjct: 883  NQLGLLGLIARRGGLAGVDAAEIAALEYWSLRPDRKAGGAGKISSTYGPRSDLKSAAEAV 942

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            + +   L  +      G+ PF         S    +YD L R  EW
Sbjct: 943  DHAADALAGLAARYLFGDAPFAPG-----DSATYGDYDQLMRRDEW 983


>gi|85373840|ref|YP_457902.1| helicase [Erythrobacter litoralis HTCC2594]
 gi|84786923|gb|ABC63105.1| helicase [Erythrobacter litoralis HTCC2594]
          Length = 994

 Score =  268 bits (684), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 280/1072 (26%), Positives = 460/1072 (42%), Gaps = 129/1072 (12%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P V++IA      R    AL+ G LV  +  D L    LA +T+ +P+ RA++ +   FI
Sbjct: 11   PQVYSIA----AHRGFADALVAG-LVPRYAEDGLG---LARLTLLLPSTRAMRTVSEAFI 62

Query: 66   EITGK---KSTILPIIKSLGDV-VEEKFTA--DLLLSYNLNPPVSNIQRLLELARLILIW 119
               G+   K  ++P + ++GD+ ++E   +  D L + ++ P V    R L LA +    
Sbjct: 63   RHFGEIGVKGMLMPRMAAIGDLDLDETLGSLLDPLGASDIPPAVDPTYRWLRLAEV---- 118

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDL------HALK 173
               L D++ D  P+         A+   LA+  A  +D +  E+   E+L          
Sbjct: 119  ---LRDVMGDDAPQG--------ASLFVLARETAQTMDRLLVEDIGPEELLQDRVLDLFD 167

Query: 174  NEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALM-RAEAEHLMKGTKGPIII 232
             +    W      F K+  ++W   L E  A      +  L  RA      +    PI+ 
Sbjct: 168  RDLAKHWQDNLRRFAKV-QQFWLAELGERGALDAAARRNRLFERAAKRWKAEPPATPIVA 226

Query: 233  AGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYS--- 289
            AG T + PA ARL+  V+  P GA++LP LD  +  A+W  +        S    ++   
Sbjct: 227  AGVTSAAPALARLLRVVSELPQGAVILPDLDLTMDAAVWEELGRAGAPAASGGAPFAKDD 286

Query: 290  --THPQYSLAKLLDFLDIKREDV-----KRLGNVSNEMYGRSMVISKSFLPPDTSDMRNT 342
              THPQY L  LL+ + + R+++     K  G   +E   RS  +S  FLPP+ S +   
Sbjct: 287  AVTHPQYHLKLLLNRMGVSRDEIQPWHRKGSGAARSE---RSHAVSAVFLPPEASKV--- 340

Query: 343  DILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRV 402
                  +P+ ++  S + L+E  N   EA ++A+A+R +L E +++ A+IT DRNLARRV
Sbjct: 341  ---WVDLPSEKRHLSGIRLMELPNPEAEAQAVALAVRQALAEPERRVAVITPDRNLARRV 397

Query: 403  KLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEK 462
               L R+ I  D SAG PL+ T    +   L   +      + +  L+ HPL + G   +
Sbjct: 398  VHHLRRWNIEADDSAGRPLAQTTAGRLFLLLAEVMGTNAAPVPLMALLGHPLVRQGEERR 457

Query: 463  YLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVL 522
               R   ALE   LRG++ +  +  ++ +             V  W        +E+  L
Sbjct: 458  QWLRDLRALER-KLRGSRPAPGLAAIRPVA--------REAQVIDWW-------EEVEAL 501

Query: 523  LVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGK 582
            L         PL         T   LS++D         + +C +       LW +E+G+
Sbjct: 502  L--------GPLA-------GTDDPLSLADCLDTLAAVGEALCGE------ALWAQEDGR 540

Query: 583  TLSSLFSKIIETGSCIKANAIEWID---IITRLIDGETVKPKIEKSSTLFILGTLESRLL 639
             LS+    + +    +    I   D   I+T  +D   V+P       + I G LE+R+ 
Sbjct: 541  ALSATVEDLRQHARAV-GTQIRRADAHAILTDAMDQVAVRPPYGGHPRVAIYGLLEARMS 599

Query: 640  NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIY 699
              D +I  GLNEG WP   + +P L+  +   L +  A+  IG +AHD   A G   ++ 
Sbjct: 600  RADLVICAGLNEGSWPGRPSVDPLLAPPVLRALGVPGADFRIGLSAHDLAGALGAPEVLL 659

Query: 700  TRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKP 759
            +RS R+   P I SR+L R+  L G +  +  ++R    L    ++D    +P Y+RP+P
Sbjct: 660  SRSERDAEGPAIPSRFLLRVKALLG-ELLERYEERDLPRL--AERIDDAPLEPRYQRPEP 716

Query: 760  FPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITEL 819
             P  E +    S + + +L +DPY  YA  IL+L  +     +P    +G L H+I+   
Sbjct: 717  MPSAEERRERISVTALDRLRSDPYQFYASAILRLKELDGLDAEPTPAWQGQLAHDILEHW 776

Query: 820  IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
             +     + P+I       +D H       P    +W     K +  ++  E  I+  ++
Sbjct: 777  HEH--GGSLPDIAKAKLTEMDHH-------PLTRALWEPRLMK-ALEWVASE--IEGDMD 824

Query: 880  KIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
            +  V       IE  G+ + G  DR+D L  G   + DYKTG  P     +     QL  
Sbjct: 825  RTPVLWEKWGEIEHRGVTIFGRIDRLDRLADGTFAVVDYKTGSPPSGSQVEAGYALQLGT 884

Query: 940  EAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDC-------------ITNDKKKYSADEL 986
                +  G F++      A+ F      K K                I+  +     +E 
Sbjct: 885  LGLMVGKGGFAKHGIHGAASAFEYWSLAKAKSATHETGFGYIETPLKISGKRSGIDPEEF 944

Query: 987  SEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW--REE 1036
              K+   L + ++    G++PF +  RL+  +     YD L R+ EW  REE
Sbjct: 945  LPKAADYLDDALSRWVLGDEPFTA--RLNPDAPGYDTYDQLMRLDEWQGREE 994


>gi|56551995|ref|YP_162834.1| double-strand break repair protein AddB [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56543569|gb|AAV89723.1| double-strand break repair protein AddB [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 993

 Score =  263 bits (671), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 252/948 (26%), Positives = 415/948 (43%), Gaps = 108/948 (11%)

Query: 4   KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
           +K  +FTI    PF R    AL+ G +    RYD  +P+ LA   I +P  R+I+ +   
Sbjct: 3   EKSRLFTI----PFHRSFADALVEGLIK---RYD--DPMTLAQGLILLPNNRSIRAITEA 53

Query: 64  FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN----LNPPVSNIQRLLELARLILIW 119
           F+        +LP +  +GD + +      L   +    L P +  ++R   L RL+   
Sbjct: 54  FVR-QSSSGLLLPRMVPVGDPLLDDRLGAFLDPVDMIDPLPPAIPPLERHFRLTRLV--- 109

Query: 120 RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDL----HALKNE 175
                   K +  +   ++ +  A+   LA+ LA  +D +   E   E L      L  E
Sbjct: 110 --------KKVMQKQGRTIAVPEAHR--LAEELALTLDQLMAAEIAPEQLTQLIDPLAEE 159

Query: 176 KYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMR-----AEAEHLMKGTKGPI 230
           +    W  +   L+     W E   EL  +  +  Q    R     A+       ++ PI
Sbjct: 160 ELARHWQASLKLLECIITEWPE---ELKKTGQIESQERRNRLLDRLADRWQTQPPSEKPI 216

Query: 231 IIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT--EKSTNITSSNTTY 288
           I AG+    P +ARL+  ++   +G +VLPGLD ++    W  +   E+  +      + 
Sbjct: 217 IAAGAITGSPVSARLLRVISEMEDGLVVLPGLDNNMSDEEWQLLGPHERDPDTGIKQPSL 276

Query: 289 STHPQYSLAKLLDFLDIKREDVKRLGNVSN-EMYGRSMVISKSFLPPDTSDMRNTDILEN 347
            +HPQ+ L  LLD + + R++V       N     R   I     P   +D   +     
Sbjct: 277 ESHPQFQLKLLLDRMGVDRKEVIEWDPPKNYHPDNREQAIRHVMAPARYTDRWRS----- 331

Query: 348 KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            +P  ++ F ++++IE  +  EEA  IA+ALR +++E  + +AL+T DR LA RV   L 
Sbjct: 332 -LPEKERAFPNLSVIETAHPEEEAQVIALALREAVEEKGQTAALVTPDRALAIRVSALLK 390

Query: 408 RFGINIDISAGIPLSTTLHSSILTSLLNAI---FKLNDFMAIATLVKHPLAKFGFPEKYL 464
           RFGI+ D SAG PLS T    +L  L++     F    F+AIA   KHPL  FG      
Sbjct: 391 RFGIDADDSAGRPLSLTPPGLLLLDLVSLAADHFSAVSFLAIA---KHPLVAFGEERDLW 447

Query: 465 SRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLV 524
                +L+++ LRG      +  + + + + +  QK +  +  W      E  +     +
Sbjct: 448 RDHIRSLDMI-LRGPLLRNGLAGITAKIKEAVDNQKADPELLAWW-----EKTKTPFQAL 501

Query: 525 DHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTL 584
           D   Q + PL         T   ++                         +W E  G   
Sbjct: 502 DQQYQSVLPLTKIVKILRETANQIAGE----------------------KIWAEAAGHLA 539

Query: 585 SSLFSKIIETGSCIKANAIEWID---IITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
           + L ++I E+ +      + + D   ++ +L+D + V+P       +FI G +E+RL + 
Sbjct: 540 ADLIAEI-ESLAADHNEDMRFSDFAHVLRQLMDKQAVRPMTGGHPRIFIWGLIEARLQHA 598

Query: 642 DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
           D +I   LNE VWP     +P+L+  ++S+L L   E  IG AAHDF    G + ++ TR
Sbjct: 599 DLMIAASLNETVWPPIKEADPWLAPRIRSELGLPGLELRIGIAAHDFSSVLGAKKILLTR 658

Query: 702 SLRENNIPTIASR-WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPF 760
           + R+   PT+ SR WL+   +       DNL         W R+LD         RP P 
Sbjct: 659 ARRDARAPTMPSRFWLRLEAMAANLHHADNLPY-------WARQLDEPQGFRPVTRPAPN 711

Query: 761 PPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI 820
           PP+  +P+  + +    L +DPY+ YA  IL L  +     +P    RG+L H+I+   +
Sbjct: 712 PPVLDRPKRIAVTRFDSLQSDPYSYYASNILGLRKLDPVDAEPTAAWRGSLIHSILENWV 771

Query: 821 KK---RINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW-RHLFHKISHSFLEHEEKIQS 876
           K+   RI K  P     ++  I++H  ++ L       W   L   I   ++E E +  +
Sbjct: 772 KEDNSRIGKLKPRALAFLES-INAHIIQKTL-------WLPRLLQAI--DWIEDEVQKNA 821

Query: 877 SIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNP 924
           +  +  +++  +   +  GI L GF DRID +  G + I DYKTG  P
Sbjct: 822 AEGRTILDVEREGRSQINGIELFGFVDRIDRMGDGSLAIVDYKTGTPP 869


>gi|87200014|ref|YP_497271.1| helicase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135695|gb|ABD26437.1| helicase [Novosphingobium aromaticivorans DSM 12444]
          Length = 993

 Score =  262 bits (670), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 265/1062 (24%), Positives = 457/1062 (43%), Gaps = 114/1062 (10%)

Query: 3    NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
              +P V++IA      R    AL+ G LV  +R D      LA +T+ +P++RA++ +  
Sbjct: 5    RARPRVWSIA----AHRGFADALVAG-LVPRYREDRFG---LARLTLLLPSQRAVRTVTE 56

Query: 63   EFIEITGKKSTILPIIKSLGDVVEEKFTADLL--LSYNLNPP--VSNIQRLLELARLILI 118
             F+  +G    +LP +  +GD+  ++    LL  +   ++ P  V  + RLL +A     
Sbjct: 57   AFVRASGA-GLLLPRMTVVGDLDLDETLGPLLDPIGAGVDMPEAVDPVWRLLRIA----- 110

Query: 119  WRNKLPDIIKDLYPESPLSLPISPANAIWL--AKNLADIID-----IIETEEKKWEDLHA 171
                   I++D   E       +P  A  L  A+ +A  ID      ++ E    E +  
Sbjct: 111  ------GILRDELGED------APGEAALLRQARGIAQGIDRLLVEGVQPERMLDEAVIG 158

Query: 172  LKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPII 231
            +  E    W      F ++  ++  E        +P      L  A      +    P+I
Sbjct: 159  IAAELSEHWQESTRLFARVFFRWRAELEAIGKVDAPERRNRLLDHAARSWRERPPAHPVI 218

Query: 232  IAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS--SNTTYS 289
             AG T + P  ARL+ TVA+ P G +VLP LD  +   +W+ +                 
Sbjct: 219  AAGVTSASPVVARLLRTVADMPEGGVVLPDLDLALDPEVWDALGSAGGPDGGLFERGDVV 278

Query: 290  THPQYSLAKLLDFLDIKREDVK---RLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILE 346
            THPQY L  LL+ + I R++V+   R G  +     RS  IS  FLPP+ S    +  LE
Sbjct: 279  THPQYHLKLLLNRMGIARDEVQPWHRAGLAAAPPE-RSRAISNLFLPPEASAAWVS--LE 335

Query: 347  NKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLEL 406
             +    ++  + V ++E  +  EEA +IA+ +R +L E +++ A+IT DR+LA R+   L
Sbjct: 336  AR----ERRLAGVRVMETAHPEEEAQAIAVLVREALKEPERRVAVITPDRSLAARIVAHL 391

Query: 407  TRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEK-YLS 465
             R+ I  D +AG PL  T    +L  L   + +    + +  L+ HPL + G     +L 
Sbjct: 392  GRWNIGADDTAGRPLPQTAAGRLLLQLAEVVAERAAPVPLLALLGHPLVQGGEGRPVWLE 451

Query: 466  RAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVD 525
            R +  L+LV LRG +    +  ++  V D+  T K    +P W S +  ED    ++ ++
Sbjct: 452  RVRQ-LDLV-LRGPRPGPGLPAIRQAV-DK--TAKRFPALPDWWSGV--EDLLFPLVPLE 504

Query: 526  HILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLS 585
              +     LV       + CG                            LW + +G++L+
Sbjct: 505  GAVPLDMALVALVEAGEALCGT--------------------------ALWAQADGRSLA 538

Query: 586  SLFSKIIETGSCIKA--NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDT 643
            +   +  +      A  +  E   ++   ++  +V+P       L I G LE+R+   D 
Sbjct: 539  AFVERWRDAAGDAPAMVDVAELPSLLRDAMEEISVRPPWGGHPRLAIYGLLEARMSRADL 598

Query: 644  LILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSL 703
            +I GGL EG WP + A +P L+  +   L +  AE  IG +AHD   A G   ++ + + 
Sbjct: 599  VICGGLTEGTWPGSPAPDPLLAPAILRALGIPGAEFRIGLSAHDLAAALGAPEVVLSHAR 658

Query: 704  RENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPL 763
            R+ + P I SR+L R+  + G    D L+   +  ++  R L    +   + +P+P P  
Sbjct: 659  RDASGPVIPSRFLLRIHAMLG----DQLRIEERA-VELARALADADRIAPHPQPRPMPSA 713

Query: 764  EAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKR 823
            E +    + + + +L  DPY  YA  IL L  +     DP    +GT  H+++       
Sbjct: 714  EQRRVPIAVTALDRLRGDPYQFYASAILGLRSLDPIDADPTPAWKGTAVHDVL------- 766

Query: 824  INKNTPEINHLMKQII---DSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
              K   E   +  Q++   +  F++ +  P +  +W+       H   E  +++     +
Sbjct: 767  --KAWHESGGVPGQLVPLAERMFDEMSAHPFMRTMWKPRLVDALHWIEEETDRLAGEGRE 824

Query: 881  IF-VNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
            +  V    ++ ++ I IH  G ADRID L  G + + DYKTG  P  +   +    QL L
Sbjct: 825  VLAVERKGEIVVDGIRIH--GRADRIDRLPDGTLAVVDYKTGKPPSGKMVAEGFALQLGL 882

Query: 940  EAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSA-------DELSEKSLK 992
                 + G    +     A  ++   + K +         K +A       +E  +++  
Sbjct: 883  IGLIARGGGMDGVAGEPTAFEYWSLGRNKERGFGYMKSPVKETARQTGIPREEFLDRTED 942

Query: 993  NLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWR 1034
             L E +     G +PF +  RL+      S+YD L R+ EW+
Sbjct: 943  YLHEAIARWLLGSEPFTA--RLNPDLPGYSDYDQLMRLDEWQ 982


>gi|260752462|ref|YP_003225355.1| double-strand break repair protein AddB [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258551825|gb|ACV74771.1| double-strand break repair protein AddB [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 993

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 251/948 (26%), Positives = 414/948 (43%), Gaps = 108/948 (11%)

Query: 4   KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
           +K  +FTI    PF R    AL+ G +    RYD  +P+ LA   I +P  R+I+ +   
Sbjct: 3   EKSRLFTI----PFHRSFADALVEGLIK---RYD--DPMTLAQGLILLPNNRSIRAITEA 53

Query: 64  FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN----LNPPVSNIQRLLELARLILIW 119
           F+        +LP +  +GD + +      L   +    L P +  ++R   L RL+   
Sbjct: 54  FVR-QSSSGLLLPRMVPVGDPLLDDRLGAFLDPVDMIDPLPPAIPPLERHFRLTRLV--- 109

Query: 120 RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHAL----KNE 175
                   K +  +   ++ +  A+   LA+ LA  +D +   E   E L  L      E
Sbjct: 110 --------KKVMQKQGRTIAVPEAHR--LAEELALTLDQLMAAEIAPEQLTQLIDPMAEE 159

Query: 176 KYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMR-----AEAEHLMKGTKGPI 230
           +    W  +   L+     W E   EL  +  +  Q    R     A+       ++ PI
Sbjct: 160 ELARHWQASLKLLECIITEWPE---ELKKTGQIESQERRNRLLDRLADRWQTQPPSEKPI 216

Query: 231 IIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT--EKSTNITSSNTTY 288
           I AG+    P +ARL+  ++    G +VLPGLD  +    W  +   E+  +      + 
Sbjct: 217 IAAGAITGSPVSARLLRVISEMEGGLVVLPGLDNSMSDEEWQLLGPHERDPDTGIKQPSL 276

Query: 289 STHPQYSLAKLLDFLDIKREDVKRLGNVSN-EMYGRSMVISKSFLPPDTSDMRNTDILEN 347
            +HPQ+ L  LLD + + R++V       N     R   I     P   +D   +     
Sbjct: 277 ESHPQFQLKLLLDRMGVDRKEVIEWDPPKNYHPDNREQAIRHVMAPARYTDRWRS----- 331

Query: 348 KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            +P  ++ F ++++IE  +  EEA  IA+ALR +++E  + +AL+T DR LA RV   L 
Sbjct: 332 -LPEKERAFPNLSVIETAHPEEEAQVIALALRAAVEEKGQTAALVTPDRALAIRVSALLK 390

Query: 408 RFGINIDISAGIPLSTTLHSSILTSLLNAI---FKLNDFMAIATLVKHPLAKFGFPEKYL 464
           RFGI+ D SAG PLS T    +L  L++     F    F+AIA   KHPL  FG      
Sbjct: 391 RFGIDADDSAGRPLSLTPPGLLLLDLVSLAADHFSAVSFLAIA---KHPLVAFGEDRDLW 447

Query: 465 SRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLV 524
                +L+++ LRG      +  + + + + +  QK +  +  W      E  ++    +
Sbjct: 448 RDHIRSLDMI-LRGPLLRNGLAGITAKIKEAVDNQKADPELLAWW-----EKTKIPFQAL 501

Query: 525 DHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTL 584
           D   Q + PL         T   ++                         +W E  G   
Sbjct: 502 DQQYQSVLPLTKIVKILRETANQIAGE----------------------KIWAEAAGHLA 539

Query: 585 SSLFSKIIETGSCIKANAIEWID---IITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
           + L ++I E+ +      + + D   ++ +L+D + V+P       +FI G +E+RL + 
Sbjct: 540 ADLIAEI-ESLAADHNEDMRFSDFAHVLRQLMDKQAVRPMTGGHPRIFIWGLIEARLQHA 598

Query: 642 DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
           D +I   LNE VWP     +P+L+  ++S+L L   E  IG AAHDF    G + ++ TR
Sbjct: 599 DLMIAASLNETVWPPIKEADPWLAPRIRSELGLPGLELRIGIAAHDFSSVLGAKKILLTR 658

Query: 702 SLRENNIPTIASR-WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPF 760
           + R+   PT+ SR WL+   +       DNL         W R+LD         RP P 
Sbjct: 659 ARRDARAPTMPSRFWLRLEAMAANLHHADNLPY-------WARQLDEPKGFRPVTRPAPN 711

Query: 761 PPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI 820
           PP+  +P+  + +    L +DPY+ YA  IL L  +     +P    RG+L H+I+   +
Sbjct: 712 PPVLDRPKRIAVTRFDSLQSDPYSYYASNILGLRKLDPVDAEPTAAWRGSLIHSILENWV 771

Query: 821 KK---RINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW-RHLFHKISHSFLEHEEKIQS 876
           K+   RI +  P     ++  I++H  ++ L       W   L   I   ++E E +  +
Sbjct: 772 KEDNSRIGRLKPRALAFLES-INAHIIQKTL-------WLPRLLQAI--DWIEGEVQKNA 821

Query: 877 SIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNP 924
           +  +  +++  +   +  GI L GF DRID +  G + I DYKTG  P
Sbjct: 822 AEGRTILDVEREGRSQINGIELFGFVDRIDRMGDGSLAIVDYKTGTPP 869


>gi|241761922|ref|ZP_04760007.1| double-strand break repair protein AddB [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373602|gb|EER63174.1| double-strand break repair protein AddB [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 993

 Score =  261 bits (667), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 251/948 (26%), Positives = 415/948 (43%), Gaps = 108/948 (11%)

Query: 4   KKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSE 63
           +K  +FTI    PF R    AL+ G +    RYD  +P+ LA   I +P  R+I+ +   
Sbjct: 3   EKSRLFTI----PFHRSFADALVEGLIK---RYD--DPMTLAQGLILLPNNRSIRAITEA 53

Query: 64  FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYN----LNPPVSNIQRLLELARLILIW 119
           F+        +LP +  +GD + +      L   +    L P +  ++R   L RL+   
Sbjct: 54  FVR-QSSSGLLLPRMVPVGDPLLDDRLGAFLDPVDMIDPLPPAIPPLERHFRLTRLV--- 109

Query: 120 RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHAL----KNE 175
                   K +  +   ++ +  A+   LA+ LA  +D +   E   E L  L      E
Sbjct: 110 --------KKVMQKQGRTIAVPEAHR--LAEELALTLDQLMAAEIDPEQLTQLIDPMAEE 159

Query: 176 KYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMR-----AEAEHLMKGTKGPI 230
           +    W  +   L+     W E   EL  +  +  Q    R     A+       ++ PI
Sbjct: 160 ELARHWQASLKLLECIITEWPE---ELKKTGQIESQERRNRLLDRLADRWQTQPPSEKPI 216

Query: 231 IIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT--EKSTNITSSNTTY 288
           I AG+    P +ARL+  ++   +G +VLPGLD ++    W  +   E+  +      + 
Sbjct: 217 IAAGAITGSPVSARLLRVISEMEDGLVVLPGLDNNMSDEEWQLLGPHERDPDTGIKQPSL 276

Query: 289 STHPQYSLAKLLDFLDIKREDVKRLGNVSN-EMYGRSMVISKSFLPPDTSDMRNTDILEN 347
            +HPQ+ L  LLD + + R++V       N     R   I     P   +D   +     
Sbjct: 277 ESHPQFQLKLLLDRMGVDRKEVIEWDPPKNYHPDNREQAIRHVMAPARYTDRWRS----- 331

Query: 348 KIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELT 407
            +P  ++ F ++++IE  +  EEA  IA+ALR +++E  + +AL+T DR LA RV   L 
Sbjct: 332 -LPEKERAFPNLSVIETAHPEEEAQVIALALREAVEEKGQTAALVTPDRALAIRVSALLK 390

Query: 408 RFGINIDISAGIPLSTTLHSSILTSLLNAI---FKLNDFMAIATLVKHPLAKFGFPEKYL 464
           RFGI+ D SAG PLS T    +L  L++     F    F+AIA   KHPL  FG      
Sbjct: 391 RFGIDADDSAGRPLSLTPPGLLLLDLVSLAADHFSAVSFLAIA---KHPLVAFGEDRDLW 447

Query: 465 SRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLV 524
                +L+++ LRG      +  + + + + +  Q  +  +  W      E  ++    +
Sbjct: 448 RDHIRSLDMI-LRGPLLRNGLAGITAKIKEAVDHQTADPELLEWW-----EKTKIPFQAL 501

Query: 525 DHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTL 584
           D   Q + PL         T   ++                         +W E  G   
Sbjct: 502 DQQFQTVLPLTKIVKILRETANQIAGE----------------------KIWAEAAGHLA 539

Query: 585 SSLFSKIIETGSCIKANAIEWID---IITRLIDGETVKPKIEKSSTLFILGTLESRLLNF 641
           + L ++I E+ +      + + D   ++ +L+D + V+P       +FI G +E+RL + 
Sbjct: 540 ADLIAEI-ESLAADHNEDMRFSDFAHVLRQLMDKQAVRPMTGGHPRIFIWGLIEARLQHA 598

Query: 642 DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTR 701
           D +I   LNE VWP     +P+L+  ++S+L L   E  IG AAHDF    G + ++ TR
Sbjct: 599 DLMIAASLNETVWPPIKEADPWLAPRIRSELGLPGLELRIGIAAHDFSSVLGAKKILLTR 658

Query: 702 SLRENNIPTIASR-WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPF 760
           + R+   PT+ SR WL+   +       DNL         W R+LD         RP P 
Sbjct: 659 ARRDARAPTMPSRFWLRLEAMASNLHHADNLPY-------WARQLDEPQGFRPVTRPAPN 711

Query: 761 PPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI 820
           PP+  +P+  + +    L +DPY+ YA  IL L  +     +P    RG+L H+I+   +
Sbjct: 712 PPVLDRPKRIAVTRFDSLQSDPYSYYASNILGLRKLDPVDAEPTAAWRGSLIHSILENWV 771

Query: 821 KK---RINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW-RHLFHKISHSFLEHEEKIQS 876
           K+   RI K  P     ++  I++H  ++ L       W   L   I   ++E E +  +
Sbjct: 772 KEDNSRIGKLKPRALAFLES-INAHIIQKTL-------WLPRLLQAI--DWIEGEVQKNA 821

Query: 877 SIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNP 924
           +  +  +++  +   +  GI L GF DRID +  G + I DYKTG  P
Sbjct: 822 AEGRTILDVEREGRSQINGIELFGFVDRIDRMGDGSLAIVDYKTGTPP 869


>gi|118593730|ref|ZP_01551099.1| hypothetical protein SIAM614_03453 [Stappia aggregata IAM 12614]
 gi|118433640|gb|EAV40303.1| hypothetical protein SIAM614_03453 [Stappia aggregata IAM 12614]
          Length = 429

 Score =  258 bits (658), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 139/410 (33%), Positives = 221/410 (53%), Gaps = 7/410 (1%)

Query: 630  ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
            ILG +E+RL  FD  ILGGLNEG+WP+ T  +P+L+R M+ D+ L+  E+ +G AAHDF 
Sbjct: 13   ILGPMEARLQTFDFAILGGLNEGIWPQRTRNDPWLNRPMKRDMGLEPPERRLGAAAHDFA 72

Query: 690  MANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTT 749
               G R ++ +R+ R +  PT+ASRWLQRL  L G D    L+ +G  Y     +LD   
Sbjct: 73   QGMGARRVLLSRAARSDGAPTVASRWLQRLTTLAGPDLTKQLEAQGAIYSALAAQLDRPE 132

Query: 750  KQPH-YKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR 808
                   RP+P P L A+P++ S +EI++LI DPYA++AR +L+L  +     +P   D+
Sbjct: 133  GAVRPASRPQPRPLLAARPKSLSITEIERLIRDPYAIFARHVLELQPVDPIGGEPGAADK 192

Query: 809  GTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFL 868
            G L H+ + + +         +    + +I +  FE  +  P I  +W   F KI+  F+
Sbjct: 193  GNLIHDALADFLLTWTGPFDDKAVKALTEIGEELFEPLDAFPAIRALWWPRFQKIAAGFV 252

Query: 869  EHEEKIQSSIEKIFVNIPA--KMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKK 926
             +E +    + + F+ I    +M +      L G ADRIDLL  G + + DYKTG  P +
Sbjct: 253  AYEARRSQHVSQRFLEIGGGVEMKLPGFDFRLRGRADRIDLLSGGGLSVVDYKTGQVPSQ 312

Query: 927  ETAQKLIDPQLSLEAAALKAGSFSQIDC-RKVANLFYIRLKQKFK--IDCITNDKKKYSA 983
            +    L+ PQL LEAA ++   F  +     ++ L Y++LK   +  I+   N  K+   
Sbjct: 313  KQVDALLSPQLPLEAAMIRRFGFKDVPADAPISELLYLQLKGGSEPVIEAPRN-PKETPL 371

Query: 984  DELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            ++L E + K L +++      +  ++S  R+  +  +  +YDHLAR  EW
Sbjct: 372  EDLVEDAWKRLEQLIAHYVREDTGYLSRARVMRERQMGGDYDHLARTQEW 421


>gi|23009340|ref|ZP_00050425.1| COG3893: Inactivated superfamily I helicase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 643

 Score =  257 bits (657), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 188/616 (30%), Positives = 290/616 (47%), Gaps = 30/616 (4%)

Query: 353 QKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGIN 412
           ++  + +A++EA +EREEA+  A+ALR +L+  +  +AL+T DR LA RV  EL R+GI 
Sbjct: 16  REGMAGLAVVEAADEREEALIAALALRETLETPRATAALVTPDRGLALRVSAELARWGIA 75

Query: 413 IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
            + SAG+ L+ +        +     ++     IA L+ HP  + G     + RA  ALE
Sbjct: 76  AEDSAGLSLARSQAGRFARLVAELAAEVAPARVIA-LLAHPFVRLGLTRSEVVRAAAALE 134

Query: 473 LVALRGN----KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
           +  LRG     KNS+  M L ++ L R +T++    VP  + RL   D +LA  ++  + 
Sbjct: 135 IGGLRGPAPIPKNSFGGM-LAAVGLQRASTER----VPRAKKRLKPIDWDLAETILRRLK 189

Query: 529 QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG-KTLSSL 587
             + P   ++       GNL       + +  L     +     P    ++    +L  L
Sbjct: 190 DALGP---FQAEDLPVTGNL-------VALAALHREACERMMDGPEDEIDDPSLDSLDGL 239

Query: 588 FSKIIETG-SCIKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTLESRLLNFDTLI 645
           F  +       +     ++    T L    TV   +      L ILG LE+RLL+ D ++
Sbjct: 240 FDDLEAAAREELPGRFSDYAAFFTALARDRTVACAQRNAHPRLRILGPLEARLLSVDRIV 299

Query: 646 LGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRE 705
           LGGL+E VWP     + FL+R M+  + L   E+ IGQAAHDF  A GT   + TR+ + 
Sbjct: 300 LGGLDEAVWPVRQTTDAFLNRPMRGQVGLSPPERRIGQAAHDFVQALGTHDAVVTRAAKR 359

Query: 706 NNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ--PHYKRPKPFPPL 763
              PT+ SR+LQRL   GG   +     RGQ        LD   +   P  KRP P P  
Sbjct: 360 EGSPTVPSRFLQRLRAFGGDAVWSEAVGRGQRLRRLAAALDRGREAPPPRLKRPAPKPDP 419

Query: 764 EAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKR 823
              P   S +EI+ L+ DPY+++A+ IL L+ +      P   +RG+L H I+ +  +  
Sbjct: 420 ALFPERLSVTEIETLVRDPYSIFAKHILGLEALEPLAVVPGAAERGSLIHKILGDFSQAH 479

Query: 824 INKNTPEINHLMKQI-IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
                     L+  I +D+    ++  P +   W   + +++ +FLE E   + SI  I 
Sbjct: 480 PGALPAAAETLLYAIALDAFGPLQDQYPELYAEWFPRYERMAVAFLEWEASQRRSIRAIH 539

Query: 883 VNIPAKMAIESIG---IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
                K+ I  +G     L+  ADRI+    G   I D+KTG  P   T      PQL+L
Sbjct: 540 AERSGKLTI-PLGERTFTLSARADRIEQRADGGFCIVDFKTGTPPSNRTVFAGFSPQLTL 598

Query: 940 EAAALKAGSFSQIDCR 955
           EAA L  G+F  +  R
Sbjct: 599 EAAMLMRGAFEGLKAR 614


>gi|149184292|ref|ZP_01862610.1| helicase [Erythrobacter sp. SD-21]
 gi|148831612|gb|EDL50045.1| helicase [Erythrobacter sp. SD-21]
          Length = 1009

 Score =  256 bits (654), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 285/1085 (26%), Positives = 475/1085 (43%), Gaps = 139/1085 (12%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            PNV++IA      R    AL+ G LV  +  D L    LA +T+ +P+ RA + +   FI
Sbjct: 8    PNVYSIA----AHRGFADALVAG-LVPRYADDELG---LARLTLLLPSARARRTVSEAFI 59

Query: 66   E---ITGKKSTILPIIKSLGDV-VEEKFTA--DLLLSYNLNPPVSNIQRLLELARLILIW 119
                 +G+   ++P +  +GD+ ++E      D L + ++ P +   +R+  LARLI   
Sbjct: 60   RHAGESGRAGLLMPRMAVVGDLDLDEALGPLLDPLGASDIPPAIDPQRRMFALARLI--- 116

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
                    +++  E+P       A  + LA+     +D +  E+   E L    +EK   
Sbjct: 117  -------AEEMGEEAPKG-----ATLLRLARETGATMDRLLVEDVGPEKL---VDEKV-- 159

Query: 180  WWLLAADFLKIASKYWTER-----------LVELNASSPVGYQIALMRA-----EAEHLM 223
                  D     SK+W E            L  LNA    G   A  R      +A H  
Sbjct: 160  -----VDIFPDLSKHWQESIRLFANVQAKWLAWLNAQ---GMLDAAARRNRLFDKARHAW 211

Query: 224  KGT--KGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNI 281
            K      PI+ AG T + PA A+L+  V+  P GA++LP  D  +   +W+ +       
Sbjct: 212  KAQPPATPIVAAGVTSAAPALAKLLRVVSELPQGAVLLPDFDLTMDEGVWDELGRAGAAP 271

Query: 282  TSSNTTYS-----THPQYSLAKLLDFLDIKREDVK---RLGNVSNEMYGRSMVISKSFLP 333
            T  +T ++     THPQY L  LL+ + + RE+V+   R G  +     RS  IS  FLP
Sbjct: 272  TPGDTVFAREDAVTHPQYHLKLLLNRMGVAREEVQPWHRKGMTAAPPE-RSHAISALFLP 330

Query: 334  PDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALIT 393
            P+ S +         +P+ ++  S V ++EA N  EEA +IA+ +R +L++  ++ A++T
Sbjct: 331  PEASKVWV------DLPSEKRRLSGVRIMEAANPEEEAQAIALMVREALEQPDRRVAVVT 384

Query: 394  ADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHP 453
             DR LARRV   L R+ I  D SAG PLS T            + +    + +  L+ HP
Sbjct: 385  PDRPLARRVVHHLARWNIVADDSAGRPLSHTAAGRAFLLAAEVMAEGARAVPLMALLGHP 444

Query: 454  LAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLS 513
            L   G  E+     +      ALRG + +  +   ++ V                 +RL+
Sbjct: 445  LVDGGM-ERGAWLRRLRRLERALRGPRLASGLEPAQAEV-----------------ARLA 486

Query: 514  EEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLP 573
            E+  E+A        Q + PLV    +        S++D         + +C +      
Sbjct: 487  EKRPEIAEWWALAEAQ-LAPLVERDRDTPE-----SLADLIDTLAASAEALCGE------ 534

Query: 574  NLWFEEEGKTLSSLFS--KIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFIL 631
             LW +E+G+TL++     ++    +  +    +   +++  ++   V+P     + + +L
Sbjct: 535  KLWAQEDGRTLAAFVEEFRLHAREAGFETAPRDVAKVLSDAMEERAVRPPYGGHARVQVL 594

Query: 632  GTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMA 691
            G LE+RL   D +I  GLNEG WP   + +  L+  +   L +   +  IG +AHD   A
Sbjct: 595  GLLEARLNRADLVICAGLNEGSWPARGSIDALLAPPVLRALGVPGGDFRIGLSAHDLAGA 654

Query: 692  NGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ 751
             G   ++ +RS R+   P I SR+L R+  L G +     ++R    L   R +      
Sbjct: 655  MGAPEVVLSRSGRDEGGPAIPSRFLLRVQALLG-ELLPRHEERAAIEL--ARAMTRAEPA 711

Query: 752  PHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTL 811
            P Y RP P P  + +    S + + +L+ DPY  +A++I+ L  +     DP+   +G +
Sbjct: 712  PEYSRPMPKPSPQQRDVDISATALDRLLGDPYQFFAQKIMGLSDLDALDADPNPLWQGNI 771

Query: 812  FHNIITEL-IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEH 870
             H I+    I +R + +   I  +M++++    E+EN  P +  +W+    K     LE 
Sbjct: 772  AHTILERWHIARRTDPDV-RIAPIMEEVL----EEENADPLVRGLWQPRLLK----GLEW 822

Query: 871  -EEKIQSSIEKIFVNIPAK--MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKE 927
             EE + S  E+  + + AK  M +E + +H  G ADRID L+ G + I DYKTG  P   
Sbjct: 823  IEETLGSYTEREVLAVEAKGSMHVEDVFVH--GRADRIDRLEDGTLAIIDYKTGKPPTAA 880

Query: 928  TAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQK-------FKIDCITNDKKK 980
              ++    QL +     + G F  +        ++   + K         ++       K
Sbjct: 881  QVEQGYALQLGILGLIAQDGGFEGLTGDPGGYEYWSLGRAKDDNPHGFGYVEVPLKVGNK 940

Query: 981  YSADELSE---KSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW--RE 1035
             S  EL E    + K L E +     G  PF +  R +        YD L R+ EW  R+
Sbjct: 941  RSGVELEEFLPLTRKKLGEAIGKYIKGTDPFTA--RENPDYPAYDTYDQLMRLEEWLPRQ 998

Query: 1036 EYDIS 1040
              D+S
Sbjct: 999  ADDLS 1003


>gi|296283898|ref|ZP_06861896.1| helicase [Citromicrobium bathyomarinum JL354]
          Length = 977

 Score =  251 bits (641), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 216/835 (25%), Positives = 352/835 (42%), Gaps = 94/835 (11%)

Query: 229  PIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTY 288
            PI+ AG T + PA ARL+  V+  P GA++LP LD  +    W+ +     +  +     
Sbjct: 196  PIVAAGVTSAAPALARLLRVVSELPQGAVILPDLDLALSDEAWDELGRAGQSDDADGERL 255

Query: 289  S-----THPQYSLAKLLDFLDIKREDVKRLG--NVSNEMYGRSMVISKSFLPPDTSDMRN 341
                  THPQY L  LL  + + R +V++     ++     R+  +S  FLPP  S    
Sbjct: 256  GRHDAPTHPQYHLKLLLGRMGVNRGEVRQWHRRGLTAANPDRTHAVSALFLPPQASKS-- 313

Query: 342  TDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARR 401
                  ++P+ ++  + V L+E  N  EEA ++A+A+R  L+E +K+ A++T DR+LARR
Sbjct: 314  ----WVELPSEKRRLAAVQLLETGNPEEEAQAVALAVRRKLEEPQKRVAVVTPDRSLARR 369

Query: 402  VKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPE 461
            +   L R+ I  D SAG PL  T     L  L   I +    + +   + HP       E
Sbjct: 370  IVHHLRRWDIQADDSAGAPLCDTAAGRALLLLAQVIAERAAPVPLIAFLGHPFVGVAGAE 429

Query: 462  KYLSRAKNALELVA-----LRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEED 516
                   + L+ +      LRG + +  +  L+++             V  W   +++  
Sbjct: 430  DSGGARADWLDALRRFEDRLRGPRPAPGLAPLRAIA--------AKADVDAWWGTVADR- 480

Query: 517  KELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLW 576
                          + PL+    +         +++        L+  C +       +W
Sbjct: 481  --------------LAPLMERDEDA-------PLAELLGTLAQVLEEFCGE------AVW 513

Query: 577  FEEEGKTLSSLFSKIIETGSCIKA--NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTL 634
              E+G+ L S    + +  S      +  E  D++T  ++   V+P       + + G L
Sbjct: 514  GREDGRALGSFVDDLRQQASAAGTMIDPREVHDVLTDAMERVAVRPAYGGHPRVAVYGLL 573

Query: 635  ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT 694
            ESR+   D +I  GLNEG WP   + +P L+  +   L +   E  IG AAHD   A G 
Sbjct: 574  ESRMARADLIICAGLNEGTWPGGASPDPLLAPPVLRALGVPGGEFRIGLAAHDLAGALGA 633

Query: 695  RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQ-----CYLDWTRKLDYTT 749
              ++ TR+  + N P I SR+  R+  L G     +L KR +       +D  R  D   
Sbjct: 634  PQVLLTRAALDANGPAIPSRFFLRIKALLG-----DLAKRHEESELPALVDALRDAD--- 685

Query: 750  KQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRG 809
              P Y  P+P PP E +  T S + + +L +DPY  YA  IL+L        +P    +G
Sbjct: 686  PAPLYPVPQPCPPAEVRRVTISATALDRLRSDPYQFYANAILRLKERDPLDSEPSPAWQG 745

Query: 810  TLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLE 869
            TL H I+ E  K+          HL    +D+H       P    +W     ++  +   
Sbjct: 746  TLAHAILEEWHKQGGALVDLATKHL--GAMDAH-------PLTRALWE---PRLMAALEW 793

Query: 870  HEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETA 929
             E ++ S  ++  V +  K      G+ +TG ADRID L  G   I DYKTG  P K   
Sbjct: 794  IENEVSSDPDRRIVAVEQKGRHLFSGVEITGTADRIDRLADGSYAIVDYKTGGPPSKRMV 853

Query: 930  QKLIDPQLSLEAAALKAGSFSQIDCRKVANLF-YIRLKQKFKIDC----------ITNDK 978
            ++    QL      ++ G+++      V   F Y  L +  K D           I N +
Sbjct: 854  EEGFALQLGTLGLLVEEGAYADRGIEGVPTRFEYWSLGRDAKSDTGFGYVTTPLKIGNAR 913

Query: 979  KKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
                 D+   ++ + L E +     G+ PF +  R +    + + YD L R+ EW
Sbjct: 914  TGMEPDDFLPETRRYLAEALDTWILGDAPFTA--RPNPDLKLYATYDQLMRLEEW 966


>gi|218506213|ref|ZP_03504091.1| hypothetical protein RetlB5_00732 [Rhizobium etli Brasil 5]
          Length = 221

 Score =  251 bits (641), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 118/218 (54%), Positives = 148/218 (67%)

Query: 612 LIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSD 671
           L  G  VKP+      LFI GTLE+RL + DTLILGGLNEG WP  +A NPF+ R+M+++
Sbjct: 4   LAAGHAVKPRALSHPRLFIFGTLEARLQSVDTLILGGLNEGSWPGQSANNPFIPRMMKTE 63

Query: 672 LNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNL 731
           + L+  E+ IGQ AHDFEMANGTRHLIY+R+LR+ + PT+ASRWLQRLL LGG  F   L
Sbjct: 64  IGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTPTVASRWLQRLLALGGEAFEAEL 123

Query: 732 KKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRIL 791
           K RG  +L W   +D    Q   +RP P PPL  QP++YSFSE+ +L  DPY +YARRIL
Sbjct: 124 KGRGTRFLQWAGLIDRGETQAPAQRPSPKPPLALQPQSYSFSEVGRLRRDPYTIYARRIL 183

Query: 792 KLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
           +LD I  F +DP   +RGTL+H II   I+      TP
Sbjct: 184 RLDPIDAFNRDPGAAERGTLYHKIIDRFIRAAHVAGTP 221


>gi|326387826|ref|ZP_08209432.1| helicase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207872|gb|EGD58683.1| helicase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 998

 Score =  248 bits (632), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 275/1068 (25%), Positives = 452/1068 (42%), Gaps = 120/1068 (11%)

Query: 6    PNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFI 65
            P V++IA      R    AL+ G L+  +R D      LA +T+ +P++RA++ +   F+
Sbjct: 5    PQVYSIA----AHRGFADALVAG-LIPRYREDGFG---LARLTLLLPSRRAVRAVTEAFV 56

Query: 66   EITGKKSTILPIIKSLGDVVEEKFTADLL------LSYNLNPPVSNIQRLLELARLILIW 119
              +G  + +LP +  +GD+  ++    L+         ++ P V    RLL LA L+   
Sbjct: 57   RASGG-ALMLPRMAVVGDLDLDETLGPLVDPLPDDAGGDIPPAVDPTLRLLILADLL--- 112

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
                     ++  E+P  +P   A  + LA+ +A+ ID +  EE   E L  L     G+
Sbjct: 113  -------RIEVASETPDHVP-GEAALLRLARGVAETIDRLLVEEVTPERL--LDPAVIGL 162

Query: 180  WWLLAA---DFLKIASKY---WTERLVELNASSPVGYQIALMRAEAEHLMKGTKG-PIII 232
               LA    D  ++ +K    W   L E  A      +  L+RA A    +     P++ 
Sbjct: 163  VGDLAEHWKDSTRLFAKVLYRWRAELDERGACDAPERRNRLLRALARRWRETPPAHPVVA 222

Query: 233  AGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKST----NITSSNTTY 288
            AG T + PA A L+  VA+ P GAI+LP LD  +   +W+ +                  
Sbjct: 223  AGVTSAAPAVAHLLRCVADLPGGAIILPDLDLALDQEVWDALGHAGAPADDGAVFGRGDI 282

Query: 289  STHPQYSLAKLLDFLDIKREDVK---RLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDIL 345
             THPQY L  LL+ + I R++V+   R G  S     RS  IS  FLPP  S       +
Sbjct: 283  VTHPQYHLKLLLNRMGIARDEVQAWHRAGP-SAAPPARSRAISNLFLPPVAS------AI 335

Query: 346  ENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLE 405
              ++P+  +  + V ++ + +  EE+++IA  +R +L++ +++ AL+T DR LA RV   
Sbjct: 336  WARLPSEDRSLAGVRIMTSAHPGEESLAIAALVRRALEQPERRVALVTPDRGLAERVIGH 395

Query: 406  LTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEK-YL 464
            L R+ +  D SAG PL  T    +L +L     +    + +  L+ HPL + G     +L
Sbjct: 396  LQRWNVGADDSAGRPLPQTAAGRLLLALAECWAERAAPVPLIALLGHPLVRAGEGRALWL 455

Query: 465  SRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLV 524
             R +  L+L ALRG +     +D     L R A       +  W+S              
Sbjct: 456  DRVRR-LDL-ALRGPRPGPG-LDGVGEALQR-ARYLERDLIAWWES-------------- 497

Query: 525  DHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTL 584
                              +    L ++D     V   + +C +       +W E +G+ L
Sbjct: 498  ---------ATALLAPLLAHAEPLPLADALAHLVEAAERLCGE------AIWAEADGRAL 542

Query: 585  SSLFSKIIETG-----SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLL 639
            ++              + +  +  E   ++   ID   V+P     S L I G LE+R+ 
Sbjct: 543  AAFVEDWSGAAGDARLAGVLVDPAELPALLRDAIDQVAVRPPYGGHSRLAIYGLLEARMN 602

Query: 640  NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIY 699
              D +I  GLNEG WP   + +P L+  +   L +   +  IG AAHDF  A G+  ++ 
Sbjct: 603  RADLVICAGLNEGTWPTAPSADPVLAPAVLRALGIPGPDFRIGLAAHDFAAALGSPEVVL 662

Query: 700  TRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKP 759
            + +LR+   P + SR+L R+  + G        +     ++W   LD     PH  RP+P
Sbjct: 663  SHALRDAAGPAVPSRFLLRIRAMLGQSI-----QTETAAIEWASALDQADPVPHSPRPRP 717

Query: 760  FPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITEL 819
             P  E +    + + + +L  DPY  YA  IL+L  +     DP    RGT  H I+   
Sbjct: 718  MPSAEQRRVDIAATALDRLRGDPYQFYASAILRLSSLDPLDADPTPAWRGTAVHAILEAW 777

Query: 820  IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWR-HLFHKISHSFLEHEEKIQSSI 878
             K        ++  L ++ +D+        P +  +W   L   +   ++E E+   +  
Sbjct: 778  HKAGAPPG--QLIVLAREALDAMSAH----PLMRALWTPRLIEAL--EWIEEEQARLAGE 829

Query: 879  EKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLS 938
             +          I   G+ + G ADRID L  G + I DYKTG  P      +    QL 
Sbjct: 830  GRTVAAFEQWGDITVRGVKIKGRADRIDRLPDGTLAIVDYKTGSPPSPTMVAEGFALQLG 889

Query: 939  LEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCI------TNDKKKYSA---DE---L 986
            L     +   F+ +   K     Y  L ++             +D K  S    DE   L
Sbjct: 890  LIGLIAERDGFANLHG-KARRFEYWSLSRRRDGSGFGWCREPVHDGKGRSGVLRDEFLPL 948

Query: 987  SEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWR 1034
            ++  L + ++   L   G +PF +  RL+      S+YD L R+ EW+
Sbjct: 949  TDDYLHDALDRWIL---GSEPFTA--RLNPNLPGYSDYDQLMRLDEWQ 991


>gi|218670460|ref|ZP_03520131.1| hypothetical protein RetlG_01777 [Rhizobium etli GR56]
          Length = 197

 Score =  241 bits (614), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 109/194 (56%), Positives = 140/194 (72%)

Query: 628 LFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHD 687
           +FI GTLE+RL + DTLILGGLNEG WP  +A NPF+ R+M++++ L+  E+ IGQ AHD
Sbjct: 1   MFIFGTLEARLQSVDTLILGGLNEGSWPGQSANNPFIPRMMKTEIGLEPPERRIGQLAHD 60

Query: 688 FEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDY 747
           FEMANGT HLIY+R+LR+ + PT+ASRWLQRLL LGG  F   LK RG  +L W   +D 
Sbjct: 61  FEMANGTCHLIYSRALRQGSTPTVASRWLQRLLALGGEAFEAELKGRGTRFLQWAGLIDR 120

Query: 748 TTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTD 807
              Q   +RP P PPL  QP++YSFSE+ +L  DPYA+YARRIL+LD +  F +DP   +
Sbjct: 121 GESQAPAQRPSPKPPLALQPKSYSFSEVGRLRRDPYAIYARRILRLDPVDAFNRDPGAAE 180

Query: 808 RGTLFHNIITELIK 821
           RGTL+H II   I+
Sbjct: 181 RGTLYHTIIDRFIR 194


>gi|312113013|ref|YP_004010609.1| double-strand break repair protein [Rhodomicrobium vannielii ATCC
            17100]
 gi|311218142|gb|ADP69510.1| double-strand break repair protein [Rhodomicrobium vannielii ATCC
            17100]
          Length = 1091

 Score =  240 bits (612), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 273/1106 (24%), Positives = 446/1106 (40%), Gaps = 122/1106 (11%)

Query: 8    VFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEI 67
            VF   P  PF   +  A+L+G L      +P +   + ++ +YVP++ A+  L+   +++
Sbjct: 20   VFACPPHRPFLPALAAAILDGALFGGGEPEPHD---IPALNVYVPSQAAVTPLKLALLDL 76

Query: 68   TGKKSTILPIIKSLGDVVE-EKFTA--------DLLL----SYNLNPPVSNIQRLLELAR 114
            +   +T LP I+ LGD    + F A        D L     + ++  PV +I+R + L+ 
Sbjct: 77   SPCGATFLPRIRVLGDADPLDMFAAYAPHMDAGDALALLRDAVDVPKPVGDIERRVHLSA 136

Query: 115  LILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDL----- 169
              +    K    I     E    L  S   A   AK  ADI  +I+   ++  DL     
Sbjct: 137  AAM----KAARDIHSTRMEFGEQL-FSGVTATSAAKIAADIASLIDDAHRERADLAKIDR 191

Query: 170  ----HALKNEKYGMWWLLAADFLKIASKYW---TERLVELNASSPVGYQIALMRAEAEHL 222
                HA   E+  +        L+   K W    +R   L+        +AL  A     
Sbjct: 192  LDRGHASGGEQISL------QILRAVRKAWDAHKKRSRRLDREERRNRLMALEAA----F 241

Query: 223  MKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNIT 282
            ++ +  P+I+AGSTGS+ AT  LM  +      AIVL GLD  +  A W  I E      
Sbjct: 242  IRASDAPVIVAGSTGSVAATMGLMEALGGRARSAIVLHGLDRALDDASWQAIAE------ 295

Query: 283  SSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYG----RSMVISKSFLPPDTSD 338
                 +  HPQ+ L +LL  L + R +V  L  V     G    R+  +S++  P  T+ 
Sbjct: 296  -----HPEHPQHGLWQLLARLVVCRNEVSELETVRALPAGGDPIRAAFLSEAMRPASTTA 350

Query: 339  -------MRNTDILENKIPNIQKCFSDVAL--------------IEADNEREEAISIAIA 377
                    R  +   +     +  ++DV+L              +EAD  +EEA+ +A+ 
Sbjct: 351  RWADYVAARKAEGSRDAGATARDVWADVSLCDAPRGTLAPGLTLVEADTSQEEAVVVALI 410

Query: 378  LRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAI 437
            LR +L++     AL+T D  L  RV+  L  +G+  ++ A        H+  L     A 
Sbjct: 411  LRAALEDEAAHVALVTPDDALTARVRHALAAWGMASELPA-----APRHAFALRVAATAT 465

Query: 438  -FKLNDFMAIATL-VKHPLAKF----------GFPEKYLSRAKNALELVALRGNKNSY-- 483
              K  DF A+  L +  P + +            P     R     ELV L   +  +  
Sbjct: 466  SGKPEDFTALLRLGLLEPRSAYLRQRESDLTEADPGADRDRFLRLAELVDLGAARQMWRP 525

Query: 484  DIMDLKSLVLDRIATQKNNTHVPH-WQSRLSEEDKELAVLLVDHILQCITPLV-TYKTNK 541
              MD     L R      +    H    R+  E  + A LL   +L  ++PL        
Sbjct: 526  ASMDGIPAALARAQHAIASGEARHPAMRRIDAEAWDAARLLAGDVLDALSPLTENAADPA 585

Query: 542  NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFE-EEGKTLSSLFSKIIETGSCIKA 600
            +     L    W       L         +L  +    + G    SL          +  
Sbjct: 586  SDAAPTLPFRRWVAAHDEALA--------RLAAIGLACDAGDDAPSLGDAFGVDAPSLAL 637

Query: 601  NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAK 660
            +  ++      L  GE           L +L  L++RLL+ D ++LGGLNEG WP+    
Sbjct: 638  DINDYAAFFAELARGEPTPAAGSPHPRLSLLSPLDARLLSADVIVLGGLNEGAWPQTPGP 697

Query: 661  NPFLSRVMQSDLNLKTAEKYIGQAAHDF-EMANGTRHLIYTRSLRENNIPTIASRWLQRL 719
            +P+L+R  ++ + L   E+ IGQAAHDF  +A     ++ TR+ + N      SRW+ R+
Sbjct: 698  SPWLNRQDRAAIGLSPEERRIGQAAHDFASLAAAAPRVVLTRAKKANGSLARPSRWIARI 757

Query: 720  LVLG-GTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQL 778
              L  GT     ++  G  +L+  R             P+P PPL A+PR  S + I+  
Sbjct: 758  TTLARGTGRLAEIET-GADWLEMARARRMPATVTPIAPPEPRPPLSARPRRLSVTAIETW 816

Query: 779  INDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQI 838
              +PYA+YA  IL L  +    +  D  D+GTL+H  +    +   ++   +    +   
Sbjct: 817  FANPYAIYASFILDLKPLRRIGESHDARDKGTLYHAALNRFFEAYPDRVPDDAAARLVAC 876

Query: 839  IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--- 895
            +D   E+          WR  F + +  F   E + +  +  +   +  K+ + + G   
Sbjct: 877  LDRSAEEFGFDLDAAPFWRPRFARFAEWFAATEAQRRDGLRLLKSEVGGKLKLVAEGAAG 936

Query: 896  -IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDC 954
               +T  ADRIDL   G + I D+KT  N    +A++   PQL+LE      G+F+ +  
Sbjct: 937  PFEVTARADRIDLGADGSLRIFDFKTSANAATTSARRGA-PQLALEGMLAMEGAFAGLPA 995

Query: 955  RKVANLFY-IRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLR 1013
                +L Y I    +   D +T    K  ++E    +   L+  +    +   P+    R
Sbjct: 996  GGAPDLCYIIASGGEPPGDIVT---LKVPSEEAIAAAKAGLLLRIARFDDEATPYAYEAR 1052

Query: 1014 LSEKSNIQSE-YDHLARVAEWREEYD 1038
               +    ++ Y HLARV EW    D
Sbjct: 1053 AIFRDKADNDPYAHLARVKEWSAAAD 1078


>gi|239833144|ref|ZP_04681473.1| double-strand break repair protein AddB [Ochrobactrum intermedium
           LMG 3301]
 gi|239825411|gb|EEQ96979.1| double-strand break repair protein AddB [Ochrobactrum intermedium
           LMG 3301]
          Length = 406

 Score =  237 bits (604), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 149/388 (38%), Positives = 216/388 (55%), Gaps = 29/388 (7%)

Query: 2   HNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELR 61
            + K  +F+I P +PF      ALL G LVE F  +P +PL LA+ TIYVPT+RA + LR
Sbjct: 10  RDGKQRLFSIPPGTPFLPAFARALLEGRLVEGFPGNPSDPLALANATIYVPTRRAARALR 69

Query: 62  SEFIEI-------------------TGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLN 100
           S  ++I                   + KKS ILP IK LGDV E+   F A     +++N
Sbjct: 70  SILVDINPAKGLSAKAVSGFAFGNASEKKSAILPTIKPLGDVDEDAAFFNAGSSGVFDIN 129

Query: 101 PPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIE 160
           PP+   +RLL LARLI  WR  LP  ++ L+    +S+P + ++AIWLA++LA ++D +E
Sbjct: 130 PPIGTAERLLLLARLIRPWRESLPSHVRALFGVDDVSVPATTSDAIWLARDLAGLMDQVE 189

Query: 161 TEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAE 220
           T+  KW +L  +  E    WW +   FL I +  W + L E   S+P  ++  L+ +E +
Sbjct: 190 TDGAKWSELATIAPEDLADWWQVTLGFLNIVTNLWPDILAERKLSNPAAHRNDLIWSEVK 249

Query: 221 HL-MKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKST 279
            L      GP+I+AGSTGSIPATA L+S +A  PNGA+VLPGLD  +  A W  +   + 
Sbjct: 250 RLRTHPPAGPVIVAGSTGSIPATAELISAIAELPNGAVVLPGLDRDLDDAAWQLLASATD 309

Query: 280 NITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDM 339
           N     +TY  HPQ+ L KLLD +   REDV+ L ++      R  V+S++  P +T+D 
Sbjct: 310 N----PSTYG-HPQFGLRKLLDAMQTLREDVEHLDDMPASKRLRERVVSEALRPAETTDA 364

Query: 340 RNTDILENKIPNIQKCFSDVALIEADNE 367
                L+ +  ++      + LIEA NE
Sbjct: 365 WGK--LDMEADSLHAAAQTIDLIEAANE 390


>gi|89067400|ref|ZP_01154913.1| putative Helicase/Exonuclease [Oceanicola granulosus HTCC2516]
 gi|89046969|gb|EAR53023.1| putative Helicase/Exonuclease [Oceanicola granulosus HTCC2516]
          Length = 977

 Score =  220 bits (560), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 199/722 (27%), Positives = 315/722 (43%), Gaps = 84/722 (11%)

Query: 5   KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
           +P VF + P   F  E++  L         R   L P  LA V ++V T+R  + LR  +
Sbjct: 7   RPRVFALPPGVDFGAELVRGLRQ-------RSADLAPDALARVELFVNTRRMQRRLREVY 59

Query: 65  IEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLP 124
               G   T+LP ++ + D+        L     L PPV  ++R  E+ RL+       P
Sbjct: 60  ---DGGPPTLLPRLRLVTDLA-------LDPKAGLPPPVPPLERRFEILRLVGALLESDP 109

Query: 125 DIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLL 183
            +              +P  A++ L+ +LA ++D ++ E    E LHAL+       W  
Sbjct: 110 SL--------------APRAALFDLSDSLAGLLDEMQGEGVDPEALHALEGTDQSEHWQR 155

Query: 184 AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK--GTKGP---IIIAGSTGS 238
              F+++  +Y        +A+     + A  R  AE L +  G + P   +I+AGSTGS
Sbjct: 156 TLAFVRVVERY-------FDAAGGTPDREARQRRVAEGLAERWGAQPPAHPLIVAGSTGS 208

Query: 239 IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
             AT   M  VA  P GA+VLPG D  +P A+W  + +          T   HPQ+   +
Sbjct: 209 RGATGLFMEAVARLPQGALVLPGFDFDMPAAVWRGMGD--------GLTAEDHPQFRFKR 260

Query: 299 LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
           LLD L+I   DV+   +       R+ ++S S  P   +D   T+     + +++   + 
Sbjct: 261 LLDRLEILPRDVEPWTDTGPASPARNRLVSLSLRPAPVTDAWLTE--GPALGDMRAATAG 318

Query: 359 VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
           + L+EA   R EA +IA+A+R ++ E+ +  ALIT DR L R+V   L R+ I  D SAG
Sbjct: 319 LTLVEAPTPRAEAETIALAMRQAV-EDGRTVALITPDRMLTRQVSAALDRWDITPDDSAG 377

Query: 419 IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
            PL  +     L  +   I +      + +L+KHPL   G        A   LEL   R 
Sbjct: 378 QPLPQSPPGRFLRHVAALISERVTGETLLSLLKHPLCHSGGDRGPHLLATRELELHLRRH 437

Query: 479 NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
                    L+          +N    P W   L+             +L+ I P    +
Sbjct: 438 GPPFPTAESLRGWG----GGHRNPERTP-WAEWLA------------GVLETI-PQPAER 479

Query: 539 TNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG-KTLSSLFSKIIETGSC 597
              +    +++I+          + +          LW E  G K L    +     G+ 
Sbjct: 480 PLADHLGAHMAIA----------EALAAGPDGGAGELWDEAAGRKALEIRAALEASAGAA 529

Query: 598 IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
                  ++D+ T +++G  V+        + I GTLESR+   D +ILGGLNEG WP+ 
Sbjct: 530 GVLTTRNYVDLFTGVLNGAEVRNPTAGHPLVQIRGTLESRVQGADIVILGGLNEGTWPEV 589

Query: 658 TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
            A +P+L+R M+  + L   E+ IG +AHD++ A     +  TR+ R +   T+ SRWL 
Sbjct: 590 PAPDPWLNRTMRHRVGLLLPERRIGLSAHDYQQAIAGPEVWLTRARRSDEAGTVPSRWLN 649

Query: 718 RL 719
           RL
Sbjct: 650 RL 651


>gi|296448463|ref|ZP_06890345.1| double-strand break repair protein AddB [Methylosinus trichosporium
           OB3b]
 gi|296254015|gb|EFH01160.1| double-strand break repair protein AddB [Methylosinus trichosporium
           OB3b]
          Length = 500

 Score =  214 bits (545), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 251/490 (51%), Gaps = 29/490 (5%)

Query: 7   NVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIE 66
           NVF+I P + F      ALL+G ++         PL LA  TIYVPT+RA + L ++   
Sbjct: 5   NVFSIPPGASFLGAFTRALLDGEIIPGLSRAS-GPLALAETTIYVPTRRAARALAAQLAA 63

Query: 67  ITGKKSTILPIIKSLGDVVEEK----FTADLLLSYN-LNPPVSNIQRLLELARLILIWRN 121
                + +LP I  LGD+ E++    F A+ + S + L P V+ I R L LA L+L W  
Sbjct: 64  AIETPAALLPRILPLGDLDEQEASALFHAEEIGSDDALAPAVAEIDRRLTLAALVLHWAK 123

Query: 122 KLPDIIKDLYP---------ESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHAL 172
            L   I  + P         E  L  P SPA+A  LA+ LA ++D    E+   + L +L
Sbjct: 124 SLRHAIVAIDPLGRIEHDPREMLLVAP-SPASACALAEELARLVDEFIIEDVDPKALGSL 182

Query: 173 KNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPII 231
             + +  ++ +   FL+IA + W + L E         + AL+ A+ + L +G  +GP+I
Sbjct: 183 AEDAHDRYFAITTHFLRIALEDWPKILKERECIDGATRRKALVAAQIDALTRGAARGPVI 242

Query: 232 IAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTH 291
             GSTG+ P TARL++ +     GA+VLPGLD  +  A W  + E S    +      TH
Sbjct: 243 ALGSTGAQPTTARLIAAIERLETGAVVLPGLDLEMDEASWRRVGETSV---AREEAAVTH 299

Query: 292 PQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN 351
           PQ  L +L+  + + R +V+R+G     +  R  +++ +  P D++D+      E    +
Sbjct: 300 PQAMLKRLIGIIGVARAEVRRIGAPPAAIEARGRLLAAALKPADSTDLWRA-FREAHGAS 358

Query: 352 IQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGI 411
                + V+ IEA +EREEA+++A+ +R +L+   + +AL+T DR +ARRV  EL R+ I
Sbjct: 359 FDAALAGVSFIEAADEREEALALALCMREALETPGRTAALVTPDRMIARRVCAELARWDI 418

Query: 412 NIDISAGIPLSTT----LHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
            +D SAG PL+ T    L   +  SL + +  ++     A L+ HPL   G     ++R 
Sbjct: 419 EVDDSAGRPLAATPIGALARLVAASLEDGVSAVD----AAALLAHPLTSLGLGRAEIARI 474

Query: 468 KNALELVALR 477
              +E+  LR
Sbjct: 475 APLVEIGVLR 484


>gi|148260454|ref|YP_001234581.1| hypothetical protein Acry_1454 [Acidiphilium cryptum JF-5]
 gi|146402135|gb|ABQ30662.1| Inactivated superfamily I helicase-like protein [Acidiphilium cryptum
            JF-5]
          Length = 959

 Score =  208 bits (530), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 232/873 (26%), Positives = 373/873 (42%), Gaps = 86/873 (9%)

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGSI 239
            W    DFL I ++ W   L E  A  P   Q  L+ A+AE   +     P+ +AG   + 
Sbjct: 155  WQRTLDFLSIVTRTWPAILAERGAVDPAVRQRMLIDAQAERWRLTPPAHPVWLAGLAAAP 214

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PA  RL   VA  P+G +VLPG D  +P   W+ +    T           HPQ  L +L
Sbjct: 215  PALGRLARVVAGLPHGCVVLPGFDPDLPDNAWSMLDHTPT-----------HPQAGLNRL 263

Query: 300  LDFLDIKREDVKRL---GNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
             + + ++RE+V  L   G    E   R  ++ ++FLP   +        +          
Sbjct: 264  AEAIGVRREEVAPLREGGATGRET--RVALLRRAFLPTAPAADIAAASADG--------- 312

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
              +  ++A +E++EA +IA+ LR +L+   + +AL+T DR LA+RV  EL R GI  D S
Sbjct: 313  --LWRLDAADEQDEARAIALTLRHALETPGRHAALVTPDRGLAQRVAAELERLGIRADDS 370

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            AG  L+ T  + +L  L  A     D + +  L+KHPL   G P          L+L+  
Sbjct: 371  AGERLADTPPAVLLRLLAAAAASDYDAVPLLALLKHPLVNAGLPAGRCRALARRLDLLLR 430

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVT 536
                                      + + H     ++ D+ L+  L D  LQ     ++
Sbjct: 431  AALPG------------------PGFSAMRHAADHSTKPDEALSTFLAD--LQVSLRPLS 470

Query: 537  YKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSS-LFSKIIETG 595
                K S  G L+        +        DE      LW  E G  LS  L  +I    
Sbjct: 471  LGPAKTSPAGLLA-------GLVEAAEAIADE------LWTGEAGAALSEHLAVQIAALD 517

Query: 596  SCIKANAIEWIDIITRLIDGETV-KPKIEKSST-LFILGTLESRLLNFDTLILGGLNEGV 653
            +     A E + ++  ++    + +P+   ++  + I G +E+RL   DTL+LGGL EGV
Sbjct: 518  ALPDIEATELVPLLDAVLGNARLRRPRARDANPRVAIWGMMEARLQRVDTLVLGGLVEGV 577

Query: 654  WPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE-MANGTRHLIYTRSLRENNIPTIA 712
            +P      P+LSR M+    L    + IG+AAHD   +      +I +   R    P + 
Sbjct: 578  FPAEPEPGPWLSRPMRRAARLPDDAERIGEAAHDLGILIASCDEVILSAPRRRGRAPAVP 637

Query: 713  SRWLQRL-LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYS 771
            SR+L R+ L L G      LK+    +  W+ +LD  T +    RP+P PP  A+P +YS
Sbjct: 638  SRFLARIDLALRGAG--SALKQHPASH--WSTRLDQPTLRIARPRPEPRPPARARPISYS 693

Query: 772  FSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEI 831
             S++  L++DPYA+YA  +L L  +   + + D    GT+ H+ +  + +     + P+ 
Sbjct: 694  ISKVTTLLSDPYAIYAGEVLDLHTLNPLQAETDAALFGTITHDALKAVTRTPDWASAPDA 753

Query: 832  NHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK---IFVNIPAK 888
               +     S    + L   ++  W     +I+   +E E    + + K   I V +P +
Sbjct: 754  AARLAHAFTSELRGKRLRRALEAFWLVRLERIAEWIVEIERGRLADLGKADDIKVELPGE 813

Query: 889  MAIESIGIHLT--GFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKA 946
                    H T  G ADRI+  +   + I DYKTG  P  +  +    PQL +EA   +A
Sbjct: 814  WRFG----HFTVKGRADRIE-RRGETLAIIDYKTGSPPADKAVEAGSAPQLPIEAVIAEA 868

Query: 947  GSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELS---EKSLKNLIEIVTLLQN 1003
            G F      KV  L Y +L      +  T      +A  L    + +   +  ++    +
Sbjct: 869  GGFPGF-TGKVTELAYWKLSGG-ATEGETRALFGGNAGPLRAVIDAARTQIPALLAYYAD 926

Query: 1004 GEQPFISHLRLSEKSNIQSEYDHLARVAEWREE 1036
               PF+       K   Q  +  ++R AEW+E+
Sbjct: 927  PATPFLDAPHPGRKPYDQP-FAGISRRAEWQED 958


>gi|326403647|ref|YP_004283729.1| double-strand break repair protein AddB [Acidiphilium multivorum
            AIU301]
 gi|325050509|dbj|BAJ80847.1| double-strand break repair protein AddB [Acidiphilium multivorum
            AIU301]
          Length = 959

 Score =  207 bits (528), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 233/875 (26%), Positives = 376/875 (42%), Gaps = 90/875 (10%)

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL-MKGTKGPIIIAGSTGSI 239
            W    DFL I ++ W   L E  A  P   Q  L+ A+AE   +     P+ +AG   + 
Sbjct: 155  WQRTLDFLSIVTRTWPAILAERGAVDPAVRQRMLIDAQAERWRLTPPAHPVWLAGLAAAP 214

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
            PA  RL   VA  P+G +VLPG D  +P   W+ +    T           HPQ  L +L
Sbjct: 215  PALGRLARVVAGLPHGCVVLPGFDPDLPDKAWSMLDHTPT-----------HPQAGLNRL 263

Query: 300  LDFLDIKREDVKRL---GNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
             + + ++RE+V  L   G    E   R  ++ ++FLP   +        +          
Sbjct: 264  AEAIGVRREEVAPLREGGATGRET--RVALLRRAFLPTAPAADIAAASADG--------- 312

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDIS 416
              +  ++A +E++EA +IA+ LR +L+   + +AL+T DR LA+RV  EL R GI  + S
Sbjct: 313  --LWRLDAADEQDEARAIALTLRHALETPGRHAALVTPDRGLAQRVAAELERLGIRAEDS 370

Query: 417  AGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVAL 476
            AG  L+ T  + +L  L  A     D + +  L+KHPL   G P          L+L+  
Sbjct: 371  AGERLADTPPAVLLRLLAAAAASDYDAVPLLALLKHPLVNAGLPAGRCRALARRLDLLLR 430

Query: 477  RGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLV- 535
                                      + + H     ++ D+ L+  L D +   + PL  
Sbjct: 431  AALPG------------------PGFSAMRHAADHSTKPDEALSTFLAD-LQVSLRPLSL 471

Query: 536  -TYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSS-LFSKIIE 593
               KT+  S    L         V   + +  DE      LW  E G  LS  L  +I  
Sbjct: 472  GPAKTSPASLLAGL---------VEAAEAIA-DE------LWTGEAGAALSEHLAVQIAA 515

Query: 594  TGSCIKANAIEWIDIITRLIDGETV-KPKIEKSST-LFILGTLESRLLNFDTLILGGLNE 651
              +     A E + ++  ++    + +P+   ++  + I G +E+RL   DTL+LGGL E
Sbjct: 516  LDALPDVEATELVPLLDAVLGNARLRRPRARDANPRVAIWGMMEARLQRVDTLVLGGLVE 575

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE-MANGTRHLIYTRSLRENNIPT 710
            GV+P      P+LSR M+    L    + IG+AAHD   +      +I +   R    P 
Sbjct: 576  GVFPAEPEPGPWLSRPMRRAARLPDDAERIGEAAHDLGILIASCDEVILSAPRRRGRAPA 635

Query: 711  IASRWLQRL-LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT 769
            + SR+L R+ L L G      LK+    +  W+ +LD  T +    RP+P PP  A+P +
Sbjct: 636  VPSRFLARIDLALRGAG--SALKQHPASH--WSTRLDQPTLRIARPRPEPRPPARARPIS 691

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTP 829
            YS S++  L++DPYA+YA  +L L  +   + + D    GT+ H+ +  + + R   + P
Sbjct: 692  YSISKVTTLLSDPYAIYAGEVLDLHTLNPLQAETDAALFGTITHDALKAVTRTRDWASAP 751

Query: 830  EINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK---IFVNIP 886
            +    +     S    + L   ++  W     +I+   +E E    + + K   I V +P
Sbjct: 752  DAAARLAHAFTSELRGKRLRRALEAFWLVRLERIAEWIVEIERGRLADLGKADDIKVELP 811

Query: 887  AKMAIESIGIHLT--GFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAAL 944
             +        H T  G ADRI+  +   + I DYKTG  P  +  +    PQL +EA   
Sbjct: 812  GEWRFG----HFTVKGRADRIE-RRGETLAIIDYKTGSPPADKAVEAGSAPQLPIEAVIA 866

Query: 945  KAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELS---EKSLKNLIEIVTLL 1001
            +AG F      KV  L Y +L      +  T      +A  L    + +   +  ++   
Sbjct: 867  EAGGFPGF-TGKVTELAYWKLSGG-ATEGETRALFGGNAGPLRAVIDAARTQIPALLAYY 924

Query: 1002 QNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREE 1036
             +   PF+       K   Q  +  ++R AEW+E+
Sbjct: 925  ADPATPFLDAPHPGRKPYDQP-FAGISRRAEWQED 958


>gi|126734387|ref|ZP_01750134.1| hypothetical protein RCCS2_09509 [Roseobacter sp. CCS2]
 gi|126717253|gb|EBA14117.1| hypothetical protein RCCS2_09509 [Roseobacter sp. CCS2]
          Length = 975

 Score =  197 bits (502), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 140/473 (29%), Positives = 215/473 (45%), Gaps = 28/473 (5%)

Query: 574  NLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFILG 632
             LW E  G+        +I+  +        ++  +   +I   TV+ +      + I G
Sbjct: 506  GLWDEAAGREARKTCDNLIQAAAAGGTMTPHDYTALFGSVIAEGTVRDRDAGHPGILIWG 565

Query: 633  TLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMAN 692
            TLE+R+   D  ILGG+N+GVWP+    +P+L+RVM++   L   E+ IG +AHD++ A 
Sbjct: 566  TLEARVQGVDLTILGGMNDGVWPEAPPPDPWLNRVMRAKAGLLLPERRIGLSAHDYQQAV 625

Query: 693  GTRHLIYTRSLRENNIPTIASRWLQRLLVL-------GGTDFFDNLKKRGQCYLDWTRKL 745
                +  TR+ R  +  T+ SRW+ RL  L        G D    +  +G  +      L
Sbjct: 626  AGHEVWITRAKRSADAETVPSRWVNRLTNLLKGLPDQNGPDALAAMCAKGDQWSAMAAVL 685

Query: 746  DY-TTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPD 804
                 + P   RP P PP+ A+P+  S ++IK LI DP+ +YAR+ L L  +       D
Sbjct: 686  STPQARVPSAPRPSPCPPVAARPKKLSVTQIKTLIRDPFTIYARKTLHLSPLDPLVPTAD 745

Query: 805  RTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKIS 864
               RGT+ H I+   I+     + P     + Q+    F      P I   W     + +
Sbjct: 746  APLRGTIMHRILERFIRA---GHGPNDRDALMQLASEEFTAHCPWPTIRAQWMARMERSA 802

Query: 865  HSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNP 924
              FL  E   Q+      + +  ++ +   G+ LT  ADRIDL K+G   I DYKTG  P
Sbjct: 803  DQFLADEADRQALATDHKIEVYGEIVVAPSGVLLTCKADRIDLTKTGAALIYDYKTGAVP 862

Query: 925  KKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFK-IDCITNDKKKYSA 983
             K   Q   D QL LEAA ++ G+F  +    V    +I +    K +    ND      
Sbjct: 863  TKNQ-QLTFDKQLLLEAAMVELGAFESLGSMSVGGATFIGVNAAMKNVPAPLNDNPP--- 918

Query: 984  DELSEKSLKNLIEIVTLLQNGEQP---FISHLRLSEKSNIQSEYDHLARVAEW 1033
            D++         E+ TL  N   P   + + L L  K++ QS+YDHL+R  EW
Sbjct: 919  DQV-------WGELETLFGNWHDPSRGYTARLALFLKTD-QSDYDHLSRHGEW 963



 Score =  157 bits (397), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 131/454 (28%), Positives = 222/454 (48%), Gaps = 46/454 (10%)

Query: 3   NKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRS 62
           +K+P++F   P   F + ++  L+        R   L+P  LA V IYV T R  + +R+
Sbjct: 5   DKQPHIFASPPGVDFAQGLVAGLIA-------RTADLDPTDLARVEIYVNTTRMQRRIRA 57

Query: 63  EFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
            F   TG  + +LP ++ + D+  +       +S +L P VS +QR LEL++ +    +K
Sbjct: 58  VFD--TGP-ARLLPRVRLITDLANDP------ISLDLPPAVSPLQRRLELSQFVAKLLDK 108

Query: 123 LPDIIKDLYPESPLSLPISPANAIW-LAKNLADIIDIIETEEKKWEDLHALKNEKYGMWW 181
            PD+              +P  A++ L+ +LA ++D ++ E    + + +L        W
Sbjct: 109 EPDL--------------APRAALYDLSDSLAKLMDEMQGEGVSPDKIASLDIADQSGHW 154

Query: 182 LLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGT-KGPIIIAGSTGSIP 240
             A  FLKI + ++ ++    +  +    Q  ++ A A+       + PI+IAGSTGS  
Sbjct: 155 ERALAFLKIITPFFDQQNEPPDKEA---RQRMVIEALAQKWETAPPQHPILIAGSTGSRG 211

Query: 241 ATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLL 300
           ATA  M  VA  P GAI+LPG D  +P  +W+ + +        + T   HPQ+   +L+
Sbjct: 212 ATALFMQAVAKLPQGAIILPGFDFDLPDHVWDAMDD--------DLTAEDHPQFRFRRLM 263

Query: 301 DFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVA 360
           D +  +R DV+     S     R+ ++S S  P   +D   ++     + ++ +    + 
Sbjct: 264 DLIGFQRHDVREWSTQSPAHPARNALVSLSLRPAPVTDQWLSE--GPDLGDLYEATKGLT 321

Query: 361 LIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIP 420
           L+EA + R EA +IA+ LR +  E+   +ALI+ DR L R+V   L R+ I  D SAG P
Sbjct: 322 LVEAASPRAEAETIALRLRQAA-EDGITAALISPDRMLTRQVTAALDRWDIKPDDSAGTP 380

Query: 421 LSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPL 454
           L+ +     L  + +   K     A+ TL+KHPL
Sbjct: 381 LALSPPGRFLRHVADLFGKPLTGEALLTLLKHPL 414


>gi|296448613|ref|ZP_06890483.1| double-strand break repair protein AddB [Methylosinus trichosporium
            OB3b]
 gi|296253885|gb|EFH01042.1| double-strand break repair protein AddB [Methylosinus trichosporium
            OB3b]
          Length = 520

 Score =  181 bits (458), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 134/424 (31%), Positives = 208/424 (49%), Gaps = 9/424 (2%)

Query: 616  ETVKPKIEKS-STLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNL 674
            ET  P   ++   L ILG LE+RLL+ D ++L GL+E +WP       FL+R M++ L L
Sbjct: 90   ETAAPSPRRAHPRLKILGLLEARLLDADLVLLAGLDETIWPPQAETGAFLNRTMRAQLGL 149

Query: 675  KTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKR 734
               E+ IGQ AHDF +A   R ++ +RS + +  PT+ SR++ RL  L G + F   K R
Sbjct: 150  SPPERRIGQTAHDFSLAFCAREVVLSRSRKRDGSPTVVSRFVARLAALAGEN-FSACKAR 208

Query: 735  GQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLD 794
            G         LD+  +     RP P PP+E +P   S + I++L  DPY+V+A  +L+L 
Sbjct: 209  GDRARALAAALDHPAEIRAAARPLPRPPVELRPVRLSVTRIEKLRRDPYSVFAEHVLRLA 268

Query: 795  FIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENL--PPHI 852
             +P    +    + G   H  + +  +       PE       I+      E L  P  I
Sbjct: 269  PLPPLGAEKGAREIGVAVHAALAKFSEAHPKGPLPEDASERLLILARAELAEFLDDPSFI 328

Query: 853  DIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPA--KMAIESIGIH-LTGFADRIDLLK 909
               W  L   + H+     E+ + + E  F+ I    ++ +   G+  L+  ADRI+L  
Sbjct: 329  AFQWPRLETGLRHALAFERERRKIASE-TFIEIRGEWRLPLADGGVFTLSCVADRIELDA 387

Query: 910  SGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKF 969
            +G   + DYKTG  P  +       PQL+LEAA ++AG+F  I  R V+   Y+RL  K 
Sbjct: 388  AGAAFVVDYKTGTPPSVKQVDAGFSPQLTLEAAMIEAGAFPPIGVRAVSGAAYVRLGGKD 447

Query: 970  KIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLAR 1029
              +      K  S  ++  +   NL+E++   ++   P+ S     E ++   +YDHLAR
Sbjct: 448  GGETRELKFKDKSFSDVVAEHRANLLELLNQFRDPATPYPSRP-FVEFASRYGDYDHLAR 506

Query: 1030 VAEW 1033
            VAEW
Sbjct: 507  VAEW 510


>gi|47716791|gb|AAT37573.1| salt tolerance-related rstW10 [Sinorhizobium meliloti]
          Length = 181

 Score =  162 bits (409), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 598 IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
           ++A+  +W DI+  L   E VKP+  +   +FI G LESRL + D ++LGG+NEG WP  
Sbjct: 1   MEADGPQWCDILEALAASEAVKPRSMRHPRVFIFGALESRLQSVDLVVLGGINEGTWPGQ 60

Query: 658 TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
           T+ +PFLSR M++ + L+  E+ IGQ AHDF+MA GTR LI +RS+R+ + PT+ASRWLQ
Sbjct: 61  TSNDPFLSRTMKAGIGLEPPERRIGQLAHDFQMACGTRRLILSRSMRQGSAPTVASRWLQ 120

Query: 718 RLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH-YKRPKPFP 761
           RL  LGG      LK  G  YL W R LD         +RP+P P
Sbjct: 121 RLQALGGERLTALLKANGADYLHWMRILDQRRASXRCXERPEPKP 165


>gi|225630600|ref|YP_002727391.1| hypothetical protein WRi_008710 [Wolbachia sp. wRi]
 gi|225592581|gb|ACN95600.1| hypothetical protein WRi_008710 [Wolbachia sp. wRi]
          Length = 943

 Score =  144 bits (362), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 254/1058 (24%), Positives = 418/1058 (39%), Gaps = 213/1058 (20%)

Query: 44   LASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV 103
            +  + + +P KR +  L + F     +K  ILP I SL ++ EE    DL+L+ +    +
Sbjct: 30   IPEIKVILPCKRDVIALLNAFKNYNAEKCIILPEIVSLENIDEE----DLILNLDRVKVI 85

Query: 104  SNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE 163
            S I+R L L + IL W  K  D           + PI       LA +L  ++D I+  +
Sbjct: 86   SPIKRTLLLIQFILEWNRKNND-----------NFPID------LAYSLPSLLDKIQYTQ 128

Query: 164  KKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM 223
                D H+ K E           F+ +  + W + L +L     + ++   + +    L 
Sbjct: 129  MAEFDEHSKKIE----------SFINLLIETWNKILKDLGVVDILEHKSDYINSMITSLQ 178

Query: 224  KGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS 283
            K     II  G    I     L+  + + P G I+LP L+  I    W  + +K      
Sbjct: 179  KDQH--IIFVG----IGKDKSLIKAIYDLPFGEIILPNLNLKIKEKDWKLLDKK------ 226

Query: 284  SNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVS--------------NE----MYGRSM 325
                   H QY L  LLD+L++ R DV  L                  NE    +Y R+ 
Sbjct: 227  -------HYQYCLKDLLDYLNVDRRDVSFLPEACSPVLRHWDPENLTLNERTRWLYNRNW 279

Query: 326  V-ISKSFLPPDTSDM---------RNTDILENKIPNIQKCF--------------SDVAL 361
            + +S + + P T+ +         +N        P +   F               ++ +
Sbjct: 280  IPVSSTGMTPSTTQITCKLQCSYTKNQRAGMTGSPELDYVFDTTADLSKVSSGHIGNIEV 339

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPL 421
            I  D+  EEA   ++ +    +E  +  +L+  D+ LA R+   L+R   +  I    P 
Sbjct: 340  ITCDSREEEAQVTSLIIE---NEGYENVSLVVFDKLLAARIAC-LSR--QHSAIPENYPY 393

Query: 422  STTLHSSI--LTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
             T L  SI  LTS  +++       A+ +L+KH L  FG+ ++  SR  +  E+  LR N
Sbjct: 394  ITLLLYSIEVLTSNWSSV-------ALLSLLKHRLVTFGYTQEEYSRILSEFEIEILR-N 445

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
             ++  + D    +++ I   K   H            KE  +L++  +     PL+    
Sbjct: 446  FSTNGLSD----IINAINAHKKLKH------------KEDILLIISKLEIIFNPLLN--- 486

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK 599
                   N  ISD     + C+  +                G   S L S+I    +C  
Sbjct: 487  -----IINCPISDVVATHLQCINVL---------------SGINFSELNSEI-GNFTCNF 525

Query: 600  ANAIEWIDIITRL-IDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNT 658
             NA E I+I   L +  + +   +EK          +  L +   +IL G NE      +
Sbjct: 526  LNACEGIEIKCSLELYSQILTLFLEKEFFSVASDLNKFSLYHNKVVILAGFNEA----PS 581

Query: 659  AKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQR 718
             ++P L+ + +   NL +A++  G   +          +  TRSL     P +    LQR
Sbjct: 582  FQSPLLNALTREKFNLPSAQEEQGYFFYTLHNLFCASKVYITRSLSHRK-PIL----LQR 636

Query: 719  LLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP---RTYSFSEI 775
            L +L        LK+  Q Y DW R L+         +P P P  E +    +  S S I
Sbjct: 637  LEIL--------LKEGKQPYRDWLRVLNTPECTVPCTQPMPKPQTEVRKEKMQVMSCSAI 688

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            ++LI +PY+ Y   IL L  +      P   +  T+ HNI+   ++   NK +P ++   
Sbjct: 689  EKLIRNPYSFYVEYILGLKQLRDLNFKPSILEFSTMVHNILARYLR---NKKSP-MSIAR 744

Query: 836  KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE-------KIFVNIPAK 888
            +    S F   N+       W     KI  SF+E +E   + +E        IF +IPA+
Sbjct: 745  EAFSTSQFNFSNM-------WWVRLQKIIQSFVEFDETRSNYVELEKNFSCPIF-HIPAR 796

Query: 889  ------------MAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQ 936
                        M      I LT   DR++ L SG V I DYK G  P  E       PQ
Sbjct: 797  DTGSCDQYETAWMTNRPQEILLTARCDRVEYLPSGQVAIIDYKLGSPPSNEEVMSGFFPQ 856

Query: 937  LSLEAAALKAGSFSQIDCRKVANLFYIRLK-QKFKIDCITNDKKKYSADELSEKSLKNLI 995
            L L+A A++      +  R+V+ L Y +L   K K+  + + ++K       ++   +L 
Sbjct: 857  LILQALAVEY-----VTGREVSELAYWKLDYDKIKVISLRDYRQKM------QEFQNDLP 905

Query: 996  EIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
            + ++   +   PFI+     +     S Y  L RV EW
Sbjct: 906  DFLSNYLSNSTPFIASPYFDKFLRFNS-YKQLERVGEW 942


>gi|218659156|ref|ZP_03515086.1| hypothetical protein RetlI_05536 [Rhizobium etli IE4771]
          Length = 212

 Score =  137 bits (344), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 4/162 (2%)

Query: 352 IQKCFSDVALIEADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELT 407
           +   F+DV+LIEA NEREEA +IA+ALR++L+    + + ++ALIT DRNLARRV  EL+
Sbjct: 37  LTSAFNDVSLIEAANEREEATAIAVALRLALERPGQDGESRAALITPDRNLARRVMAELS 96

Query: 408 RFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
           RFGI  D SAG PLS T   S+L  LL A  +  D +AI +L+KHPLA+FG     L  A
Sbjct: 97  RFGILADDSAGTPLSATPQGSLLQLLLEAALRPGDPVAIVSLLKHPLARFGLERDALISA 156

Query: 468 KNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQ 509
             ALEL+ALRG     DI  L+ L+  ++A Q  + H P W+
Sbjct: 157 TEALELLALRGGVVEVDISALEPLLTHQLAEQALDRHAPQWR 198


>gi|99034830|ref|ZP_01314745.1| hypothetical protein Wendoof_01000432 [Wolbachia endosymbiont of
            Drosophila willistoni TSC#14030-0811.24]
          Length = 932

 Score =  137 bits (344), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 253/1043 (24%), Positives = 415/1043 (39%), Gaps = 194/1043 (18%)

Query: 44   LASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV 103
            +  V I +P KR +  L S F     KK  ILP I SL ++ EE    DL+L+ +    +
Sbjct: 30   IPEVKIILPCKRDVIALLSAFKNHNAKKCIILPEIVSLENIDEE----DLILNLDRVKVI 85

Query: 104  SNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE 163
               +R L L + IL W  K  D           + PI  A ++    +L D I   +T +
Sbjct: 86   KPTKRTLLLIQFILEWNRKNND-----------NFPIDLAYSL---PSLLDKIQSTQTTD 131

Query: 164  KKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM 223
                D H+ K E          +F+ + ++ W++ L +L     + ++   +      L 
Sbjct: 132  CYQFDEHSKKIE----------NFISLLTETWSKTLKDLEVVDILKHKSDYINNMIISLQ 181

Query: 224  KGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS 283
            K     II  G    I     L+  + + P G I+LP L+  I    W ++ +K      
Sbjct: 182  KDQY--IIFVG----IGKDKSLIRAIYDLPFGKIILPNLNLKIKEKDWKSLDKK------ 229

Query: 284  SNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVS--------------NE----MYGRSM 325
                   H QY L  LLD+L + R DV  L                  NE    +Y  + 
Sbjct: 230  -------HYQYCLKDLLDYLKVDRRDVSFLPEACSPVPRHWDPENLTLNERTRWLYNENW 282

Query: 326  V-ISKSFLPPDTSDMRNT-----DILENKIPNIQKCFS----DVALIEADNEREEAISIA 375
            + +S +++  + + +  +     D + +   ++ K  S    ++ +I  D+  EEA   +
Sbjct: 283  IPVSATWMTEERAGITGSPEEYLDYVFDTTADLSKVSSGHVGNIEVITCDSREEEAQVTS 342

Query: 376  IALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSI--LTSL 433
            + +    +E  +  +L+  D+ LA R+   L+R   +  I    P  T L  SI  LTS 
Sbjct: 343  LIIE---NEGYENISLVVFDKLLAARIAC-LSR--QHSAIPENYPYITLLLYSIEVLTSN 396

Query: 434  LNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVL 493
             ++       +++ +L+KH L  FG+ ++  +R  +  E+  LR N ++  + D    ++
Sbjct: 397  WSS-------VSLLSLLKHRLVTFGYTQEEYTRILSEFEIEILR-NFSTNGLSD----II 444

Query: 494  DRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDW 553
            + I   K   +            KE  +L++  +     PL+           N SI D 
Sbjct: 445  NAINAHKKLKY------------KEDILLIISKLEVIFNPLLR--------SINCSIFDV 484

Query: 554  TKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLI 613
                + C+  +                G   S L S+I    +C  +NA E + I   L 
Sbjct: 485  VATHLQCINIL---------------SGINFSELNSEI-GNFTCNFSNACEGVGIKCSLE 528

Query: 614  DGETVKPKIEKSSTLFILGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDL 672
                +     +    F+   L    L +   +IL G NE        ++P L+ + +   
Sbjct: 529  LYSQILTLFLEKEFFFVASDLNKFSLYHNKVVILAGFNEA----PNFQSPLLNALTREKF 584

Query: 673  NLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLK 732
            NL +A++  G   +          +  TRSL     P +    LQRL +L        LK
Sbjct: 585  NLPSAQEEQGYFFYTLHNLFCASKVYITRSLSHRK-PIL----LQRLEIL--------LK 631

Query: 733  KRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP---RTYSFSEIKQLINDPYAVYARR 789
            +  Q Y DW R L+         +P P P  E +    +  S S I++LI +PY+ Y   
Sbjct: 632  EGKQPYRDWLRILNTPECTVPCTQPMPKPQTEVRKEKMQVMSCSAIEKLIRNPYSFYVEY 691

Query: 790  ILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLP 849
            IL L  +      P   + GT+ HNI+   ++   NK +P ++   +    S F   N+ 
Sbjct: 692  ILGLKQLRDLNFKPSILEFGTMVHNILARYLR---NKKSP-MSIAREAFSTSQFNFSNM- 746

Query: 850  PHIDIIWRHLFHKISHSFLEHEEKIQSSIE-------KIFVNIPAK------------MA 890
                  W     KI  SF+E +E   + +E        IF +IPA+            M 
Sbjct: 747  ------WWVRLQKIIQSFVEFDETRSNYVEWEKNFSCPIF-HIPARDTGSCDQYETAWMT 799

Query: 891  IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
             +   I L    DR++ L SG V I DYK G  P  E       PQL L+A A++     
Sbjct: 800  NKPQEISLIARCDRVEYLPSGQVAIIDYKLGTPPSNEEVMSGFFPQLILQALAVE----- 854

Query: 951  QIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFIS 1010
             I  R+V+ L Y +L    KI  I+    +Y   EL      +L   ++   +   PFI+
Sbjct: 855  HITKREVSELAYWKLDYD-KIKVISIQNYRYKMQELK----NDLPGFLSNYLSNSTPFIA 909

Query: 1011 HLRLSEKSNIQSEYDHLARVAEW 1033
                 +     S Y  L RV EW
Sbjct: 910  SPYFDKFLRFNS-YKQLERVGEW 931


>gi|58696747|ref|ZP_00372288.1| conserved hypothetical protein [Wolbachia endosymbiont of Drosophila
            simulans]
 gi|58537064|gb|EAL60192.1| conserved hypothetical protein [Wolbachia endosymbiont of Drosophila
            simulans]
          Length = 901

 Score =  136 bits (343), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 251/1042 (24%), Positives = 410/1042 (39%), Gaps = 213/1042 (20%)

Query: 60   LRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            L + F     +K  ILP I SL ++ EE    DL+L+ +    +S I+R L L + IL W
Sbjct: 4    LLNAFKNYNAEKCIILPEIVSLENIDEE----DLILNLDRVKVISPIKRTLLLIQFILEW 59

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
              K  D           + PI       LA +L  ++D I+  +    D H+ K E    
Sbjct: 60   NRKNND-----------NFPID------LAYSLPSLLDKIQYTQMAEFDEHSKKIE---- 98

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
                   F+ +  + W + L +L     + ++   + +    L K     II  G    I
Sbjct: 99   ------SFINLLIETWNKILKDLGVVDILEHKSDYINSMITSLQKDQH--IIFVG----I 146

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
                 L+  + + P G I+LP L+  I    W  + +K             H QY L  L
Sbjct: 147  GKDKSLIKAIYDLPFGEIILPNLNLKIKEKDWKLLDKK-------------HYQYCLKDL 193

Query: 300  LDFLDIKREDVKRLGNVS--------------NE----MYGRSMV-ISKSFLPPDTSDM- 339
            LD+L++ R DV  L                  NE    +Y R+ + +S + + P T+ + 
Sbjct: 194  LDYLNVDRRDVSFLPEACSPVLRHWDPENLTLNERTRWLYNRNWIPVSSTGMTPSTTQIT 253

Query: 340  --------RNTDILENKIPNIQKCF--------------SDVALIEADNEREEAISIAIA 377
                    +N        P +   F               ++ +I  D+  EEA   ++ 
Sbjct: 254  CKLQCSYTKNQRAGMTGSPELDYVFDTTADLSKVSSGHIGNIEVITCDSREEEAQVTSLI 313

Query: 378  LRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSI--LTSLLN 435
            +    +E  +  +L+  D+ LA R+   L+R   +  I    P  T L  SI  LTS  +
Sbjct: 314  IE---NEGYENVSLVVFDKLLAARIAC-LSR--QHSAIPENYPYITLLLYSIEVLTSNWS 367

Query: 436  AIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDR 495
            ++       A+ +L+KH L  FG+ ++  SR  +  E+  LR N ++  + D    +++ 
Sbjct: 368  SV-------ALLSLLKHRLVTFGYTQEEYSRILSEFEIEILR-NFSTNGLSD----IINA 415

Query: 496  IATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTK 555
            I   K   H            KE  +L++  +     PL+           N  ISD   
Sbjct: 416  INAHKKLKH------------KEDILLIISKLEIIFNPLLN--------IINCPISDVVA 455

Query: 556  LTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRL-ID 614
              + C+  +                G   S L S+I    +C   NA E I+I   L + 
Sbjct: 456  THLQCINVL---------------SGINFSELNSEI-GNFTCNFLNACEGIEIKCSLELY 499

Query: 615  GETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNL 674
             + +   +EK          +  L +   +IL G NE      + ++P L+ + +   NL
Sbjct: 500  SQILTLFLEKEFFSVASDLNKFSLYHNKVVILAGFNEA----PSFQSPLLNALTREKFNL 555

Query: 675  KTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKR 734
             +A++  G   +          +  TRSL     P +    LQRL +L        LK+ 
Sbjct: 556  PSAQEEQGYFFYTLHNLFCASKVYITRSLSHRK-PIL----LQRLEIL--------LKEG 602

Query: 735  GQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP---RTYSFSEIKQLINDPYAVYARRIL 791
             Q Y DW R L+         +P P P  E +    +  S S I++LI +PY+ Y   IL
Sbjct: 603  KQPYRDWLRVLNTPECTVPCTQPMPKPQTEVRKEKMQVMSCSAIEKLIRNPYSFYVEYIL 662

Query: 792  KLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPH 851
             L  +      P   +  T+ HNI+   ++   NK +P ++   +    S F   N+   
Sbjct: 663  GLKQLRDLNFKPSILEFSTMVHNILARYLR---NKKSP-MSIAREAFSTSQFNFSNM--- 715

Query: 852  IDIIWRHLFHKISHSFLEHEEKIQSSIE-------KIFVNIPAK------------MAIE 892
                W     KI  SF+E +E   + +E        IF +IPA+            M   
Sbjct: 716  ----WWVRLQKIIQSFVEFDETRSNYVELEKNFSCPIF-HIPARDTGSCDQYETAWMTNR 770

Query: 893  SIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQI 952
               I LT   DR++ L SG V I DYK G  P  E       PQL L+A A++      +
Sbjct: 771  PQEILLTARCDRVEYLPSGQVAIIDYKLGSPPSNEEVMSGFFPQLILQALAVEY-----V 825

Query: 953  DCRKVANLFYIRLK-QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISH 1011
              R+V+ L Y +L   K K+  + + ++K       ++   +L + ++   +   PFI+ 
Sbjct: 826  TGREVSELAYWKLDYDKIKVISLRDYRQKM------QEFQNDLPDFLSNYLSNSTPFIAS 879

Query: 1012 LRLSEKSNIQSEYDHLARVAEW 1033
                +     S Y  L RV EW
Sbjct: 880  PYFDKFLRFNS-YKQLERVGEW 900


>gi|218509238|ref|ZP_03507116.1| hypothetical protein RetlB5_17865 [Rhizobium etli Brasil 5]
          Length = 149

 Score =  133 bits (334), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 67/144 (46%), Positives = 98/144 (68%), Gaps = 2/144 (1%)

Query: 5   KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
           +P + TI    PF + +   L +G L   F++D  +PL LA VTIY+PT+RA++ LRSEF
Sbjct: 6   QPRILTIPAGLPFLKTLATTLCDGRLTPLFQHDVDDPLSLARVTIYLPTRRAVRVLRSEF 65

Query: 65  IEITGKKSTILPIIKSLGDVVEEK--FTADLLLSYNLNPPVSNIQRLLELARLILIWRNK 122
           +++ G +S ILP+I+ LG+  ++   F   L  + +L  P+SN  RLLELARLIL WRNK
Sbjct: 66  VDLLGGRSAILPVIRPLGETDDDSGYFDEALPATIDLAQPLSNTARLLELARLILAWRNK 125

Query: 123 LPDIIKDLYPESPLSLPISPANAI 146
           LP+I++ ++ +SPL  P SPA+AI
Sbjct: 126 LPEIVRHIHSDSPLVAPASPADAI 149


>gi|42520737|ref|NP_966652.1| hypothetical protein WD0912 [Wolbachia endosymbiont of Drosophila
            melanogaster]
 gi|42410477|gb|AAS14586.1| hypothetical protein WD_0912 [Wolbachia endosymbiont of Drosophila
            melanogaster]
          Length = 890

 Score =  129 bits (323), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 248/1027 (24%), Positives = 408/1027 (39%), Gaps = 194/1027 (18%)

Query: 60   LRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIW 119
            L S F     KK  ILP I SL ++ EE    DL+L+ +    +   +R L L + IL W
Sbjct: 4    LLSAFKNHNAKKCIILPEIVSLENIDEE----DLILNLDRVKVIKPTKRTLLLIQFILEW 59

Query: 120  RNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM 179
              K  D           + PI  A ++    +L D I   +T +    D H+ K E    
Sbjct: 60   NRKNND-----------NFPIDLAYSL---PSLLDKIQSTQTTDCYQFDEHSKKIE---- 101

Query: 180  WWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSI 239
                  +F+ + ++ W++ L +L     + ++   +      L K     II  G    I
Sbjct: 102  ------NFISLLTETWSKTLKDLEVVDILKHKSDYINNMIISLQKDQY--IIFVG----I 149

Query: 240  PATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKL 299
                 L+  + + P G I+LP L+  I    W ++ +K             H QY L  L
Sbjct: 150  GKDKSLIRAIYDLPFGKIILPNLNLKIKEKDWKSLDKK-------------HYQYCLKDL 196

Query: 300  LDFLDIKREDVKRLGNVS--------------NE----MYGRSMV-ISKSFLPPDTSDMR 340
            LD+L + R DV  L                  NE    +Y  + + +S +++  + + + 
Sbjct: 197  LDYLKVDRRDVSFLPEACSPVPRHWDPENLTLNERTRWLYNENWIPVSATWMTEERAGIT 256

Query: 341  NT-----DILENKIPNIQKCFS----DVALIEADNEREEAISIAIALRMSLDENKKKSAL 391
             +     D + +   ++ K  S    ++ +I  D+  EEA   ++ +    +E  +  +L
Sbjct: 257  GSPEEYLDYVFDTTADLSKVSSGHVGNIEVITCDSREEEAQVTSLIIE---NEGYENISL 313

Query: 392  ITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSI--LTSLLNAIFKLNDFMAIATL 449
            +  D+ LA R+   L+R   +  I    P  T L  SI  LTS  ++       +++ +L
Sbjct: 314  VVFDKLLAARIAC-LSR--QHSAIPENYPYITLLLYSIEVLTSNWSS-------VSLLSL 363

Query: 450  VKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQ 509
            +KH L  FG+ ++  +R  +  E+  LR N ++  + D    +++ I   K   +     
Sbjct: 364  LKHRLVTFGYTQEEYTRILSEFEIEILR-NFSTNGLSD----IINAINAHKKLKY----- 413

Query: 510  SRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEH 569
                   KE  +L++  +     PL+           N SI D     + C+  +     
Sbjct: 414  -------KEDILLIISKLEVIFNPLLR--------SINCSIFDVVATHLQCINIL----- 453

Query: 570  RKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLF 629
                       G   S L S+I    +C  +NA E + I   L     +     +    F
Sbjct: 454  ----------SGINFSELNSEI-GNFTCNFSNACEGVGIKCSLELYSQILTLFLEKEFFF 502

Query: 630  ILGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF 688
            +   L    L +   +IL G NE      + ++P L+ + +   NL +A++  G   +  
Sbjct: 503  VASDLNKFSLYHNKVVILAGFNEA----PSFQSPLLNALTREKFNLPSAQEEQGYFFYTL 558

Query: 689  EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYT 748
                    +  TRSL     P +    LQRL +L        LK+  Q Y DW R L+  
Sbjct: 559  HNLFCASKVYITRSLSHRK-PIL----LQRLEIL--------LKEGKQPYRDWLRILNTP 605

Query: 749  TKQPHYKRPKPFPPLEAQP---RTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDR 805
                   +P P P  E +    +  S S I++LI +PY+ Y   IL L  +      P  
Sbjct: 606  ECTVPCTQPMPKPQTEVRKEKMQVMSCSAIEKLIRNPYSFYVEYILGLKQLRDLNFKPSI 665

Query: 806  TDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISH 865
             + GT+ HNI+   ++   NK +P ++   +    S F   N+       W     KI  
Sbjct: 666  LEFGTMVHNILARYLR---NKKSP-MSIAREAFSTSQFNFSNM-------WWVRLQKIIQ 714

Query: 866  SFLEHEEKIQSSIE-------KIFVNIPAK------------MAIESIGIHLTGFADRID 906
            SF+E +E   + +E        IF +IPA+            M  +   I L    DR++
Sbjct: 715  SFVEFDETRSNYVELEKNFSCPIF-HIPARDTGSCDQYETAWMTNKPQEISLIARCDRVE 773

Query: 907  LLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLK 966
             L SG V I DYK G  P  E       PQL L+A A++      I  R+V+ L Y +L 
Sbjct: 774  YLPSGQVAIIDYKLGTPPSNEEVMSGFFPQLILQALAVEY-----ITKREVSELAYWKLD 828

Query: 967  QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDH 1026
               KI  I+    +Y   EL      +L   ++   +   PFI+     +     S Y  
Sbjct: 829  YD-KIKVISIQNYRYKMQELK----NDLPGFLSNYLSNSTPFIASPYFDKFLRFNS-YKQ 882

Query: 1027 LARVAEW 1033
            L RV EW
Sbjct: 883  LERVGEW 889


>gi|225677121|ref|ZP_03788121.1| hypothetical protein WUni_006090 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590825|gb|EEH12052.1| hypothetical protein WUni_006090 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 903

 Score =  122 bits (307), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 237/1001 (23%), Positives = 400/1001 (39%), Gaps = 193/1001 (19%)

Query: 44  LASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV 103
           +  + + +P KR +  L S F     +K  ILP I SL ++ EE    DL+L+ +    +
Sbjct: 30  IPEIKVILPCKRDVIALLSAFKNYNAEKCIILPEIVSLENIDEE----DLILNLDRVKVI 85

Query: 104 SNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE 163
           S I+R L L + IL W  K  D         P+ L  S  +++       D I   +T +
Sbjct: 86  SPIKRTLLLIQFILEWNRKNND-------NFPIDLAYSLPSSL-------DKIQSTQTTD 131

Query: 164 KKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM 223
               D H+ K E          +F+ + ++ W++ L +L     + ++   +      L 
Sbjct: 132 CYQFDEHSKKIE----------NFISLLTETWSKTLKDLEVVDILKHKSDYINNMITSLQ 181

Query: 224 KGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS 283
           K     II  G    I     L+  + + P G I+LP L+  I    W  + +K      
Sbjct: 182 KDQH--IIFVG----IGKDKSLIKAIYDLPFGKIILPNLNLKIKEKDWKLLDKK------ 229

Query: 284 SNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVS-----------------NE----MYG 322
                  H QY L  LLD+L + R DV  L                     NE    +Y 
Sbjct: 230 -------HYQYCLKDLLDYLKVDRRDVSFLPEACSGVIPVPRHWDPENLTLNERTRWLYN 282

Query: 323 RSMV-ISKSFLPPDTSDMRNT-----DILENKIPNIQKCFS----DVALIEADNEREEAI 372
            + + +S +++  + + +  +     D + +   ++ K  S    ++ +I  D+  EEA 
Sbjct: 283 ENWIPVSATWMTEERAGITGSPEEYLDYVFDTTADLSKVSSGHVGNIEVITCDSREEEAQ 342

Query: 373 SIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSI--L 430
             ++ +    +E  +  +L+  D+ LA R+   L+R   +  I    P  T L  SI  L
Sbjct: 343 VTSLIIE---NEGYENISLVVFDKLLAARIAC-LSR--QHSAIPENYPYITLLLYSIEVL 396

Query: 431 TSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKS 490
           TS  ++       +++ +L+KH L  FG+ ++  +R  +  E+  LR N ++  + D   
Sbjct: 397 TSNWSS-------VSLLSLLKHRLVTFGYTQEEYTRILSEFEIEILR-NFSTNGLSD--- 445

Query: 491 LVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSI 550
            +++ I   K   +            KE  +L++  +     PL+           N SI
Sbjct: 446 -IINAINAHKKLKY------------KEDILLIISKLEVIFNPLLR--------SINCSI 484

Query: 551 SDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIIT 610
            D     + C+  +                G   S L S+I    +C  +NA E ++I  
Sbjct: 485 FDVVATHLQCINIL---------------SGINFSELNSEI-GNFTCNFSNACEGVEIKC 528

Query: 611 RL-IDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQ 669
            L +  + +   +EK          +  L +   +IL G NE      + ++P L+ + +
Sbjct: 529 SLELYSQILTLFLEKEFFSVASDLNKFSLYHNKVVILAGFNEA----PSFQSPLLNALTR 584

Query: 670 SDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFD 729
              NL +A++  G   +          +  TRSL     P +    LQRL +L       
Sbjct: 585 EKFNLPSAQEEQGYFFYTLHNLFCASKVYITRSLSHRK-PML----LQRLEIL------- 632

Query: 730 NLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP---RTYSFSEIKQLINDPYAVY 786
            L+     Y DW R L+         +P P P  E +    +  S S I++LI +PY+ Y
Sbjct: 633 -LQGSKYPYRDWLRILNTPECTVPCTQPMPKPQTEVRKEKMQVMSCSAIEKLIRNPYSFY 691

Query: 787 ARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKE 846
              IL L  +      P   + GT+ HNI+   ++   NK +P ++   +    S F   
Sbjct: 692 VEYILGLKQLRDLNFKPSILEFGTMVHNILARYLR---NKKSP-MSIAREAFSTSQFNFS 747

Query: 847 NLPPHIDIIWRHLFHKISHSFLEHEE------KIQSSIEKIFVNIPAK------------ 888
           N+       W     KI  SF+E +E      +++ S      +IPA+            
Sbjct: 748 NM-------WWVRLQKIIQSFVEFDETRSNYVELEKSFSCPIFHIPARDTGSCDQYETAW 800

Query: 889 MAIESI---GIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALK 945
           M    +    I LT   DR++ L SG V I DYK G  P  E       PQL L+A A++
Sbjct: 801 MTDRDLIPQEILLTARCDRVEYLPSGQVAIIDYKLGTPPSNEEVMSGFFPQLILQALAVE 860

Query: 946 AGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADEL 986
                 I  R+V+ L Y +L    KI  I+    +Y   EL
Sbjct: 861 -----HITKREVSELAYWKLDYD-KIKVISIQNYRYKMQEL 895


>gi|218459328|ref|ZP_03499419.1| hypothetical protein RetlK5_07500 [Rhizobium etli Kim 5]
          Length = 189

 Score =  120 bits (300), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 76/190 (40%), Positives = 111/190 (58%), Gaps = 8/190 (4%)

Query: 245 LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
           L++ VA+   G IVLPGLD  +P   W  +  +       N    +HPQY L+ LL  L 
Sbjct: 2   LIAAVAHLSEGVIVLPGLDLAMPEGHWQMVAPEPAPGQHLNPASRSHPQYGLSSLLKRLR 61

Query: 305 IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPN--IQKCFSDVALI 362
           + R DV  L     ++  R+ ++S++  P + +    T   ++++P   +   F+DV+LI
Sbjct: 62  LTRADVSILDRPEADLDRRAEILSRALAPAEATSDWGT--WKSELPGGALTSAFNDVSLI 119

Query: 363 EADNEREEAISIAIALRMSLD----ENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
           EA NEREEA +IA+ALR++L+    + + ++ALIT DRNLARRV  EL+RFGI  D S G
Sbjct: 120 EAANEREEATAIAVALRLALERPGQDGESRAALITPDRNLARRVMAELSRFGILADDSGG 179

Query: 419 IPLSTTLHSS 428
            PLS T   S
Sbjct: 180 TPLSATPQGS 189


>gi|296534678|ref|ZP_06897076.1| double-strand break repair protein AddB [Roseomonas cervicalis ATCC
           49957]
 gi|296264995|gb|EFH11222.1| double-strand break repair protein AddB [Roseomonas cervicalis ATCC
           49957]
          Length = 366

 Score =  112 bits (281), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 128/260 (49%), Gaps = 14/260 (5%)

Query: 574 NLWFEEEGKTLSSLFSKIIET-GSCIKANAIEWIDIITRLIDGETVKPKIE--------K 624
            L+  EEG+ L+   S +          +   W  +   L++G    P +         +
Sbjct: 85  RLYAGEEGEPLAVFLSTLPPALRELPPMSPASWPALFDVLLEGPAA-PGVRIGRGREYAQ 143

Query: 625 SSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQA 684
              + ILG LE+RL +FD  +LG L EGVWP++T   P++SR M+ D  L   E  IG+ 
Sbjct: 144 HPRIAILGLLEARLQDFDLAVLGSLEEGVWPQSTDPGPWMSRPMRGDFGLPEPEARIGRV 203

Query: 685 AHDFEMANGTR-HLIYTRSLRENNIPTIASRWLQRL-LVLGGTDFFDNLKKRGQCYLDWT 742
           A DF +A  +   ++  R+ +    PT+ SRWL RL   LGG      L +  +  LDW 
Sbjct: 204 AADFMLAAASAPRVVLARARKRAGAPTVPSRWLTRLETFLGGQAPGLGLPR--ERALDWA 261

Query: 743 RKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKD 802
            +LD       + RP P PP E +PR  S +E+  L+ DPY  YARR+L+L  +     +
Sbjct: 262 SRLDMPEVVKPWPRPAPAPPPEDRPREISVTEVADLMADPYGFYARRVLRLLPLEPLDAE 321

Query: 803 PDRTDRGTLFHNIITELIKK 822
              +D G + H ++ +  ++
Sbjct: 322 VGASDYGQIVHQVMADWTRR 341


>gi|58584530|ref|YP_198103.1| RecB exonuclease [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418846|gb|AAW70861.1| RecB exonuclease [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 888

 Score =  112 bits (279), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 221/1004 (22%), Positives = 395/1004 (39%), Gaps = 174/1004 (17%)

Query: 51   VPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLL 110
            +P +  +  + S F     KK  ILP I SL ++ E+    DL+L+ +    +   +R+L
Sbjct: 37   LPCRSDVIAMLSAFKNYDSKKCIILPEIVSLENIDEK----DLILNLDRIKFIKPTKRIL 92

Query: 111  ELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLH 170
             L + IL W  K  D             PI  A ++    +L D +  I+  +    + H
Sbjct: 93   LLIQFILEWNKKNNDY-----------FPIDLAYSL---PSLLDKVQCIQITDDYQLNDH 138

Query: 171  ALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPI 230
            + K E          +F+ +  + W++ L  L     + Y+   +      L +     I
Sbjct: 139  SKKME----------NFINLLVEAWSKTLKNLGVMDILKYKSDYINNMVISLQEDQH--I 186

Query: 231  IIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYST 290
            I  G  G       L+  +   P G I+LP L+  I    W ++ ++             
Sbjct: 187  IFVG-IGKGEIYKLLIKAIYELPFGKIILPNLNLKIKEKDWKSLDKR------------- 232

Query: 291  HPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSD-MRNTDILENKI 349
            H QY L  LLD+L + RED+  L       +G  +   ++ +  +  D + +T    +K+
Sbjct: 233  HYQYCLKNLLDYLSVSREDISFLPEALPPAHGARICDQRTGMTAEYLDYIFDTTADLSKV 292

Query: 350  PNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRF 409
             N      ++ +I  D+  EE+  +++ +    +E  +  +L+  D+ LA R        
Sbjct: 293  SN--GYIENIEVITCDSREEESQVMSLIIE---NEGYENVSLVVFDKLLAAR-------- 339

Query: 410  GINIDISAGIPLSTTLHSSI--LTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRA 467
             I    S   P  T L  SI  LTS  N++       A+ +L+KH L  FG+ ++  S+ 
Sbjct: 340  -ITCSASENYPYVTLLLYSIEVLTSNWNSV-------ALLSLLKHRLVTFGYAQEEYSKI 391

Query: 468  KNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHI 527
             +  E+  LR    S          LD I    N     H + R  E+     +++++ +
Sbjct: 392  LSEFEIEILRSFNTS---------GLDDIVKVIN----IHKKLRYKED----ILIIINKL 434

Query: 528  LQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSL 587
               + PL+      NST  N  ISD     + C+  +   +  +L N     E    +  
Sbjct: 435  ETILNPLL------NST--NCPISDVVTAHLRCVSILSSVDFLELSN-----EMGNFTHD 481

Query: 588  FSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
            F    E G  I+ +   +  I+T  +  E           L +    +  L +   +IL 
Sbjct: 482  FLNACE-GVAIECSLELYSQILTLFLRKEFF---------LAVSDLSKFSLYHNKVVILA 531

Query: 648  GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRE 705
            G N+      + ++PFL+ + +   +L +  +  G   ++          ++I   S R+
Sbjct: 532  GFND----IPSFQSPFLNALTRKRFSLPSVREEQGYFLYNLRNLFCASKVYIINLLSNRK 587

Query: 706  NNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRP--KPFPPL 763
              +       LQ               K    Y DW R L+     P Y  P  +P P  
Sbjct: 588  TILLRRLEILLQ---------------KSKYPYRDWLRVLN----MPEYVTPCIQPMPKP 628

Query: 764  EAQPR-----TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITE 818
            + + R         S +++LI DPY+ Y   +L L  +      P   + G + H+I+  
Sbjct: 629  QTKIREEKMQVMPCSAVEKLIRDPYSFYIEYVLNLKQLKDLNFKPSILEFGNMVHSILER 688

Query: 819  LIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSI 878
             ++   N+ +P ++   +    S F   N+       W      I  SF+E ++   + +
Sbjct: 689  YLR---NRKSP-MSIAQEVFSTSRFNFSNM-------WWVRLQGIIQSFVEFDKARSNRV 737

Query: 879  E--KIFV------NIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQ 930
            E  K F       N+ A   ++ +   LT   DR++ L +G   I DYK G  P  E   
Sbjct: 738  ELEKSFSYRVPVHNVKATWKLQEVS--LTARCDRVEYLPNGQAVIIDYKLGSPPSNEEVM 795

Query: 931  KLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLK-QKFKIDCITNDKKKYSADELSEK 989
                PQL L+A A++  +      ++V+ L Y +L   K K+  + N ++K       ++
Sbjct: 796  SGFFPQLILQALAVEYTT-----GKEVSELAYWKLDYDKIKVISLKNYRQK------VQE 844

Query: 990  SLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
               +L + ++       PFI+     +     S Y  L R+ EW
Sbjct: 845  FQSDLPDFLSNYLKNTTPFIASPYFDKFLRFNS-YKQLERIGEW 887


>gi|58617000|ref|YP_196199.1| hypothetical protein ERGA_CDS_02730 [Ehrlichia ruminantium str.
            Gardel]
 gi|58416612|emb|CAI27725.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 913

 Score =  108 bits (269), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 188/861 (21%), Positives = 340/861 (39%), Gaps = 116/861 (13%)

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
            A +FL   SK WTE L + N    + ++   +     +L +G+    II           
Sbjct: 153  AVEFLSCFSKKWTEILQQENVLDILEHRSLYINTLIRYLEEGSSNSTIIFAGMAFNTLII 212

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
              + T+   PN  I+LP +D  I    W  + E             +H QY +  LLD L
Sbjct: 213  DFVRTLYKLPNTQIILPYVDVGIDEKNWKLLEE-------------SHYQYCVKNLLDVL 259

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD--VAL 361
             I R DV  LG  +N ++  S+     FL             E     IQ C S   V +
Sbjct: 260  KIGRNDVVFLGKQNNRVFIDSIFNFDLFLE------------EYHKGRIQICDSCDYVQV 307

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVK--LELTRFGINIDISAGI 419
            I   ++ EE+  I+  ++       K  A+ T +  L++RV   + L      +DI+  I
Sbjct: 308  ITCMSDEEESHVISALMK---KYKSKDVAVFTNNVLLSKRVDSIVNLENLPHELDINYLI 364

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
                    S ++++L  +    + +++ +L+KHP    G+ E   S   +  EL  +R  
Sbjct: 365  L-------SFVSNVLEVVVSFWNPISLLSLLKHPFINLGYSEDEYSTLISNFELKVIRL- 416

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
             +SYD + +   V +++        +  W+                 I   + PLV  K 
Sbjct: 417  YSSYDFVSIDGNVREKVPDL-----IHFWEK----------------ITSIVLPLVDVK- 454

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK 599
                   + +IS   K  + CL+ +            F  E   +   F       + I+
Sbjct: 455  -------HCTISSIVKAHIVCLRGLLTGSTV------FSYE--KIEGFFDNFQSACANIR 499

Query: 600  ANAIE-WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNT 658
             + I+ + +I+  ++           SS           L   + +I  G NE  +    
Sbjct: 500  MSGIDIYYEILISVLHNNLFVENYRLSSV---------NLYKREVVIFSGFNELNYGTG- 549

Query: 659  AKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQR 718
              +  L+  M+S L L + ++  G  A+       +  +  TRSL+        S W+++
Sbjct: 550  LHSTLLNNRMRSKLGLPSIQREKGYFAYMLYSFFYSDKIYITRSLKSFGKVNEESIWIKK 609

Query: 719  LLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY---SFSEI 775
            + ++     + NL++    YL        +     Y RP+P P +  +   +   S + +
Sbjct: 610  IKIMAKIYNYKNLERED--YLRSENGCTNSVTNLCYLRPQPNPEINHRVMAFNILSTTAV 667

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            + L+ +PY  Y   IL +       +     D G + HN++ + +     KN  +   L+
Sbjct: 668  EILVKNPYVFYLNNILNILPYKDINEKFSMRDFGIIVHNVLHKYLVTP--KNQQDYERLI 725

Query: 836  KQIIDSHF--EKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIES 893
            K I +S F  + +N P    I+W   F +I+  F E      S+I+KI         I +
Sbjct: 726  K-IAESEFLNKYKNFPQVETILWPK-FQQIAEQFFEMNLNRNSNIDKIITEHFFSWEINN 783

Query: 894  IGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
              + +    DR++ LK   + I DYKTG  P +    + I  Q+ ++A  +K        
Sbjct: 784  -NVKIISKCDRVECLKDNSIAIIDYKTGVIPSQLDISRGIALQMIIQALTVKKSL----- 837

Query: 954  CRKVANLFYIRL-KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHL 1012
             + +++L Y ++  +  K+  I N       +E+ EK+   L E++       +PFI+  
Sbjct: 838  KKNISDLMYWKIGAEDIKVVSIDN------YEEIMEKTEIALKELILEYLVNRKPFIASH 891

Query: 1013 RLSEKSNIQSEYDHLARVAEW 1033
             ++   +    YD L R+ EW
Sbjct: 892  DIAGFGS----YDLLIRLKEW 908


>gi|57239004|ref|YP_180140.1| hypothetical protein Erum2730 [Ehrlichia ruminantium str.
            Welgevonden]
 gi|58578942|ref|YP_197154.1| hypothetical protein ERWE_CDS_02780 [Ehrlichia ruminantium str.
            Welgevonden]
 gi|57161083|emb|CAH57990.1| hypothetical protein Erum2730 [Ehrlichia ruminantium str.
            Welgevonden]
 gi|58417568|emb|CAI26772.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
            Welgevonden]
          Length = 912

 Score =  106 bits (265), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 187/861 (21%), Positives = 341/861 (39%), Gaps = 116/861 (13%)

Query: 184  AADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATA 243
            A  FL   SK WTE L + N    + ++   +     +L +G+    II           
Sbjct: 152  AVKFLSCFSKKWTEILQQENVLDILEHRSLYINTLIRYLEEGSSNSTIIFAGMAFNTLII 211

Query: 244  RLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFL 303
              + T+   PN  I+LP +D  I    W  + E             +H QY +  LLD L
Sbjct: 212  DFVRTLYKLPNTQIILPYVDVSIDEKNWKLLEE-------------SHYQYCVKNLLDVL 258

Query: 304  DIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD--VAL 361
             I R DV  LG  +N ++  S+     FL             E     IQ C S   V +
Sbjct: 259  KIGRNDVVFLGKQNNRVFIDSIFNFDLFLE------------EYHKGRIQICDSCDYVQV 306

Query: 362  IEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVK--LELTRFGINIDISAGI 419
            I   ++ EE+  I+  ++       K  A+ T +  L++RV   + L      +D++  I
Sbjct: 307  ITCMSDEEESHVISALMK---KYKSKDVAVFTNNVLLSKRVDSIVNLENIPHELDVNYLI 363

Query: 420  PLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN 479
                    S ++++L  +    + +++ +L+KHP    G+ E   S   +  EL  +R  
Sbjct: 364  L-------SFVSNVLEVVISSWNPISLLSLLKHPFINLGYSEDEYSTLISNFELKVIRL- 415

Query: 480  KNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKT 539
             +SYD + +   V +++        +  W+                 I   + PLV  K 
Sbjct: 416  YSSYDFVSIDGNVREKVPDL-----IHFWEK----------------ITSIVLPLVDVK- 453

Query: 540  NKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIK 599
                   + +IS   K  + CL+++            F  E   +   F       + I+
Sbjct: 454  -------HCTISSIVKAHIVCLRDLLTGSTV------FSYE--KIEGFFDNFQSACANIR 498

Query: 600  ANAIE-WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNT 658
             + I+ + +I+  ++           SS           L   + +I  G NE  +    
Sbjct: 499  MSGIDIYYEILISVLHNNLFVENYRLSSV---------NLYKREVVIFSGFNELNYGTG- 548

Query: 659  AKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQR 718
              +  L+  M+S L L + ++  G  A+       +  +  TRSL+        S W+++
Sbjct: 549  LHSTLLNNRMRSKLGLPSIQREKGYFAYMLYSFFYSDKIYITRSLKSFGKVNEESIWIKK 608

Query: 719  LLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY---SFSEI 775
            + ++     + NL++    YL   +    +     Y RP+P P +  +   +   S + +
Sbjct: 609  IKIMAKIYNYKNLERED--YLRSEKGCTNSVTNLCYLRPQPNPEINHRVMAFNILSTTAV 666

Query: 776  KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
            + L+ +PY  Y   IL +       +     D G + HN++ + +     KN  +   L+
Sbjct: 667  EILVKNPYVFYLNNILNILPYKDINEKFSMRDFGIIVHNVLHKYLVTP--KNQQDYERLI 724

Query: 836  KQIIDSHF--EKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIES 893
            K I +S F  + +N P    I+W   F +I+  F E      S+I+KI         I +
Sbjct: 725  K-IAESEFLNKYKNFPQVETILWPK-FQQIAEQFFEMNLNRNSNIDKIITEHFFSWEINN 782

Query: 894  IGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
              + +    DR++ LK   + I DYKTG  P +    + I  Q+ ++A  +K        
Sbjct: 783  -NVKIISKCDRVECLKDNSIAIIDYKTGVIPSQVDISRGIALQMIIQALTVKKSL----- 836

Query: 954  CRKVANLFYIRL-KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHL 1012
             + +++L Y ++  +  K+  I N       +E+ EK+   L E++       +PFI+  
Sbjct: 837  KKNISDLMYWKIGAEDIKVVSIDN------YEEIMEKTEIALKELILEYLVNRKPFIASH 890

Query: 1013 RLSEKSNIQSEYDHLARVAEW 1033
             ++   +    YD L R+ EW
Sbjct: 891  DIAGFGS----YDLLIRLKEW 907


>gi|73666892|ref|YP_302908.1| hypothetical protein Ecaj_0263 [Ehrlichia canis str. Jake]
 gi|72394033|gb|AAZ68310.1| conserved hypothetical protein [Ehrlichia canis str. Jake]
          Length = 911

 Score =  105 bits (261), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 229/1044 (21%), Positives = 412/1044 (39%), Gaps = 158/1044 (15%)

Query: 8    VFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQ----ELRSE 63
            VF++ P+  F           T+V  F +D  N    ++V I VP +  ++    EL+  
Sbjct: 4    VFSVYPAESFL----------TVVAKFVFDVFNDTF-SNVIIIVPNQEDVELLCNELKLY 52

Query: 64   FIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV-SNIQRLLELARLILIWRNK 122
            F +    K  I+    SL D+       DLL+  + +  + S I++LL L   I +W ++
Sbjct: 53   FSDTVFGKIKIM----SLADI-----DQDLLVGNHGSIKIMSPIRKLLLLMEFIKLWNSE 103

Query: 123  LPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWL 182
              +       + PL++          +  LA +++ I     +  +L  L +    +   
Sbjct: 104  NDE-------DYPLTM----------SYELATLLNEINVHCIELSNLENLFDCDLPVHCQ 146

Query: 183  LAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPAT 242
              A FL   SK W E L E      + ++   + +  E+L K +    +I          
Sbjct: 147  KTAKFLFRLSKKWREVLKEEGVLDILEHRSLYINSLIEYLEKESLNSTVIFAGMAFDEFF 206

Query: 243  ARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDF 302
               +  +    N  I+LP +D  I  + W  + E              H QY +  +LD 
Sbjct: 207  INFIQALYKLSNTKIILPYVDMTICQSEWELLDE-------------CHYQYCIKNVLDV 253

Query: 303  LDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALI 362
            L I R+D+  LG+ S+ ++  S+     FL              N+I N    ++ V LI
Sbjct: 254  LMINRDDIIFLGSPSSSIFVNSVFNFNLFLEAYH---------RNEIQNYDD-YNRVKLI 303

Query: 363  EADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLS 422
               ++ +EA  ++  ++   + +     + T +  L++R+   L    + +D S     S
Sbjct: 304  TCVSDEDEAQIVSTLVK---ENSCNDLTIFTNNLLLSKRINSILDSQNL-LDKSDN---S 356

Query: 423  TTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNS 482
              + S +L  L  AI   N  +++ +L+KHP     + ++      +  EL  +R     
Sbjct: 357  YLILSFVLYILEVAISNWNP-ISLLSLLKHPFVTLEYVKEDYEALVSDFELKVIR----C 411

Query: 483  YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKN 542
            Y   D  S+            HVP              +   + I   + PLV  +  K 
Sbjct: 412  YSSCDFASI------ESNIKEHVPD------------LLFFWEKITSIMLPLVNVRYEK- 452

Query: 543  STCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANA 602
                   IS   K  +TC+ N  L +   + +L    +   +   F+ +  + + IK   
Sbjct: 453  -------ISSIVKAHITCMNN--LLKGNTVVSL---NDSNKIEEFFNSLKNSCNGIKIYG 500

Query: 603  IE-WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKN 661
            I+ + +I+  ++         + S            L     +I  G NE  +  N+  N
Sbjct: 501  IDLYYEILLSILRSNFFSENYKLSCL---------NLSKKKVVIFAGFNEINYGVNSF-N 550

Query: 662  PFLSRVMQSDLNLKTAEK---YIGQAAHDFEMANGTRHLIY-TRSLRENNIPTIASRWLQ 717
              L+  +++ L L + +K   Y     H F  A+     IY T+SL+        S W++
Sbjct: 551  TLLNGWIRAKLGLPSIQKERGYFAYLLHSFFYADK----IYITQSLKSFGKINEESVWVR 606

Query: 718  RLLVLGGTDFFDNLKK----RGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--- 770
            RL +LG     ++LK     R Q      + L    K   Y RP P P L+ +   +   
Sbjct: 607  RLKILGELYDIEDLKCAMHLRTQ-----DKSLFDDVKNLVYLRPNPNPELDKRLGAFNIL 661

Query: 771  SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
            S + ++ L+ +PY  Y   IL +       +     D G + HNI+ + +    NK+  +
Sbjct: 662  SSTALETLVKNPYVFYLSSILNILPCRGINEKFSMRDFGIIVHNILHKYLLN--NKSKCQ 719

Query: 831  INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMA 890
               L++  +    +K    P ++ I    F KI+  F E   +    I++I         
Sbjct: 720  CKDLVEIAVSELLDKYKNFPQVETILWPKFQKIAEQFFEMNLERDHYIDEIMTERFFSWK 779

Query: 891  IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFS 950
            I S  I +    DR++ L+ G V I DYKTG  P +      I  Q+ ++A  +K     
Sbjct: 780  INS-NIKVVSKCDRVECLRDGSVVIIDYKTGMIPSQSDINYGISLQMIIQALTVK----- 833

Query: 951  QIDCRKVANLFYIRL-KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
            Q   + ++ L Y ++  +  KI  I N  +     E+  + L  ++  VT +    +PF 
Sbjct: 834  QSLKKDISGLMYWKMSSEDMKIISIDNYVELMKQLEIDLEQL--ILNYVTFM----KPFT 887

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEW 1033
            +   +S      ++YD L R+ EW
Sbjct: 888  ASCDMSR----YTDYDLLTRIKEW 907


>gi|88657793|ref|YP_507616.1| hypothetical protein ECH_0820 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599250|gb|ABD44719.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 914

 Score =  104 bits (259), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 191/870 (21%), Positives = 345/870 (39%), Gaps = 130/870 (14%)

Query: 184  AADFLKIASKYWTERL-------VELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGST 236
            AA FL   SK W E L       +  + S  +G  I  ++ E           +I AG  
Sbjct: 151  AARFLSELSKKWKEVLNKDEVLDILEHRSLYIGNLIKYLQDEV------LNCTVIFAGMV 204

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSL 296
                     +  +   PN  I+ P +D  I    W  + E              H QY +
Sbjct: 205  FD-NFFVNFIQELYKLPNSRIIFPYVDISIDEKDWQLLEE-------------CHYQYYV 250

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
              LLD L + R D+  LG  ++ ++  S+     FL             +++I N    +
Sbjct: 251  KSLLDILKVNRNDIVFLGEPNHSVFVSSVFNFNLFLEKYH---------QHEIQNYSD-Y 300

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALI-TADRNLARRVKLELTRFGINIDI 415
            S V LI   ++ EEA  +++ ++    EN   S ++ T +  L +R+   +    +    
Sbjct: 301  SRVKLITCISDEEEAQVVSMLIK----ENVNSSPIVFTNNLLLTKRINSIVNAERLLDKP 356

Query: 416  SAG-IPLSTTLHS-SILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALEL 473
            + G + LS  LH+  ++ S  N I        + +L+KHP    G+ ++      ++ EL
Sbjct: 357  NVGYLILSFILHTLEVVMSKWNPI-------PLLSLLKHPFVTLGYVKEDYDALISSFEL 409

Query: 474  VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITP 533
              +R   + YD   +++ V +++        +P W+                 I   I P
Sbjct: 410  KVIRS-YSGYDFFSMENNVKEKVPDL-----LPFWEK----------------ITSVILP 447

Query: 534  LVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT-LSSLFSKII 592
            LV  K +         IS   K  + C+QN+         NL  +  G + +   F  + 
Sbjct: 448  LVKVKHD--------VISSIVKAHIVCIQNLLEG------NLVIDSNGYSKIQEFFDDLQ 493

Query: 593  ETGSCIKANAIE-WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
             + + IK   ++ + +I+T ++         + S+           L     +I  G NE
Sbjct: 494  NSCNGIKVYGMDVYYEILTSVLYSSFSLENYKLSTV---------NLFKRGIVIFAGFNE 544

Query: 652  GVWPKNTAKNPFLSRVMQSDLNLKTAEK---YIGQAAHDFEMANGTRHLIY-TRSLRENN 707
              +  N+     L+R +++ L L + ++   Y     H F  A+     IY T+SL+   
Sbjct: 545  INYGVNSC-GTLLNRWIRTKLGLPSIQREKGYFAYLLHSFFYADK----IYITQSLKSFG 599

Query: 708  IPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQP 767
                 S W++RL +L      +NLK      +      D  TK   Y RP+P P +  + 
Sbjct: 600  KINEESIWIRRLGILAKLYDIENLKCEIYSKISDRFSCD-DTKSLAYLRPQPNPDINNRV 658

Query: 768  RTY---SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRI 824
              +   S + ++ L+ +PY  Y   IL +       +     D G + HN++ + +    
Sbjct: 659  IAFNVLSTTSLETLVKNPYVFYLSNILNILPCKSINEKFSMRDFGIVVHNVLHKYL--LC 716

Query: 825  NKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
            N N      L++       +K    P ++ I    F KI+  F E   +    +++I   
Sbjct: 717  NNNQHRYEDLVEIAASELLDKYKDFPQVETILWPKFQKIAEQFFEINLERAHYVDEIITE 776

Query: 885  IPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAAL 944
                  I S  I +    DR++ LK G V I DYKTG  P +      +  Q+ ++A  +
Sbjct: 777  RFFSWEINS-NIEVISRCDRVECLKDGSVIIIDYKTGAIPSQSDINYGVALQMIIQALTV 835

Query: 945  KAGSFSQIDCRKVANLFYIRL-KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQN 1003
            K     Q   ++++ L Y ++  +  +I  I N  +     E++ K L  +++ V  +  
Sbjct: 836  K-----QSLKKEISGLMYWKISSEDMRIVPIDNYTELIKKLEVALKQL--ILDYVEFM-- 886

Query: 1004 GEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
              +PF +   +S+     ++YD + RV EW
Sbjct: 887  --KPFTASCDMSK----YADYDLITRVKEW 910


>gi|68171127|ref|ZP_00544536.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999452|gb|EAM86092.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 914

 Score =  103 bits (258), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 192/871 (22%), Positives = 344/871 (39%), Gaps = 132/871 (15%)

Query: 184  AADFLKIASKYWTERL-------VELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGST 236
            AA FL   SK W E L       +  + S  +G  I  ++ E           +I AG  
Sbjct: 151  AARFLSELSKKWKEVLNKDEVLDILEHRSLYIGNLIKYLQDEV------LNCTVIFAGMV 204

Query: 237  GSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSL 296
                     +  +   PN  I+ P +D  I    W  + E              H QY +
Sbjct: 205  FD-NFFVNFIQELYKLPNSRIIFPYVDISIDEKDWQLLEE-------------CHYQYYV 250

Query: 297  AKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCF 356
              LLD L + R D+  LG  ++ ++  S+     FL             +++I N    +
Sbjct: 251  KSLLDILKVNRNDIVFLGEPNHSVFVSSVFNFNLFLEKYH---------QHEIQNYSD-Y 300

Query: 357  SDVALIEADNEREEAISIAIALRMSLDENKKKSALI-TADRNLARRVK--LELTRFGINI 413
            S V LI   ++ EEA  +++ ++    EN   S ++ T +  L +R+   +   R     
Sbjct: 301  SRVKLITCISDEEEAQVVSMLIK----ENVNSSPIVFTNNLLLTKRINSIVNAERLLDKP 356

Query: 414  DISAGIPLSTTLHS-SILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALE 472
            ++   I LS  LH+  ++ S  N I        + +L+KHP    G+ ++      ++ E
Sbjct: 357  NVGYLI-LSFILHTLEVVMSKWNPI-------PLLSLLKHPFVTLGYVKEDYDALISSFE 408

Query: 473  LVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532
            L  +R   + YD   +++ V +++        +P W+                 I   I 
Sbjct: 409  LKVIRS-YSGYDFFSMENNVKEKVPDL-----LPFWEK----------------ITSVIL 446

Query: 533  PLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT-LSSLFSKI 591
            PLV  K +         IS   K  + C+QN+         NL  +  G + +   F  +
Sbjct: 447  PLVKVKHD--------VISSIVKAHIVCIQNLLEG------NLVIDSNGYSKIQEFFDDL 492

Query: 592  IETGSCIKANAIE-WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLN 650
              + + IK   ++ + +I+T ++         + S+           L     +I  G N
Sbjct: 493  QNSCNGIKVYGMDVYYEILTSVLYSSFSLENYKLSTV---------NLFKRGIVIFAGFN 543

Query: 651  EGVWPKNTAKNPFLSRVMQSDLNLKTAEK---YIGQAAHDFEMANGTRHLIY-TRSLREN 706
            E  +  N+     L+R +++ L L + ++   Y     H F  A+     IY T+SL+  
Sbjct: 544  EINYGVNSC-GTLLNRWIRTKLGLPSIQREKGYFAYLLHSFFYADK----IYITQSLKSF 598

Query: 707  NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ 766
                  S W++RL +L      +NLK      +      D  TK   Y RP+P P +  +
Sbjct: 599  GKINEESIWIRRLGILAKLYDIENLKCEIYSKISDRFSCD-DTKSLAYLRPQPNPDINNR 657

Query: 767  PRTY---SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKR 823
               +   S + ++ L+ +PY  Y   IL +       +     D G + HN++ + +   
Sbjct: 658  VIAFNVLSTTSLETLVKNPYVFYLSNILNILPCKSINEKFSMRDFGIVVHNVLHKYL--L 715

Query: 824  INKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFV 883
             N N      L++       +K    P ++ I    F KI+  F E   +    +++I  
Sbjct: 716  CNNNQHRYEDLVEIAASELLDKYKDFPQVETILWPKFQKIAEQFFEINLERAHYVDEIIT 775

Query: 884  NIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
                   I S  I +    DR++ LK G V I DYKTG  P +      +  Q+ ++A  
Sbjct: 776  ERFFSWEINS-NIEVISRCDRVECLKDGSVIIIDYKTGAIPSQSDINYGVALQMIIQALT 834

Query: 944  LKAGSFSQIDCRKVANLFYIRL-KQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQ 1002
            +K     Q   ++++ L Y ++  +  +I  I N  +     E++ K L  +++ V  + 
Sbjct: 835  VK-----QSLKKEISGLMYWKISSEDMRIVPIDNYTELIKKLEVALKQL--ILDYVEFM- 886

Query: 1003 NGEQPFISHLRLSEKSNIQSEYDHLARVAEW 1033
               +PF +   +S      ++YD + RV EW
Sbjct: 887  ---KPFTASCDMSR----YADYDLITRVKEW 910


>gi|213019082|ref|ZP_03334889.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
            quinquefasciatus JHB]
 gi|212995191|gb|EEB55832.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
            quinquefasciatus JHB]
          Length = 936

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 239/1068 (22%), Positives = 413/1068 (38%), Gaps = 244/1068 (22%)

Query: 44   LASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV 103
            +  + I +P KR +  L S F      ++ ILP I SL ++ EE    DL+L+ +    +
Sbjct: 34   IPEIKIILPCKRDVIALLSAF---KNYRTIILPEIVSLENIDEE----DLILNLDRVKVI 86

Query: 104  SNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE 163
            +  +R L L + IL W  K  D           + PI       L  +L  ++   + E 
Sbjct: 87   NPTKRTLLLIQFILEWNKKNND-----------NFPID------LVYSLPSLLQYTQIEG 129

Query: 164  KKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM 223
                D H+ K           A+F+ +  K W++ L  L     + ++   +      L 
Sbjct: 130  DYQLDEHSKK----------VANFINLLIKTWSKTLKGLGVIDILKHKNDYINNMINFLQ 179

Query: 224  KGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS 283
            K  +  I I    G I     L+  + + P G I+LP L+  +    W ++ +K      
Sbjct: 180  KD-QHMIFIGIGKGEI--YKLLIKAIYDLPFGKIILPNLNLKMNEKDWKSLDKK------ 230

Query: 284  SNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNV--------SNEMYGRSMVISKS----- 330
                   H Q+ L  LLD+L + R DV  L           S  M      I+ S     
Sbjct: 231  -------HYQHCLKDLLDYLKVDRRDVSFLSEACSGVIPVSSTGMTEERAGITGSPEEYL 283

Query: 331  -FLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKS 389
             ++   T+D+  +++    I NI+       +I  D+  EEA   ++ ++   +E  + +
Sbjct: 284  DYIFDTTADL--SEVGGGSIENIE-------VITCDSREEEAQVTSLIIK---NEGYENA 331

Query: 390  ALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLN---DFMAI 446
            +L   D+ LA R+   ++                  + S +T LL +I  LN   + +A+
Sbjct: 332  SLFVFDKLLADRMACTISE-----------------NYSYVTLLLYSIEILNSKWNGVAL 374

Query: 447  ATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVP 506
             +L+KH L  FG+ ++  +R  +  E+  LR    S++   LK  +++ I T K   H  
Sbjct: 375  LSLLKHRLVTFGYAQEEYTRILSEFEIEVLR----SFNTNGLKD-IINAINTCKKLRH-- 427

Query: 507  HWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL 566
                   +ED  + +  +  I   +  LV Y            I D     + C+ NV  
Sbjct: 428  -------KEDILIIISKLKIIFNPLLYLVNY-----------PIFDVASAHLQCV-NV-- 466

Query: 567  DEHRKLPNLWFEEEGKTLSSLFSKIIETGS--CIKANAIEWIDIITRLIDGETVKPK--I 622
                 L N+ F E    + +     +       IK +   +  I+   +  +   P+  +
Sbjct: 467  -----LSNINFLELNGEIGNFTRDFLNACEDVAIKCSLELYSQILILFLKRKFFSPENNL 521

Query: 623  EKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIG 682
            +K S           L +   ++L G N+   P    +NPFLS + +   NL + ++  G
Sbjct: 522  DKFS-----------LYHNKVVVLAGFND--IP--NFQNPFLSALNREKFNLPSVQEEQG 566

Query: 683  QAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWT 742
               +      G   +  TR + +       S  L+RL VL        L++    Y +W 
Sbjct: 567  YFLYTLRNLFGAGKVYITRLVSDR-----KSILLRRLEVL--------LQEPKYPYRNWL 613

Query: 743  RKLDYTTKQPHYKRPKPFPPLE---AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHF 799
            R L+         +P P P  E   A+ +  S S +++LI +PY+ Y   IL L  +   
Sbjct: 614  RILNTPECIVPCTQPMPKPKTEVRQAKMQVMSCSAVEKLIRNPYSFYVEYILNLRQLKDL 673

Query: 800  KKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHL 859
               P   + GT+ HNI+      R  +N   + ++ ++I  S+        H   +W   
Sbjct: 674  NFKPSILEFGTMVHNILA-----RYLRNEKSLMNIAREIFSSN------RFHFSNMWWVR 722

Query: 860  FHKISHSFLEHEE--KIQSSIEKIF----VNIPAK---------MAIESIG--------- 895
              +I  SF+E +     Q  +EK F     +IPA+          + ++ G         
Sbjct: 723  LQRIIQSFVELDRTGNNQVELEKSFSYPIFHIPARDTQLRGCCTTSTKNKGVIPVLDYLD 782

Query: 896  --------------------------IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETA 929
                                      I LT   DR++ L  G V I DYK G  P  E  
Sbjct: 783  PKNLIANEHTRQLCNKSWSDTRMTEEILLTARCDRVEYLPGGQVAIIDYKLGSPPSNEEV 842

Query: 930  QKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLK-QKFKIDCITNDKKK-YSADELS 987
                 PQL L+A A++  +      ++V+ L Y +L   K K+  + + ++K +    + 
Sbjct: 843  MSGFFPQLILQALAVEYTT-----KKEVSELAYWKLDYDKIKVIALKDYRQKMHEFQNIL 897

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSE--KSNIQSEYDHLARVAEW 1033
               L N +   T       PFI+     +  + NI   Y  L R+ EW
Sbjct: 898  PDFLSNYLRDTT-------PFIASPYFDKFLRFNI---YKQLERIGEW 935


>gi|190570669|ref|YP_001975027.1| hypothetical protein WPa_0219 [Wolbachia endosymbiont of Culex
            quinquefasciatus Pel]
 gi|190356941|emb|CAQ54327.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
            quinquefasciatus Pel]
          Length = 932

 Score =  102 bits (255), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 239/1068 (22%), Positives = 413/1068 (38%), Gaps = 244/1068 (22%)

Query: 44   LASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPV 103
            +  + I +P KR +  L S F      ++ ILP I SL ++ EE    DL+L+ +    +
Sbjct: 30   IPEIKIILPCKRDVIALLSAF---KNYRTIILPEIVSLENIDEE----DLILNLDRVKVI 82

Query: 104  SNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE 163
            +  +R L L + IL W  K  D           + PI       L  +L  ++   + E 
Sbjct: 83   NPTKRTLLLIQFILEWNKKNND-----------NFPID------LVYSLPSLLQYTQIEG 125

Query: 164  KKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLM 223
                D H+ K           A+F+ +  K W++ L  L     + ++   +      L 
Sbjct: 126  DYQLDEHSKK----------VANFINLLIKTWSKTLKGLGVIDILKHKNDYINNMINFLQ 175

Query: 224  KGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITS 283
            K  +  I I    G I     L+  + + P G I+LP L+  +    W ++ +K      
Sbjct: 176  KD-QHMIFIGIGKGEI--YKLLIKAIYDLPFGKIILPNLNLKMNEKDWKSLDKK------ 226

Query: 284  SNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNV--------SNEMYGRSMVISKS----- 330
                   H Q+ L  LLD+L + R DV  L           S  M      I+ S     
Sbjct: 227  -------HYQHCLKDLLDYLKVDRRDVSFLSEACSGVIPVSSTGMTEERAGITGSPEEYL 279

Query: 331  -FLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKS 389
             ++   T+D+  +++    I NI+       +I  D+  EEA   ++ ++   +E  + +
Sbjct: 280  DYIFDTTADL--SEVGGGSIENIE-------VITCDSREEEAQVTSLIIK---NEGYENA 327

Query: 390  ALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLN---DFMAI 446
            +L   D+ LA R+   ++                  + S +T LL +I  LN   + +A+
Sbjct: 328  SLFVFDKLLADRMACTISE-----------------NYSYVTLLLYSIEILNSKWNGVAL 370

Query: 447  ATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVP 506
             +L+KH L  FG+ ++  +R  +  E+  LR    S++   LK  +++ I T K   H  
Sbjct: 371  LSLLKHRLVTFGYAQEEYTRILSEFEIEVLR----SFNTNGLKD-IINAINTCKKLRH-- 423

Query: 507  HWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCL 566
                   +ED  + +  +  I   +  LV Y            I D     + C+ NV  
Sbjct: 424  -------KEDILIIISKLKIIFNPLLYLVNY-----------PIFDVASAHLQCV-NV-- 462

Query: 567  DEHRKLPNLWFEEEGKTLSSLFSKIIETGS--CIKANAIEWIDIITRLIDGETVKPK--I 622
                 L N+ F E    + +     +       IK +   +  I+   +  +   P+  +
Sbjct: 463  -----LSNINFLELNGEIGNFTRDFLNACEDVAIKCSLELYSQILILFLKRKFFSPENNL 517

Query: 623  EKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIG 682
            +K S           L +   ++L G N+   P    +NPFLS + +   NL + ++  G
Sbjct: 518  DKFS-----------LYHNKVVVLAGFND--IP--NFQNPFLSALNREKFNLPSVQEEQG 562

Query: 683  QAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWT 742
               +      G   +  TR + +       S  L+RL VL        L++    Y +W 
Sbjct: 563  YFLYTLRNLFGAGKVYITRLVSDR-----KSILLRRLEVL--------LQEPKYPYRNWL 609

Query: 743  RKLDYTTKQPHYKRPKPFPPLE---AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHF 799
            R L+         +P P P  E   A+ +  S S +++LI +PY+ Y   IL L  +   
Sbjct: 610  RILNTPECIVPCTQPMPKPKTEVRQAKMQVMSCSAVEKLIRNPYSFYVEYILNLRQLKDL 669

Query: 800  KKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHL 859
               P   + GT+ HNI+      R  +N   + ++ ++I  S+        H   +W   
Sbjct: 670  NFKPSILEFGTMVHNILA-----RYLRNEKSLMNIAREIFSSN------RFHFSNMWWVR 718

Query: 860  FHKISHSFLEHEE--KIQSSIEKIF----VNIPAK---------MAIESIG--------- 895
              +I  SF+E +     Q  +EK F     +IPA+          + ++ G         
Sbjct: 719  LQRIIQSFVELDRTGNNQVELEKSFSYPIFHIPARDTQLRGCCTTSTKNKGVIPVLDYLD 778

Query: 896  --------------------------IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETA 929
                                      I LT   DR++ L  G V I DYK G  P  E  
Sbjct: 779  PKNLIANEHTRQLCNKSWSDTRMTEEILLTARCDRVEYLPGGQVAIIDYKLGSPPSNEEV 838

Query: 930  QKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLK-QKFKIDCITNDKKK-YSADELS 987
                 PQL L+A A++  +      ++V+ L Y +L   K K+  + + ++K +    + 
Sbjct: 839  MSGFFPQLILQALAVEYTT-----KKEVSELAYWKLDYDKIKVIALKDYRQKMHEFQNIL 893

Query: 988  EKSLKNLIEIVTLLQNGEQPFISHLRLSE--KSNIQSEYDHLARVAEW 1033
               L N +   T       PFI+     +  + NI   Y  L R+ EW
Sbjct: 894  PDFLSNYLRDTT-------PFIASPYFDKFLRFNI---YKQLERIGEW 931


>gi|144899272|emb|CAM76136.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
            MSR-1]
          Length = 316

 Score = 99.4 bits (246), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 117/256 (45%), Gaps = 9/256 (3%)

Query: 779  INDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQI 838
            + DPY +YA+++LKL  +P    DP   D G+L H  + + +         +    +  +
Sbjct: 1    MRDPYGLYAKKVLKLKALPEIDADPGAADYGSLVHEAVEQFLLAYPQSLPDDAEAKLLAV 60

Query: 839  IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--I 896
             ++ F +    P +   W   F  ++     HE+K +  +  I   I   + +E      
Sbjct: 61   GEAVFAQALERPGVWAFWWPRFRAVARWLAAHEKKRRPELAAIHTEIKGALEMEGPAGPF 120

Query: 897  HLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRK 956
             L   ADR+D+LK G + + DYKTG  P  +       PQL LEAA  + G F  I    
Sbjct: 121  LLHARADRVDVLKDGTLALIDYKTGQPPSPKEVAAGYAPQLPLEAAIARFGGFDGIAPAA 180

Query: 957  VANLFYIRLKQKFKIDCITNDKKKYSAD--ELSEKSLKNLIEIVTLLQNGEQPFISHLRL 1014
            V+ + Y RLK   +      ++K   AD  +L++ +L+ L  ++    +   P+ +    
Sbjct: 181  VSQMLYWRLKGGAE----GGEEKSAGADPKQLTDDALEGLYGLIAAFDDANTPYEARPH- 235

Query: 1015 SEKSNIQSEYDHLARV 1030
             +++   S+Y HLARV
Sbjct: 236  PDRAPKYSDYLHLARV 251


>gi|91205399|ref|YP_537754.1| endonuclease [Rickettsia bellii RML369-C]
 gi|122425724|sp|Q1RIZ9|Y584_RICBR RecName: Full=Uncharacterized protein RBE_0584
 gi|91068943|gb|ABE04665.1| RecB family exonuclease [Rickettsia bellii RML369-C]
          Length = 832

 Score = 96.7 bits (239), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/385 (24%), Positives = 165/385 (42%), Gaps = 15/385 (3%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFIL 631
           LP++W +E G  LS   + + E    I  +  ++  I   L+        IE      I+
Sbjct: 373 LPDIWEKEGGAELSEFLNNLTEFSGSINVSKKDFPKIFALLLSNVKYYKNIESK---III 429

Query: 632 GTLESRLLN-FDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEM 690
           G+ E   L+ FD +IL   N   W   T  +P+LS+  +  LN+   E      ++ F++
Sbjct: 430 GSPEELALSRFDLVILPHFNSDNWSNTTTTHPYLSKEAKQILNIDYDEITPKLYSNYFDL 489

Query: 691 ANGTRHLIYTRSLR-ENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQ--CYLDWTRKLDY 747
                 +I   + +    + T  + +L+    L   +   N     Q  C +     LD 
Sbjct: 490 LLQNEEVIILNAKKYAGKLSTPCNLFLK----LSNKNVIPNKSVIPQLDCGISGVIFLDS 545

Query: 748 TTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTD 807
           TT                 P   S ++I+ LI +PY  YA++ILKL       ++P  +D
Sbjct: 546 TTSTQDDIEQAAHSTF--FPNILSVTDIETLIRNPYGFYAKKILKLRTQDKIWEEPKISD 603

Query: 808 RGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSF 867
            G   H ++ E  K    +N  +    +  I ++      LP +    W+     +S +F
Sbjct: 604 FGNFIHKVLEEYSKNYDQQNMLDQQQALLNIGNNILHSTILPTYTKKTWQTKLTLLSKAF 663

Query: 868 LEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPK 925
           +  + + + + +KI+  I  ++ +   G  I + G ADRI++ KS  + I DYKTG  P 
Sbjct: 664 ILFDMERRKNCQKIYFEIKGELNLNIAGQNIKIIGIADRIEISKSNCITILDYKTGTIPT 723

Query: 926 KETAQKLIDPQLSLEAAALKAGSFS 950
           K+  +  + PQL +E+  +    F+
Sbjct: 724 KKEIELGLSPQLIIESLMILENGFN 748


>gi|157827002|ref|YP_001496066.1| endonuclease [Rickettsia bellii OSU 85-389]
 gi|157802306|gb|ABV79029.1| RecB family exonuclease [Rickettsia bellii OSU 85-389]
          Length = 846

 Score = 95.9 bits (237), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 163/384 (42%), Gaps = 13/384 (3%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFIL 631
           LP++W +E G  LS   + + E    I  +  ++  I   L+        IE  S + I 
Sbjct: 387 LPDIWEKEGGAELSEFLNNLKEFSGSINVSKKDFPKIFALLLSNVKYYKNIE--SKIIIG 444

Query: 632 GTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMA 691
              E  L  FD +IL   N   W   T  +P+LS+  +  LN+   E      ++ F++ 
Sbjct: 445 SPEELALSRFDLVILPHFNSDNWSNTTTTHPYLSKEAKQILNIDYDEITPKLYSNYFDLL 504

Query: 692 NGTRHLIYTRSLR-ENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQ--CYLDWTRKLDYT 748
                +I   + +    + T  + +L+    L   +   N     Q  C +     LD T
Sbjct: 505 LQNEEVIILNAKKYAGKLSTPCNLFLK----LSNKNVIPNKSVIPQLDCGISGVIFLDST 560

Query: 749 TKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR 808
           T                 P   S ++I+ LI +PY  YA++ILKL       ++P  +D 
Sbjct: 561 TSTQDDIEQAAHSTF--FPNILSVTDIETLIRNPYGFYAKKILKLRTQDKIWEEPKISDF 618

Query: 809 GTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFL 868
           G   H ++ E  K    +N  +    +  I ++      LP +    W+     +S +F+
Sbjct: 619 GNFIHKVLEEYSKNYDQQNMLDQQQALLNIGNNILHSTILPTYTKKTWQTKLTLLSKAFI 678

Query: 869 EHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKK 926
             + + + + +KI+  I  ++ +   G  I + G ADRI++ KS  + I DYKTG  P K
Sbjct: 679 LFDMERRKNCQKIYFEIKGELNLNIAGQNIKIIGIADRIEISKSNCITILDYKTGTIPTK 738

Query: 927 ETAQKLIDPQLSLEAAALKAGSFS 950
           +  +  + PQL +E+  +    F+
Sbjct: 739 KEIELGLSPQLIIESLMILENGFN 762


>gi|218513540|ref|ZP_03510380.1| hypothetical protein Retl8_07371 [Rhizobium etli 8C-3]
          Length = 136

 Score = 94.4 bits (233), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 56/132 (42%), Positives = 80/132 (60%)

Query: 835 MKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESI 894
           M+ I+   F+ E LPPHID +WR  F +++ +FLE E   + +I +    +   + +E+I
Sbjct: 1   MELILTELFDMEKLPPHIDAVWRPRFREVARAFLEWEAGRRPAIRRTLTEVRGGVELETI 60

Query: 895 GIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDC 954
            I L G ADRID+      DI DYKTG NP    A+ L+DPQL+LEAAAL+AG+F     
Sbjct: 61  NIRLNGVADRIDITGPNAADIIDYKTGYNPSPAQARALLDPQLALEAAALRAGAFRDAGS 120

Query: 955 RKVANLFYIRLK 966
               +L Y+RL+
Sbjct: 121 LTPQDLLYVRLR 132


>gi|51473593|ref|YP_067350.1| hypothetical protein RT0391 [Rickettsia typhi str. Wilmington]
 gi|81390120|sp|Q68WX4|Y391_RICTY RecName: Full=Uncharacterized protein RT0391
 gi|51459905|gb|AAU03868.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 864

 Score = 92.8 bits (229), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 101/404 (25%), Positives = 176/404 (43%), Gaps = 27/404 (6%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIK-ANAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +EEG+ L    + +I     I   N  ++  I + L+    +K      S+  I
Sbjct: 372 LPTIWEKEEGEVLIEFLTNLISYSKHINLMNKKDFPKIFSFLLSN--IKHYKNTDSSSII 429

Query: 631 LGTLESRLL-NFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHD-F 688
           +G  E  +L  FD +IL   N   W  N   +P LS+     LN+   +        D F
Sbjct: 430 IGQPEDLVLCRFDLIILPHFNNEHWSPNAKPHPLLSKKALQILNIDYNDAITTMLYTDYF 489

Query: 689 EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYT 748
            +    + ++   + + N   + +     RL +     +FD      +     T  LD  
Sbjct: 490 NLLLQNKQIVILNAKKYNGKLSTSCNLFLRLQLKHVIPWFD-----PKLLTPATNSLDIK 544

Query: 749 TKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR 808
           ++  H    K      + P   S ++I+ LI +PY  YA++IL L    +  ++P  +D 
Sbjct: 545 SQDDH----KLTTISHSFPSVLSVTDIESLIRNPYGFYAKKILGLYKKDNIWEEPKISDF 600

Query: 809 GTLFHNIITELIKKRINKNTPEINHLMKQI----IDSHFEKEN-LPPHIDIIWRHLFHKI 863
           G   H ++ E   K  +K    +N L KQ     I +H      LP +   IW+      
Sbjct: 601 GNFIHKVL-EKYSKNYDKQYVCLNLLDKQAALINIGNHILYSTILPAYTKKIWQIKLTAF 659

Query: 864 SHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTG 921
           S +F+  + + + + ++I+  I  ++ +   G  I + G ADRI++ KS  + I DYKTG
Sbjct: 660 SKTFILFDIERRKNCKEIYFEIKGELRLNIAGQNIKIIGIADRIEVSKSNDITILDYKTG 719

Query: 922 DNPKKETAQKLIDPQLSLEAAAL-----KAGSFSQIDCRKVANL 960
             P K+  +  + PQL +E   L        SFS ++  +++N+
Sbjct: 720 TIPTKKEIEFGLSPQLIIECLMLLENGFNIKSFSNLETSQLSNI 763


>gi|165933138|ref|YP_001649927.1| ATP-dependent nuclease subunit B [Rickettsia rickettsii str. Iowa]
 gi|165908225|gb|ABY72521.1| ATP-dependent nuclease subunit B [Rickettsia rickettsii str. Iowa]
          Length = 838

 Score = 91.7 bits (226), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 170/400 (42%), Gaps = 40/400 (10%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+         + +S   I
Sbjct: 371 LPTIWEKEGGAELLEFLTNLTTYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAAS--II 428

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +   +P+LS+     LN+   E      +  F 
Sbjct: 429 IGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKKALQILNIDYDEIAPTLYSDYFN 488

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 489 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 537

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
                  T  +P Y +        + P T S +EI+ LI +PY  YA++IL L    H  
Sbjct: 538 -------TVVKPRYDKSIEIHS-PSFPTTLSVTEIETLIRNPYGFYAKKILGLRKKDHIW 589

Query: 801 KDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQI----IDSHFEKEN-LPPHIDII 855
           ++P  +D G L H ++ E   K  NK    +N L KQ     I +H      LP +    
Sbjct: 590 EEPKISDFGNLIHKVLEEY-SKNYNKQYINLNLLDKQNALINIGNHILYSTILPSYTKKT 648

Query: 856 WRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFV 913
           W+      S +F+  + + + + ++I+     ++ +  +G  I + G ADRI++ KS  +
Sbjct: 649 WQIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKIIGIADRIEISKSNNI 708

Query: 914 DITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            I DYKTG  P K+  +  + PQL +E+  L    F+Q +
Sbjct: 709 TILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTQCN 748


>gi|157828426|ref|YP_001494668.1| hypothetical protein A1G_03115 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800907|gb|ABV76160.1| hypothetical protein A1G_03115 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 838

 Score = 91.7 bits (226), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 170/400 (42%), Gaps = 40/400 (10%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+         + +S   I
Sbjct: 371 LPTIWEKEGGAELLEFLTNLTTYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAAS--II 428

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +   +P+LS+     LN+   E      +  F 
Sbjct: 429 IGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKKALQILNIDYDEIAPTLYSDYFN 488

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 489 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 537

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
                  T  +P Y +        + P T S +EI+ LI +PY  YA++IL L    H  
Sbjct: 538 -------TVVKPRYDKSIEIHN-PSFPTTLSVTEIETLIRNPYGFYAKKILGLRKKDHIW 589

Query: 801 KDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQI----IDSHFEKEN-LPPHIDII 855
           ++P  +D G L H ++ E   K  NK    +N L KQ     I +H      LP +    
Sbjct: 590 EEPKISDFGNLIHKVLEEY-SKNYNKQYINLNLLDKQNALINIGNHILYSTILPSYTKKT 648

Query: 856 WRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFV 913
           W+      S +F+  + + + + ++I+     ++ +  +G  I + G ADRI++ KS  +
Sbjct: 649 WQIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKIIGIADRIEISKSNNI 708

Query: 914 DITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            I DYKTG  P K+  +  + PQL +E+  L    F+Q +
Sbjct: 709 TILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTQCN 748


>gi|229586675|ref|YP_002845176.1| RecB family exonuclease [Rickettsia africae ESF-5]
 gi|228021725|gb|ACP53433.1| RecB family exonuclease [Rickettsia africae ESF-5]
          Length = 838

 Score = 90.9 bits (224), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 171/400 (42%), Gaps = 40/400 (10%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+         + +S   I
Sbjct: 371 LPTIWEKEGGAELLEFLTNLTAYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAAS--II 428

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +T  +P+LS+     LN+   E      +  F 
Sbjct: 429 IGRPEDLALCEFDLIILPHFNNENWTLSTKAHPWLSKKALQILNIDYDEIAPTLYSDYFN 488

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 489 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 537

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
                  T  +P Y +        + P T S +EI+ LI +PY  YA++IL L    H  
Sbjct: 538 -------TVVKPRYDKSIEIHS-PSFPTTLSVTEIETLIRNPYGFYAKKILGLRKKDHIW 589

Query: 801 KDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQ----IIDSHFEKEN-LPPHIDII 855
           ++P  +D G L H ++ E   K  +K    +N L KQ     I +H      LP +    
Sbjct: 590 EEPKISDFGNLIHKVLEEY-SKNYDKQYINLNLLDKQNALINIGNHILYSTILPSYTKKT 648

Query: 856 WRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFV 913
           W+      S +F+  + + + + ++I+     ++ +  IG  I + G ADRI++ KS  +
Sbjct: 649 WQIKLTAFSKAFILFDIERRKNCKEIYFETKGELQLNIIGQDIKIIGIADRIEISKSNNI 708

Query: 914 DITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            I DYKTG  P K+  +  + PQL +E+  L    F++ +
Sbjct: 709 TILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCN 748


>gi|157964483|ref|YP_001499307.1| endonuclease [Rickettsia massiliae MTU5]
 gi|157844259|gb|ABV84760.1| RecB family exonuclease [Rickettsia massiliae MTU5]
          Length = 846

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 91/399 (22%), Positives = 171/399 (42%), Gaps = 38/399 (9%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+    +K     ++T  I
Sbjct: 379 LPTIWEKEGGAELLEFLTNLTAYSKYINSTDKKDFPKIFSFLLSN--IKHYKNTNTTSII 436

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +   +P+LS+     LN+   E      +  F 
Sbjct: 437 IGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKKALQILNIDYDEIAPTLYSDYFN 496

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 497 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 545

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
                  T  +P Y +        + P T S +EI+ LI +PY  YA++IL L    H  
Sbjct: 546 -------TVVKPRYDKSIEIHS-PSFPTTLSVTEIETLIRNPYGFYAKKILGLRKKDHIW 597

Query: 801 KDPDRTDRGTLFHNIITELI----KKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW 856
           ++P  +D G L H ++ E      K+ IN N  +  + +  I +       LP +    W
Sbjct: 598 EEPKISDFGNLIHKVLEEYSKNYDKQYINLNLLDKQNALINIGNHILYSTILPSYTKKTW 657

Query: 857 RHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVD 914
           +      S +F+  + + + + ++I+     ++ +  +G  I + G ADRI++ KS  + 
Sbjct: 658 QIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKIIGIADRIEISKSNNIT 717

Query: 915 ITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
           I DYKTG  P K+  +  + PQL +E+  L    F++ +
Sbjct: 718 ILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCN 756


>gi|34580532|ref|ZP_00142012.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28261917|gb|EAA25421.1| unknown [Rickettsia sibirica 246]
          Length = 838

 Score = 89.0 bits (219), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 93/400 (23%), Positives = 171/400 (42%), Gaps = 40/400 (10%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+         + +S   I
Sbjct: 371 LPTIWEKEGGAELLEFLTNLTAYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAAS--II 428

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +   +P+LS+     LN+   E      ++ F 
Sbjct: 429 IGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKKALQILNIDYDEIAPTLYSNYFN 488

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 489 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 537

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
                  T  +P Y +        + P T S +EI+ LI +PY  YA++IL L    H  
Sbjct: 538 -------TVVKPRYDKSIEIHS-PSFPTTLSVTEIETLIRNPYGFYAKKILGLRKKDHIW 589

Query: 801 KDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQ----IIDSHFEKEN-LPPHIDII 855
           ++P  +D G L H ++ E   K  +K    +N L KQ     I +H      LP +    
Sbjct: 590 EEPKISDFGNLIHKVLEEY-SKNYDKQYINLNLLDKQNALINIGNHILYSTILPSYTKKT 648

Query: 856 WRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFV 913
           W+      S +F+  + + + + ++I+     ++ +  +G  I + G ADRI++ KS  +
Sbjct: 649 WQIKLTAFSKAFILFDIERRKNCKEIYFETKGELQLNIVGQDIKIIGIADRIEISKSNNI 708

Query: 914 DITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
            I DYKTG  P K+  +  + PQL +E+  L    F++ +
Sbjct: 709 TILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCN 748


>gi|15892473|ref|NP_360187.1| hypothetical protein RC0550 [Rickettsia conorii str. Malish 7]
 gi|81528292|sp|Q92I70|Y550_RICCN RecName: Full=Uncharacterized protein RC0550
 gi|15619629|gb|AAL03088.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 838

 Score = 88.2 bits (217), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 90/399 (22%), Positives = 169/399 (42%), Gaps = 38/399 (9%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+         + +S   I
Sbjct: 371 LPTIWEKEGGAELLEFLTNLTAYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAAS--II 428

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +   +P+LS+     LN+   E      +  F 
Sbjct: 429 IGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKQALQILNIDYDEIAPTLYSDYFN 488

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 489 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 537

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
                  T  +P Y +        + P T S +EI+ LI +PY  YA++IL L    H  
Sbjct: 538 -------TVVKPRYDKSIEIHS-PSFPTTLSVTEIETLIKNPYGFYAKKILGLRKKDHIW 589

Query: 801 KDPDRTDRGTLFHNIITELI----KKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW 856
           ++P  +D G L H ++ E      K+ IN N  +  + +  I +       LP +    W
Sbjct: 590 EEPKISDFGNLIHKVLEEYSKNYDKQYINLNLLDKQNALINIGNHILYSTILPSYTKKTW 649

Query: 857 RHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVD 914
           +      S +F+  + + + + ++I+     ++ +  +G  I + G ADRI++ KS  + 
Sbjct: 650 QIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKIIGIADRIEISKSNNIT 709

Query: 915 ITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
           I DYKTG  P K+  +  + PQL +E+  L    F++ +
Sbjct: 710 ILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCN 748


>gi|238650911|ref|YP_002916767.1| hypothetical protein RPR_05775 [Rickettsia peacockii str. Rustic]
 gi|238625009|gb|ACR47715.1| hypothetical protein RPR_05775 [Rickettsia peacockii str. Rustic]
          Length = 838

 Score = 88.2 bits (217), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 91/403 (22%), Positives = 170/403 (42%), Gaps = 46/403 (11%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L    + +      I + +  ++  I + L+         + +S   I
Sbjct: 371 LPTIWEKEGGAELLEFLTNLTAYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAAS--II 428

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W  +   +P+LS+     LN+   E      +  F 
Sbjct: 429 IGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKKALQILNIDYDEIAPTLYSDYFN 488

Query: 690 MANGTRHLIYTRSLRENNIPTIASRWLQRL---------LVLGGTDFFDNLKKRGQCYLD 740
           +    + ++   + + +   ++ S    +L         L+ G +++ D           
Sbjct: 489 LFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMD----------- 537

Query: 741 WTRKLDYTTKQPHYKRP----KPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFI 796
                  T  +P Y +      P+      P T S +EI+ LI +PY  YA++IL L   
Sbjct: 538 -------TVVKPRYDKSIEIHSPY-----FPTTLSVTEIETLIRNPYGFYAKKILGLRKK 585

Query: 797 PHFKKDPDRTDRGTLFHNIITELI----KKRINKNTPEINHLMKQIIDSHFEKENLPPHI 852
            H  ++P  +D G L H ++ E      K+ IN N  +  + +  I +       LP + 
Sbjct: 586 DHIWEEPKISDFGNLIHKVLEEYSKNYDKQYINLNLLDKQNALINIGNHILYSTILPSYT 645

Query: 853 DIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKS 910
              W+      S +F+  + + + + ++I+     ++ +  +G  I + G ADRI++ KS
Sbjct: 646 KKTWQIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKIIGIADRIEISKS 705

Query: 911 GFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
             + I DYKTG  P K+  +  + PQL +E+  L    F++ +
Sbjct: 706 NNITILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCN 748


>gi|15604268|ref|NP_220784.1| hypothetical protein RP403 [Rickettsia prowazekii str. Madrid E]
 gi|81554846|sp|Q9ZDC8|Y403_RICPR RecName: Full=Uncharacterized protein RP403
 gi|3860960|emb|CAA14860.1| unknown [Rickettsia prowazekii]
 gi|292572014|gb|ADE29929.1| RecB family exonuclease [Rickettsia prowazekii Rp22]
          Length = 870

 Score = 87.8 bits (216), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 177/410 (43%), Gaps = 25/410 (6%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIK-ANAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LPN+W +E G  L    + +I     I   N  ++  I + L+    +K      S+  I
Sbjct: 372 LPNIWEQEGGTVLIEFLTNLISYSKHINLTNKKDFPKIFSFLLSN--IKHYKNIDSSRII 429

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHD-F 688
           +G  E   L  FD +IL   N   W  N   +P LS+     LN+   +        D F
Sbjct: 430 IGQPEDLALCRFDLIILPHFNNEHWSSNAKPHPLLSKKALQILNIDYDDAITTTLYSDYF 489

Query: 689 EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFD-NLKKRGQCYLDWTRKLDY 747
            +    + ++   + + N   + A     RL +      F+ ++KK+   +      LD 
Sbjct: 490 NLLLQNKQIVILNAKKYNGKLSAACNLFLRLQLKYVIPCFECDIKKK--LFTPAINSLDE 547

Query: 748 TTK-QPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRT 806
            TK Q  +K           P   S ++I+ LI +PY  YA++IL L    +  ++P  +
Sbjct: 548 HTKPQDDHKLTTISNTF---PSVLSVTDIETLIRNPYGFYAKKILGLHKKDNIWEEPKIS 604

Query: 807 DRGTLFHNIITELIKKRINKNTPEINHLMKQ-----IIDSHFEKENLPPHIDIIWRHLFH 861
           D G   H ++ E   K  +K    +N   KQ     I ++      LP +    W+    
Sbjct: 605 DFGNFIHKVL-EKYSKNYDKQYVYLNLHDKQAALINIGNNILYSTILPAYTKKTWQIKLT 663

Query: 862 KISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYK 919
             S +F+  + + + + +KI+  I  ++ +   G  I + G ADRI++ KS ++ I DYK
Sbjct: 664 AFSKTFILFDIERRKNCKKIYFEIKGELRLNIAGQDIKIIGIADRIEVSKSNYITILDYK 723

Query: 920 TGDNPKKETAQKLIDPQLSLEAAAL-----KAGSFSQIDCRKVANLFYIR 964
           TG  P K+  +  + PQL +E   L        SF+ ++  + +N+ + +
Sbjct: 724 TGTIPTKKEIEFGLSPQLIIEGLMLIENGFNIESFNNLETSQFSNIHFCK 773


>gi|148284069|ref|YP_001248159.1| hypothetical protein OTBS_0148 [Orientia tsutsugamushi str. Boryong]
 gi|146739508|emb|CAM79214.1| hypothetical protein OTBS_0148 [Orientia tsutsugamushi str. Boryong]
          Length = 942

 Score = 84.7 bits (208), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 153/699 (21%), Positives = 296/699 (42%), Gaps = 89/699 (12%)

Query: 358  DVALIEADNEREEAISIAIALRMSL---DENKKKSALITADRNLARRVKLELTRFGIN-- 412
            D+  ++ +++ +EA  +A  +   L   +    K  ++T   +    + + L+++ IN  
Sbjct: 303  DIEYVKVNSQYDEAKLVAAMIHNYLIKANAKHNKILVVTTTSSFTTLLTMHLSKYQINYA 362

Query: 413  ----IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAK 468
                +DI   + ++  L   +L  L+++ F ++ F+    L+K PL          S + 
Sbjct: 363  NLTNVDIKQLLEINFIL---VLADLVSSNFSISKFI---NLIKTPLLT--------SSSS 408

Query: 469  NALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
            N  E + L   KN +   +LK ++LD +   K+++ +  W +                IL
Sbjct: 409  NKFENLIL---KNKFQQSELKQILLD-LTISKDDSELQKWAT---------------FIL 449

Query: 529  QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLF 588
              +  L  Y       C         +L +  LQ     E      +W  +  K +S + 
Sbjct: 450  SALDNLWIYYNCNTILCD--------QLIIDLLQAA---EKLTEGKIWQFQFSKRISDVL 498

Query: 589  SKIIETGSCIKANAI-EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
             ++I          I ++ +++T L+       + + ++ + I G   + LL+ D +I+ 
Sbjct: 499  KEVIHIAKQFGNIDIRDFSNVLTELVTMIKFNYEHDYNANVVITGADSAILLSADYIIIP 558

Query: 648  GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENN 707
              N   WP N+ +NP+L++ + S L L     +  +  +         H+  T S    +
Sbjct: 559  EFNNDHWPGNSIQNPWLNQAIYSKLGLIERNAHYDRKQYILYTILQKAHVSLTNSQFTAS 618

Query: 708  IPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTT---KQPHYKRPKPFPPLE 764
              T  S+++ +L +L    F + L +     L      +YT+   K   ++         
Sbjct: 619  GKTNDSQFILKLQLLA---FKNPLIRIRVNDLKLQHNQNYTSVDNKSTTFQISSGMLLSS 675

Query: 765  AQ-PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR--GTLFHNIITEL-I 820
            A   +T S ++I+ LI +PY  YA+ IL+L   P    D   T    G   H +I    I
Sbjct: 676  ADIVKTISATDIEMLIRNPYGFYAKNILRLK--PVILNDDQLTQAKFGDFIHTVIHRYTI 733

Query: 821  KKRINKNTPEINHLM---KQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSS 877
              +  + +  IN+ +   KQ+ID +    N      ++W    H+++  F+  + + ++ 
Sbjct: 734  CYKDMEESKLINYFIDIGKQLIDCY----NCSSFAKMVWLTKLHQLAEEFVRFDMERRNE 789

Query: 878  IEKIFVNIPAKMA--IESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDP 935
              KIF     +++  I +  +++   ADRI+  ++G   I D+KTG  P K+  Q  I  
Sbjct: 790  GFKIFSEQLGQISLNINNHALNIMAIADRIEYSQNGECYIIDFKTGTVPNKKEVQHGIAT 849

Query: 936  QLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFKIDCITNDKKKYSADELSEKSLK 992
            QL +E+  L  G F  +       + YI++   K   +   IT D++     EL      
Sbjct: 850  QLIIESIILYKGGFKDLPTIMPNKIIYIKITSTKPLLEFTEITVDQEMLDKHELG----- 904

Query: 993  NLIEIVT-LLQNGEQPFISHL-RLSEKSNIQSEYDHLAR 1029
             L+E++   +++G   F S + +L+ K N    Y HLAR
Sbjct: 905  -LVELLQYYIKDGGVFFPSPVDKLAPKYN---NYKHLAR 939


>gi|157825678|ref|YP_001493398.1| hypothetical protein A1C_03000 [Rickettsia akari str. Hartford]
 gi|157799636|gb|ABV74890.1| hypothetical protein A1C_03000 [Rickettsia akari str. Hartford]
          Length = 888

 Score = 80.9 bits (198), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 96/399 (24%), Positives = 170/399 (42%), Gaps = 34/399 (8%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKA-NAIEWIDIITRLIDGETVKPKIEKSSTLFI 630
           LP +W +E G  L+   + +      I + +  ++  I + L+    +K      ST   
Sbjct: 399 LPTIWEKEGGAELAEFLTNLTAYSKYINSTDKKDFPKIFSFLLSN--IKYYKNTDSTSIT 456

Query: 631 LGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           +G  E   L  FD +IL   N   W      +P+LS      LN+   E      +  F 
Sbjct: 457 IGAPEDLALCAFDFIILPHFNNENWTPTAKAHPWLSNKALQILNIDYNEITPTLYSDYFN 516

Query: 690 MANGTRHLIYTRSLREN---NIPTIASRWLQRLL-----VLGGTDFFDNLKKRGQCYLDW 741
           +    + +I   + + +   ++P+     LQ ++     V+   D       RG      
Sbjct: 517 LFLQNKQVIILNAKKYDGKLSVPSNLFLMLQNVIPIPYYVIPRLD-------RG------ 563

Query: 742 TRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKK 801
           + K+  T  +P Y   +P     + P   S ++I+ LI +PY  YA++IL L    +  +
Sbjct: 564 SHKIIDTVIKPRYDN-RPTAQSTSFPSVLSVTDIETLIRNPYGFYAKKILGLRPKDNIWE 622

Query: 802 DPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQI----IDSHFEKEN-LPPHIDIIW 856
           +P  +D G   H ++ E   K  +K    +N L KQ     I +H      LP +    W
Sbjct: 623 EPKISDFGNFIHKVLEEY-SKNYDKQYVNLNLLDKQAALINIGNHILYGTILPTYTKKTW 681

Query: 857 RHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVD 914
           +      S +F+  + + + + ++I+     ++ +   G  I + G ADRI++ KS  + 
Sbjct: 682 QIKLTAFSKAFILFDIERRKNCKEIYFETNGELRLNIAGQDIKIIGIADRIEISKSNNIT 741

Query: 915 ITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQID 953
           I DYKTG  P K++ +  + PQL +E+  L    F   D
Sbjct: 742 IMDYKTGTIPTKKSIELGLSPQLIIESLMLLENGFITFD 780


>gi|302879643|ref|YP_003848207.1| hypothetical protein Galf_2444 [Gallionella capsiferriformans ES-2]
 gi|302582432|gb|ADL56443.1| hypothetical protein Galf_2444 [Gallionella capsiferriformans ES-2]
          Length = 902

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 159/715 (22%), Positives = 276/715 (38%), Gaps = 93/715 (13%)

Query: 359  VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
            + L  A    +EA +  + +R  L E K   A++  DR +ARR++  L R  + +    G
Sbjct: 230  IGLFGAHGMEQEAQAADVQVRRWLLEGKTAIAVVVQDRMVARRLRALLERARVMVQDETG 289

Query: 419  IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
               +T   S++L   L A+     +  +  L+K P   F F E  + R + A +      
Sbjct: 290  WTFATLSVSTVLMRWLEAVQGDFYYQDVLDLLKSP---FLFAENQVLRKQAAYQF----- 341

Query: 479  NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
                      + LV         N H+    +    E  EL   LV  + Q    L    
Sbjct: 342  ----------EQLVRRHGVVLHLNEHI----AAAEREAPELVPALV-RLRQAARLLTARH 386

Query: 539  TNKNSTCGNLSIS-DWTKLTVTCLQNVCLDEHRKLPNLWFEE-EGKTLSSLFSKIIETGS 596
             + +     L  S D   +     Q+    +  +L  LW EE +  T S  FS       
Sbjct: 387  ASLSGWLSALHQSLDLLGVIHGWRQDAAGQQLMQLLALWQEELQADTTSCSFS------- 439

Query: 597  CIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
                   EW   +++ +D  T +     S  LF      +R   FD ++L G + G  P 
Sbjct: 440  -------EWRRWLSQQLDLNTYRDLSVDSPVLFT-HLAATRWRCFDAVLLLGCDAGHLPA 491

Query: 657  NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE---MANGTRHLIYTRSLRENNIPTIAS 713
                  + +  +++ L L  +     Q   D       NGT  ++ T     N  P + S
Sbjct: 492  PVNAGLWFNDAVRTTLGLPLSCVQQDQVRDDLLSLLAMNGT--VLATWQANCNGEPNLLS 549

Query: 714  RWLQRL----LVLGGTDFFDNLKKRGQCYLDWTR-------KLDYTTKQPH--------- 753
             + + L    L+  G D   N++  G   L   R        L  TTK  H         
Sbjct: 550  PYFEMLRAMHLLAFGHDLM-NVELGGLLPLAQVRIQDSDRKGLPRTTKVLHTKFLREGCR 608

Query: 754  ----YKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRG 809
                 K P+P  P E  P+  S S    L+  PY  +AR +L L+ +   ++D D+ D G
Sbjct: 609  IQDPAKMPRPVVPPELIPQKISPSGYNSLVACPYQYFARHVLHLNELDDVREDLDKRDYG 668

Query: 810  TLFHNIITEL---IKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHS 866
            T  H ++      I +  +++  E   ++++I D  F       ++   W   +  +  +
Sbjct: 669  TWVHEVLQRFHAEIPQLGSRDKGEAERVLRRISDEVFANALAHDYLAQAWLLRWQGLIPA 728

Query: 867  FLEHEEKIQSSIEKIF-VNIPAKMAIESIGIHLTGFADRIDLL--KSGFVDITDYKTGDN 923
            +L  + +I++   +     +P ++A+ S  + L G  DR+D+    +    + DYKT   
Sbjct: 729  YLHWQLEIEADGWRYHAAEVPFEVAV-SGNLLLRGRLDRVDVSVENADAFAVIDYKT--Q 785

Query: 924  PKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSA 983
              +    KL  P   ++ A      ++ +   K A   ++ L     +  ++ D++    
Sbjct: 786  SIQGLKNKLKSPGEDVQLA-----CYAHVQAAKTAA--FVSLDDD-TVQAVSPDEE---I 834

Query: 984  DELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYD 1038
            DEL++ +L  L EI   ++ G     +H   +EK     E   L R+ EW E  D
Sbjct: 835  DELAQLTLARLGEIFAQIREGA-GMPAH--GTEKICAYCEMKGLCRLGEWEESQD 886


>gi|321478211|gb|EFX89169.1| hypothetical protein DAPPUDRAFT_95254 [Daphnia pulex]
          Length = 228

 Score = 79.7 bits (195), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 644 LILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSL 703
           LI+GGLNEGVWP +  ++P+LSR M+  +N+ + E+ +G  AHDF       +L  TRS 
Sbjct: 100 LIIGGLNEGVWPADEGEDPWLSRPMRETVNMPSLERRVGLMAHDFRQIFAGENLFLTRST 159

Query: 704 RENNIPTIASRWLQRL---LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPF 760
           R    PT+ SR LQRL   L   G    + L  R      W  +++  T       P P 
Sbjct: 160 RLQGAPTLPSRLLQRLEAALEASGQPLPEPLHWR-----QWAHRMEIPTIFSPESPPAPC 214

Query: 761 PPLEAQ 766
           P LEA+
Sbjct: 215 PRLEAR 220


>gi|73541803|ref|YP_296323.1| DNA helicase/exodeoxyribonuclease V, subunit B [Ralstonia eutropha
           JMP134]
 gi|72119216|gb|AAZ61479.1| DNA helicase/exodeoxyribonuclease V, subunit B [Ralstonia eutropha
           JMP134]
          Length = 957

 Score = 78.6 bits (192), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 130/583 (22%), Positives = 229/583 (39%), Gaps = 58/583 (9%)

Query: 382 LDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLN 441
           L+  ++  AL+  DR +ARRV+  L R G  +    G  LSTT  ++ L    + + +  
Sbjct: 312 LNAGRRNIALVAHDRVVARRVRALLARAGAPVRDETGWKLSTTRAAAALMRWFDLLVRDG 371

Query: 442 DFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGN-KNSYDIMD--LKSLVLDRIAT 498
           D  A+  L+K P     FP++    A   +E    R N    +D +    ++L       
Sbjct: 372 DTAALLDLLKSPFCLPDFPDR--GAAIALIERQVRRDNVSGGWDRLRHLPRALPAALADA 429

Query: 499 QKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTV 558
             ++T +   ++ +     EL  +L D   +    L  +            +S W    +
Sbjct: 430 DADDTEIKRAEA-VRRSAGELLTILADEAARWPRGLAQHP-----------LSMW----L 473

Query: 559 TCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKII-----ETGSCIKANAIEWIDIITRLI 613
            CL    LD       L  +E G+ L    +++      ET S    +  E+  +++ L+
Sbjct: 474 GCLDGT-LDALGMRAALAADEAGRQLLDALARLQDLPSDETSSHATLSQAEFRAMLSALL 532

Query: 614 DGETVK-PKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDL 672
           +    K P    ++ + IL    +R+  FD +++ G ++   P + A+  F S  M+ +L
Sbjct: 533 ESVAYKEPSAASAARITILPLNGARMRRFDGVVVVGCDDAQLPSSAAELMFFSNQMRREL 592

Query: 673 NLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDN 730
            L+  E    Q A D    + N    ++  + L     P   S W++RL           
Sbjct: 593 QLEDRESRFAQQARDLAEVLLNNDDVVLTWQRLGGRGEPKHVSGWIERLSAC-------- 644

Query: 731 LKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRI 790
             + G         L + T       P P  P +  P  +S      L   PY  +A R+
Sbjct: 645 CARAGVAIEASMAPLVHQTFAETQGMPAPAAP-QLVPARWSAQAYNMLRRCPYQFFAGRM 703

Query: 791 LKLDFIPHFKKDPDRTDRGTLFHNII----TELIKKRINKNT-PEINHL--MKQIIDSHF 843
           L L  +     D ++ D G L H ++     EL+ +R    T PE   L  +++I D  F
Sbjct: 704 LGLAGLDAVSDDLEKRDIGELLHRVLLRYHRELLARRERGETVPEAERLDRLREISDDVF 763

Query: 844 EKENLPPHIDIIWRHLFHKISHSFL--EHEEKIQSSIEK-----IFVNIPAKMAIESIGI 896
                     I +   + ++  S++  + E + Q    +       V++P     +   I
Sbjct: 764 GALMAEDGNAIGYYRRWCEVLPSYVTWQTEREAQGWFWRGGEIDAGVDLPMP---DGKPI 820

Query: 897 HLTGFADRIDLLKSGFVDITDYKTGDNP--KKETAQKLIDPQL 937
            L G  DR+D    G   + DYKT      K++T++   D QL
Sbjct: 821 RLNGRIDRLDQGPGGAHAVLDYKTQSAARLKRKTSEVEEDCQL 863


>gi|157803845|ref|YP_001492394.1| hypothetical protein A1E_03370 [Rickettsia canadensis str. McKiel]
 gi|157785108|gb|ABV73609.1| hypothetical protein A1E_03370 [Rickettsia canadensis str. McKiel]
          Length = 928

 Score = 78.6 bits (192), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 99/200 (49%), Gaps = 8/200 (4%)

Query: 767 PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK 826
           P T S ++I+ LI +PY  YA++IL L    +  ++P  +D G   HN++ E   K  +K
Sbjct: 640 PTTLSVTDIETLIRNPYGFYAKKILGLRKKDNIWEEPKISDFGNFIHNVLEEY-SKNYDK 698

Query: 827 NTPEINHLMKQI----IDSHFEKEN-LPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKI 881
               +N L KQ     I +H      LP +    W+      S +F+  + + + + ++I
Sbjct: 699 QYMNLNLLDKQNALINIGNHILYSTILPIYTKKAWQIKLVAFSKAFILFDIERRKNCKEI 758

Query: 882 FVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSL 939
           +  I  ++ +   G  I + G ADRI++ KS  + I DYKTG  P K+  +  + PQL +
Sbjct: 759 YFEIKGELRLNIAGQDIKIIGIADRIEISKSNNITILDYKTGTIPTKKEIELGLSPQLII 818

Query: 940 EAAALKAGSFSQIDCRKVAN 959
           E+  L    F++    K  N
Sbjct: 819 ESLMLLENGFTEFYSCKSGN 838


>gi|218458526|ref|ZP_03498617.1| hypothetical protein RetlK5_03323 [Rhizobium etli Kim 5]
          Length = 97

 Score = 76.6 bits (187), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/91 (39%), Positives = 58/91 (63%)

Query: 5  KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEF 64
          +P + TI    PF + +   L +G L   FR++  +PL LA VTIY+PT+RA++ LRS F
Sbjct: 6  QPRILTIPAGLPFLKTLATTLCDGRLTPLFRHNVDDPLSLAGVTIYLPTRRAVRVLRSAF 65

Query: 65 IEITGKKSTILPIIKSLGDVVEEKFTADLLL 95
          +++ G +S ILP+I+ LG+  ++    D +L
Sbjct: 66 VDLLGGRSAILPVIRPLGETDDDSGYFDEVL 96


>gi|189184253|ref|YP_001938038.1| hypothetical protein OTT_1346 [Orientia tsutsugamushi str. Ikeda]
 gi|189181024|dbj|BAG40804.1| hypothetical protein OTT_1346 [Orientia tsutsugamushi str. Ikeda]
          Length = 946

 Score = 75.9 bits (185), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 157/709 (22%), Positives = 300/709 (42%), Gaps = 107/709 (15%)

Query: 358  DVALIEADNEREEAISIAIALRMSL---DENKKKSALITADRNLARRVKLELTRFGIN-- 412
            D+  ++ +++ +EA  +A  +   L   +    K  ++T   +    + + L+++ IN  
Sbjct: 305  DIEYVKVNSQYDEAKLVAAMIHNYLIKANTQHNKILVVTTTPSFTTLLTMHLSKYQINYA 364

Query: 413  ----IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAK 468
                +DI   + ++  L   +L  L+++ F ++ F+    L+K  L          S + 
Sbjct: 365  NLTNVDIKQLLEINFIL---VLADLVSSNFSISKFI---NLIKTSLLT--------SSSS 410

Query: 469  NALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHIL 528
            N  E + L   KN +   +LK ++LD +   K+++ +  W +                IL
Sbjct: 411  NKFENLIL---KNKFQQSELKQILLD-LTISKDDSELQKWAT---------------FIL 451

Query: 529  QCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLF 588
              +  L  Y  +    C         +L +  LQ     E+     +W  +  K +S + 
Sbjct: 452  SALDDLWIYYNSNTILCD--------QLIIGLLQAA---ENLTEGKIWQFQFSKRISDVL 500

Query: 589  SKIIETGSCIKANAI-EWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
             ++I          I ++ +++T L+       + + ++ + I G   + LL+ D +I+ 
Sbjct: 501  KEVIHIAKQFGNIDIRDFSNVLTELVTMIKFNYEHDYNANVVITGADSAILLSADYIIIP 560

Query: 648  GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENN 707
              N   WP N+ +NP+L++ + S L L      I + AH     +  ++++YT  L++ +
Sbjct: 561  EFNNDHWPGNSIQNPWLNQAIYSKLGL------IERNAH----YDRKQYILYT-ILQKAH 609

Query: 708  IPTIASRWL--------QRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKR--- 756
            +  I S++         Q +L L    F + L +     L      +YT+     K    
Sbjct: 610  VSLINSQFTASSKTTDSQFILKLQLLAFKNPLIRIRVNDLKLQYNQNYTSNVVDNKSTTF 669

Query: 757  ---PKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR--GTL 811
               P          +T S ++I+ LI +PY  YA+ IL+L   P    D   T    G  
Sbjct: 670  QILPGILLSSADIVKTISATDIEMLIRNPYGFYAKNILRLK--PVILNDDQLTQAKFGDF 727

Query: 812  FHNIITEL-IKKRINKNTPEINHLM---KQIIDSHFEKENLPPHIDIIWRHLFHKISHSF 867
             H +I    I  +  + +  IN+ +   KQ+ID +    N      +IW    H+++  F
Sbjct: 728  IHKVIHRYTICYKDMEESKLINYFIDIGKQLIDCY----NCSSFAKMIWLTKLHQLAEEF 783

Query: 868  LEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFA--DRIDLLKSGFVDITDYKTGDNPK 925
            +  + + ++   KIF     ++++      L   A  DRI+  ++G   I D+KTG  P 
Sbjct: 784  VRFDMERKNEGFKIFSEQSGQISLNINNNALNIIAIADRIEYSQNGECYIIDFKTGTVPN 843

Query: 926  KETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRL---KQKFKIDCITNDKKKYS 982
            K+  Q+ I  QL +E+  L  G F  +       + YI++   K   +   IT D++   
Sbjct: 844  KKEVQQGIATQLIIESIILYRGGFKNLPAMMPNKIIYIKITSTKPLLEFTEITVDQEMLD 903

Query: 983  ADELSEKSLKNLIEIVT-LLQNGEQPFISHL-RLSEKSNIQSEYDHLAR 1029
              EL       L+E++   +++G   F S + +L+ K N    Y HLAR
Sbjct: 904  KHELG------LVELLQYYIKDGGVFFPSPVDKLAPKYN---NYKHLAR 943


>gi|67459016|ref|YP_246640.1| hypothetical protein RF_0624 [Rickettsia felis URRWXCal2]
 gi|75536548|sp|Q4ULU8|Y624_RICFE RecName: Full=Uncharacterized protein RF_0624
 gi|67004549|gb|AAY61475.1| unknown [Rickettsia felis URRWXCal2]
          Length = 856

 Score = 73.6 bits (179), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 158/387 (40%), Gaps = 11/387 (2%)

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFIL 631
           LP +W +E G  L    + +      I +   +    I   +       K   S+ + I 
Sbjct: 369 LPTIWEKEGGAELVEFLTNLTAYSKYINSMDKKDFPKIFSFLLSNIKYYKNTDSANIIIA 428

Query: 632 GTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMA 691
              +  L  FD +IL   N   W      +P+LS+     LN+   E      +  F + 
Sbjct: 429 PPEDLALCTFDLIILPHFNNENWTPTAKSHPWLSKKALQILNIDYNETASTLYSDYFNLF 488

Query: 692 NGTRHLIYTRSLRENNIPTIASRWLQRLL-VLGGTDFFDNLKKRGQCYLDWTRKLDYTTK 750
              + +I   + + +   ++ S    +L  V+    +   +      +LD   +  +   
Sbjct: 489 LQNKQVIILNAKKYDGKLSVPSNLFLKLQDVIPAVHYV--IPAEAGIHLDMDSRRCWNDI 546

Query: 751 QPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGT 810
           +      +      + P   S ++I+ LI +PY  YA++IL L    +  ++P  +D G 
Sbjct: 547 RKDDIGDESTAHSHSFPSVLSVTDIETLIRNPYGFYAKKILGLRKKDNIWEEPKISDFGN 606

Query: 811 LFHNIITELIKKRINKNTPEINHLMKQI----IDSHFEKEN-LPPHIDIIWRHLFHKISH 865
             H ++ E   K  +K    +N L KQ     I +H      LP +    W+      S 
Sbjct: 607 FIHKVLEEY-SKNYDKQFINLNLLDKQNALINIGNHILYGTILPNYTKKTWQIKLTAFSK 665

Query: 866 SFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDN 923
           +F+  + + + + ++I+     ++ +   G  I + G ADRI++ KS  + I DYKTG  
Sbjct: 666 AFILFDIERRKNCKEIYFETKGELRLNIAGQDIKIIGIADRIEISKSNHITILDYKTGTI 725

Query: 924 PKKETAQKLIDPQLSLEAAALKAGSFS 950
           P K+  +  + PQL +E+  L    F+
Sbjct: 726 PTKKEIELGLSPQLIIESLMLLENGFN 752


>gi|239947253|ref|ZP_04699006.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921529|gb|EER21553.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 908

 Score = 72.4 bits (176), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/343 (22%), Positives = 142/343 (41%), Gaps = 21/343 (6%)

Query: 626 STLFILGTLES-RLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQA 684
           S   I+G+ E   L  FD +IL   N   W      +P+LS+     LN+   E      
Sbjct: 473 SASIIIGSPEDLALCGFDLIILPHFNNENWTLTAKAHPWLSKKALQILNIDYNEIAPTLY 532

Query: 685 AHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDN----LKKRGQCYLD 740
           +  F +    + ++   + + +    + S    +L +     + D+    + +    +LD
Sbjct: 533 SDYFNLFLQNKQIVILNAKKYDGKLLVPSNLFLKLQLKHVIPWLDHGIHTINRSNNIFLD 592

Query: 741 WTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFK 800
              K           R          P   S ++I+ LI +PY  YA++IL L    +  
Sbjct: 593 PAIK----------SRDDKVASSTFFPAVLSVTDIETLIRNPYGFYAKKILGLRKKDNIW 642

Query: 801 KDPDRTDRGTLFHNIITELIK----KRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIW 856
           ++P  +D G   H ++ E  K    + IN N  +  + +  I +       LP +    W
Sbjct: 643 EEPKISDFGNFIHKVLEEYSKNHDKQYINLNLLDKQNALINIGNHILYSTILPNYTKKTW 702

Query: 857 RHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVD 914
           +      S +F+  + + + + ++I+     ++ +   G  I + G ADRI++ KS  + 
Sbjct: 703 QIKLTAFSKAFILFDIERRKNCKEIYFETKGELQLNIAGQDIKIIGIADRIEISKSNNIT 762

Query: 915 ITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKV 957
           I DYKTG  P ++  +  + PQL +E+  L    F     RK+
Sbjct: 763 ILDYKTGTIPTRKEIELGLSPQLIIESLMLLENGFYTARFRKL 805


>gi|296536931|ref|ZP_06898961.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296262742|gb|EFH09337.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 292

 Score = 72.0 bits (175), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 76/276 (27%), Positives = 118/276 (42%), Gaps = 28/276 (10%)

Query: 40  NPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSL-GDVVEEKFTADLLLSYN 98
           +PL L+  TI +PT+RA   LR  F+  +G ++ +LP + +L G   +E     L +  +
Sbjct: 28  DPLSLSRTTILLPTRRAALALRESFLRESGGRTLLLPRMHALSGLSTQEADELSLPVLLD 87

Query: 99  LNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDI 158
           L P V+   R   L  L++    +LP         S    P +P  A  LA  LA+ +D 
Sbjct: 88  LPPAVAPAVRHSVLTSLVM----RLP---------SRFGGPDTPEQAWRLATALAEWLDE 134

Query: 159 IETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAE 218
              E      L  L  E++   W +   FL+     W   L           ++A +RA+
Sbjct: 135 TALEGCDMARLETLVPEEFATHWQVTLTFLRGVLSAWEAWLAGQGLMDIGPRRVAALRAQ 194

Query: 219 AEHLMKG-TKGPIIIA--GSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTIT 275
           A+   +   + P+I A  G+ G+IPA A L+  VA  P G +VL G        +W  I 
Sbjct: 195 ADSWKREPPRDPVIAAGIGAGGTIPAAAALLKVVAQMPQGCVVLHGAGEVKSDELWAAIG 254

Query: 276 EKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVK 311
           E             THP     +LL  +D    D++
Sbjct: 255 ES-----------PTHPLAGQVRLLSAMDATPRDLE 279


>gi|321466936|gb|EFX77928.1| hypothetical protein DAPPUDRAFT_105537 [Daphnia pulex]
          Length = 566

 Score = 71.6 bits (174), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (61%)

Query: 644 LILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSL 703
           LI+GGLNE VWP +   +P+LSR M+   N+ + E+++G  AHDF       +L  TRS 
Sbjct: 421 LIIGGLNEVVWPADEGGDPWLSRPMRETDNMPSLERWVGLMAHDFRHNFAGENLFLTRST 480

Query: 704 RENNIPTIASRWLQRL 719
           R    PT+ SR LQRL
Sbjct: 481 RLQGAPTLPSRLLQRL 496


>gi|300310195|ref|YP_003774287.1| inactivated superfamily I helicase [Herbaspirillum seropedicae
           SmR1]
 gi|300072980|gb|ADJ62379.1| inactivated superfamily I helicase [Herbaspirillum seropedicae
           SmR1]
          Length = 924

 Score = 70.9 bits (172), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 123/573 (21%), Positives = 222/573 (38%), Gaps = 71/573 (12%)

Query: 364 ADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLST 423
           +D E     S  I LR  L + K + A++  DR  ARR++  L R  +++    G  LST
Sbjct: 306 SDLENAAVQSAQIVLRW-LQQGKNEIAIVAQDRVTARRLRALLERAQVSVADETGWKLST 364

Query: 424 TLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVA-LRGNKNS 482
           T  ++ L +  + +    +  A+  L+K P   F FP     RA   + + A LR    +
Sbjct: 365 TRAAAALAAWNDLVSARGETNALLDLLKSP---FVFPADP-GRADRVMRIEARLRRANIA 420

Query: 483 YDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKN 542
            D   L++   D  A   ++                         LQCI   +T      
Sbjct: 421 GDWQALQTAFAD--ARDPDD-------------------------LQCI---LTLARQAA 450

Query: 543 STCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEG---KTLSSLFSKIIETGSCI- 598
              G  ++S W +      + + +D           E+G   + L  L     E G+   
Sbjct: 451 RFGGRKTLSQWCETQRRLCEALGMDAA-------LREDGAGQQCLLMLDEIAAEQGALQD 503

Query: 599 KANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNT 658
           + +  EW  ++   +D  +  P I K   + +L    +RL  FD +++ G +    P   
Sbjct: 504 QFSFAEWRALLNLRLDATSYMPPI-KDRRVVMLPLNGARLRRFDAVLVIGADAAHLPSPP 562

Query: 659 AKNPFLSRVMQSDLNLKTAEKYIGQAAHDF-EMANGTRHLIYTRSLRENNIPTIASRWLQ 717
            +  F S  ++ +LNL T      Q   D  E+      ++      ++  P   S W++
Sbjct: 563 QETLFFSNAVRRELNLATRATRQRQQLRDLVELLCINPEVVLCWQTHQDGEPNPVSPWIE 622

Query: 718 RLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKR-----PKPFPPLEAQPRTYSF 772
           RL +         L ++G   L   ++L+        +      P P  P +  P T S 
Sbjct: 623 RLEL--------KLAQQGAAPL---QRLELPPPVQQLRALPSSMPAPSAP-DLLPPTLSA 670

Query: 773 SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT--PE 830
           S     +  PY  +A+R+L++  +    + P++ D G+  H I+ +      + +T  P 
Sbjct: 671 SGFGSFLACPYQFFAQRMLRVAVMDELSEMPEKRDYGSWLHEILYKYHAHLRDNDTPLPA 730

Query: 831 INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSF-LEHEEKIQSSIEKIFVNIPAKM 889
              L+ Q  +  F++E       + +   + K+  ++ L   E+     +  F       
Sbjct: 731 RAALLAQFSEEVFQREMQRHPAALAFHARWQKVMPAYLLWANEREAEGWQFAFGEESQSQ 790

Query: 890 AIE--SIGIHLTGFADRIDLLKSGFVDITDYKT 920
            ++    GI L G  DR+D  + G   + DYKT
Sbjct: 791 TLQWSDGGIELYGRLDRVDRNEQGQRALLDYKT 823


>gi|296532163|ref|ZP_06894923.1| inactivated superfamily I helicase [Roseomonas cervicalis ATCC 49957]
 gi|296267511|gb|EFH13376.1| inactivated superfamily I helicase [Roseomonas cervicalis ATCC 49957]
          Length = 191

 Score = 67.8 bits (164), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 56/192 (29%), Positives = 85/192 (44%), Gaps = 17/192 (8%)

Query: 850  PHIDIIWRHLFHKISHSFLEHEEKIQSS--IEKIFVNIPAKMAIESIGIHLTGFADRIDL 907
            P +   WR    +I    +  EE  Q    I +    +P  + I    + L   ADR+D 
Sbjct: 3    PGLLAFWRPRLARIGGFVVAQEEAAQQGRRIRRRHAELPGHLDIAGRRVKLKVRADRLDE 62

Query: 908  LKSGFVDITDYKTGDNPKKETAQKLID---PQLSLEAAALKAGSFSQIDCRKVANLFYIR 964
            L  G + + DYKTG  P   T +++ D   PQ+ LEAA  +AG F  I    V+ L + R
Sbjct: 63   LADGTIALIDYKTGTPP---TGKEMTDGRAPQMPLEAAIAEAGGFQGIARAPVSGLAHWR 119

Query: 965  LK---QKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQ 1021
            L       ++  +  D     AD L + +      +V     G + FI+      +   +
Sbjct: 120  LTGGGTPGEVKPVKGDPGTLGADALEQTT-----ALVQGFLLGHRRFIARPHPRRRPQ-R 173

Query: 1022 SEYDHLARVAEW 1033
             E+DHLAR+AEW
Sbjct: 174  GEHDHLARIAEW 185


>gi|94311070|ref|YP_584280.1| DNA helicase/exodeoxyribonuclease V subunit B [Cupriavidus
           metallidurans CH34]
 gi|93354922|gb|ABF09011.1| ATP-dependent nuclease, subunit B [Cupriavidus metallidurans CH34]
          Length = 976

 Score = 67.8 bits (164), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/341 (22%), Positives = 140/341 (41%), Gaps = 25/341 (7%)

Query: 593 ETGSCIKANAIEWIDIITRLIDGETVK-PKIEKSSTLFILGTLESRLLNFDTLILGGLNE 651
           ETGS    N  E+  +++ L++    K P  +  S + IL    +R+  FD +++ G ++
Sbjct: 531 ETGSHATLNQQEFRAMLSALLESVAYKEPSAQSQSRITILPLNGARMRRFDGVVVVGCDD 590

Query: 652 GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIP 709
              P + A+  F S  M+ +L L+  E    Q A D    + N +  ++  + +     P
Sbjct: 591 AQLPSSAAELMFFSNQMRRELGLEDREARFAQQARDLAEVLLNNSDVVLTWQRIGSRGEP 650

Query: 710 TIASRWLQRL---LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQ 766
              S W++RL       GT    +           T  L  T  QP    P P  P E  
Sbjct: 651 HHVSGWIERLSACCARAGTPIEASA----------TPALHDTFAQP-AGMPAPVAP-ERV 698

Query: 767 PRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIIT---ELIKKR 823
           P  +S      L   PY  +A R+L L  +     D ++ D G L H ++    E I   
Sbjct: 699 PERWSAQAYNTLRRCPYQFFASRMLGLSGLDTLSDDLEKRDIGNLLHRVLLQYHEEIHAS 758

Query: 824 INKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE-EKIQSSIEKIF 882
             +++      +++I D+ F K+       I +   + ++  S++  + E+ ++      
Sbjct: 759 GERDSDRRLARLREISDTSFGKQIAEDGNAISYYRRWMEVLPSYVAWQAEREEAGWHWRG 818

Query: 883 VNIPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYKT 920
               A + +   + + + L G  DR+D    G   + DYKT
Sbjct: 819 GEFDAGVDVAMPDGVPLRLAGRIDRLDKGPDGAHAVLDYKT 859


>gi|6626266|gb|AAF19531.1| hypothetical protein [Bradyrhizobium japonicum]
          Length = 231

 Score = 67.0 bits (162), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 75/167 (44%), Gaps = 7/167 (4%)

Query: 803 PDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHK 862
           PD+ DR        TE    R+  +   +   ++ I + HF      P    +W   F +
Sbjct: 16  PDQLDRYWQHSLEFTERYATRLPDDPARV---LRAIGEKHFAPLMERPEARALWWPRFQR 72

Query: 863 ISHSFLEHEEKIQSSIEKIFVNIPAKMAI---ESIGIHLTGFADRIDLLKSGFVDITDYK 919
           I+  F E E   +  +E I      +++I         L+  ADRI+  + G   I DYK
Sbjct: 73  IARWFSEWETARRDVVEAITAETRGEISITLDNERSFRLSARADRIERRQGGGYAILDYK 132

Query: 920 TGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDC-RKVANLFYIRL 965
           TG  P  +  +  + PQL+LEAA L+ G F  ID    V+ L Y+RL
Sbjct: 133 TGQPPTGKQVRMGLSPQLTLEAAILREGGFPDIDAGSSVSQLVYVRL 179


>gi|325286151|ref|YP_004261941.1| hypothetical protein Celly_1242 [Cellulophaga lytica DSM 7489]
 gi|324321605|gb|ADY29070.1| hypothetical protein Celly_1242 [Cellulophaga lytica DSM 7489]
          Length = 910

 Score = 66.6 bits (161), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 86/346 (24%), Positives = 143/346 (41%), Gaps = 58/346 (16%)

Query: 611 RLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQS 670
            L+  ET+  K E    L I+G LESR L+F+T++L  +NEG+ P   + N F+   ++ 
Sbjct: 488 ELLSSETLDFKGEPLKGLQIMGMLESRNLDFETVLLTSVNEGILPSGKSNNSFIPFDIKK 547

Query: 671 DLNLKT-AEKYIGQAAHDFEMANGTR--HLIYTRSLRENNIPTI-----ASRWLQRLLVL 722
              L T  EK      H + +    +  HL+Y      N  P +      SR +++LL  
Sbjct: 548 MYGLPTYKEKDAVYTYHFYRLLQRAKNIHLVY------NTEPDVLEGGEVSRLIRQLLAD 601

Query: 723 GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKP----------FPPLEAQPRTYSF 772
                            + +  +  T   P  K PK              L      Y F
Sbjct: 602 S----------------NISNYITETIAFPEIKSPKKKVVSIQKDAHLMELIKGIAAYGF 645

Query: 773 S--EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKN--- 827
           S   +   I +P   Y + ILK++ +   ++       GT+ H  + EL +  +N     
Sbjct: 646 SPTSLSNYIRNPLDFYKKNILKINELEEVEETVAANTFGTIVHETLDELYQPFVNTFLEA 705

Query: 828 ------TPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSF--LEHEEKIQSSIE 879
                  P+IN  +++    H++  +L    ++I  ++  K   +F  LE E   +  I+
Sbjct: 706 EQLKALLPKINSTVRKHFAIHYKNVSLEEGKNLIAFNVVLKYVENFIKLEIESAKKHKIK 765

Query: 880 KIFVNIPAKMAIESIG----IHLTGFADRIDLLKSGFVDITDYKTG 921
            I + +  K AI   G    +H+ G  DRID +  G + + DYKTG
Sbjct: 766 IIGLELSLKTAINVPGVNFPVHIKGKLDRIDEI-DGVLRVIDYKTG 810


>gi|157164411|ref|YP_001466191.1| hypothetical protein CCC13826_0735 [Campylobacter concisus 13826]
 gi|112801476|gb|EAT98820.1| conserved hypothetical protein [Campylobacter concisus 13826]
          Length = 781

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 126/311 (40%), Gaps = 56/311 (18%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFL-SRVMQSDLNLKTAEKYIGQAAHDF 688
           ++G LESR + FD +I+   N+   P  +A   FL S+V Q    +   E+   Q  +  
Sbjct: 430 VMGMLESRGMKFDGVIIVDFNDNFIPARSANEMFLNSKVRQKAGLISYVERENLQRFYYE 489

Query: 689 EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDN----LKKRGQCYLDWTRK 744
            + N  + +  +  + E +IP   SR+L+    +    F D     L  +G+  L+ +  
Sbjct: 490 SLINNAKKVAISCCVNEESIP---SRFLKNFKTIKDEKFSDEAYLKLFLKGEASLNLSDD 546

Query: 745 LDYTTKQPHYKRPKPFPPLE---AQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKK 801
            +   +   +  P  F  L      PR Y +++I   I+ P A+ +    K     H   
Sbjct: 547 -EIILEHDFFANPLSFSTLNLFLTCPRKYYYTKIAH-IDAPKAIASELGTKQGNSVH--- 601

Query: 802 DPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFH 861
                  G LF    +E  K+    NT ++      +      K+NL P    IW H F 
Sbjct: 602 -------GALFEYYTSEFYKQN---NTFDL-----AVFKEMLAKQNLTPLEFEIWTHKFK 646

Query: 862 ----------KISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSG 911
                     +     LE E+++QS               E  G+ + GF DRID+  +G
Sbjct: 647 EYEIYENERLRAGFRVLECEKEVQS---------------EFCGVQIKGFIDRIDVGANG 691

Query: 912 FVDITDYKTGD 922
            V I DYKTG+
Sbjct: 692 DVLILDYKTGE 702


>gi|171463386|ref|YP_001797499.1| inactivated superfamily I helicase-like protein [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171192924|gb|ACB43885.1| inactivated superfamily I helicase-like protein [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 991

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 150/668 (22%), Positives = 249/668 (37%), Gaps = 116/668 (17%)

Query: 335 DTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITA 394
           +  D   T  LEN      K +    LI A    E A + A  +   L   K   AL+  
Sbjct: 291 EDGDQARTQALENVKRTQNKGWR---LIAAKRFEELAWAAAKTIEQHLINGKTNLALVAQ 347

Query: 395 DRNLARRVKLELTRFG--INIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLV-- 450
           DR +ARR +  L+R G  +NI    G  LSTT  ++ L S L  I    D  +  TL+  
Sbjct: 348 DRLVARRARALLSRLGPALNIRDETGWKLSTTRAAAALNSWLELIKAPKDGPSAKTLLEF 407

Query: 451 -KHPLAKFGFPEKYLSR-AKNALELVA-----LRGNKNSYDIMDLK-SLVLDRIATQKNN 502
            ++P    G   K L+R A+  + L+A     L G+K          ++   ++   KN 
Sbjct: 408 LQNPFLDLG---KILNRDAEACIGLIAGLEDILVGSKAESGWKTFHIAIEGAQVNAAKNA 464

Query: 503 THVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTC-- 560
           + +P               +L +        L+ +   ++         +W  L V C  
Sbjct: 465 SAMP-------------GTVLFE--------LLQFARERHH--------EWLTLQVDCNK 495

Query: 561 ---LQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAI---EWIDIITRLID 614
              L  V L       +L  +  GK L  +      + +  +  ++   EW+ ++  +I+
Sbjct: 496 AYQLLQVNLQATGMAQSLEKDSAGKQLLEVLKTFDLSKTQYQQTSVRLSEWLSLLKTVIE 555

Query: 615 GETVK-PKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLN 673
           G + +    E  +TL IL    +R+ +F+ +++ G +E   P  +    F S  +   L 
Sbjct: 556 GASYQEAGKEAKATLSILPLSSTRMRDFEAVVVVGCDEQQLPAYSEPPLFFSDALNQLLK 615

Query: 674 LKTAEKYIGQAAHDFE---MANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFD- 729
             T      Q + D     ++  +  L++ +S   N  P   S W+QRL      +    
Sbjct: 616 TSTIAMQFVQQSRDLSQLLVSCPSVDLLW-QSKSNNGEPLRPSAWIQRLQNQVEWEAIPV 674

Query: 730 NLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARR 789
            LKKR                  H++   P P L   P  Y     K L + PY  Y R 
Sbjct: 675 QLKKRA------FEATPMVMTVAHFEEDLPMP-LSMSPSAY-----KALRDCPYRYYVRS 722

Query: 790 ILKLDFIPHFKKDPDRTDRGTLFHNIIT---------ELIKKRINKNTPEINHLMKQIID 840
           +L L     F +  D +  G   H ++          EL    +  +  +    M+Q ++
Sbjct: 723 LLSLRKNKEFDEGFDASLAGQTLHKLLKRFYHALKTHELTNPSLKTDEDQRRAWMEQSLN 782

Query: 841 SHFEKE--------------------NLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEK 880
            + E+E                     +P  ID  W+    +    + + E K+      
Sbjct: 783 DYSEQEFAALIEGDARVMGTLRDWQKQIPSFID--WQLQREQAGWEYFDGEVKVG----- 835

Query: 881 IFVNIPAKMAIESIG-IHLTGFADRID--LLKSGFVDITDYKTG--DNPKKETAQKLIDP 935
              N+P + A  +I  I + G+ADR D  +  S    + DYK    +  K      L DP
Sbjct: 836 --FNLPFQDADGNIKMIRIEGYADRYDVNVDNSKIASVIDYKNQRFEKVKARAEHILDDP 893

Query: 936 QLSLEAAA 943
           QL + A A
Sbjct: 894 QLLIYAKA 901


>gi|309782348|ref|ZP_07677074.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308918884|gb|EFP64555.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 947

 Score = 65.9 bits (159), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 124/583 (21%), Positives = 220/583 (37%), Gaps = 80/583 (13%)

Query: 369 EEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSS 428
           +EA   A  L   L+  ++  AL+  DR +ARRV+  L R  + +    G  LSTT  ++
Sbjct: 302 DEAAFAAHTLVDWLNAGRRSLALVAQDRIVARRVRALLARVNVPVRDETGWKLSTTRAAA 361

Query: 429 ILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDL 488
            L   ++ +    D  A+  L+K P           + A  A     +R +  S     L
Sbjct: 362 ALMRWVDVVQGDGDTAALLDLIKSPFCLRDADAGTATPAWVAELERRVRRHNVSGGWGRL 421

Query: 489 KSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNL 548
           + LV DR A+          ++++S     L VL  +  L                 G+ 
Sbjct: 422 RRLVTDRPASDAEG------EAKVSRLADRLGVLADEAALW-------------RRAGSA 462

Query: 549 SISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-----IETGSCIKANAI 603
           ++  W  L    L  + +     L N   ++ G+ L     ++       T +  + +  
Sbjct: 463 TLDAWVTLLAGTLDRLHM--RTGLQN---DDAGRQLLDWIDRLRTSIHGSTDAGARFSLT 517

Query: 604 EWIDIITRLIDGETV-KPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
           EW  +++ L++     +P       + IL    +R+  FD +++ G ++   P    +  
Sbjct: 518 EWRALLSMLLESAVFSEPSPPADRRVVILPLNGARMRRFDGVVVVGCDDAQLPSAQPEWL 577

Query: 663 FLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIPTIASRWLQRL- 719
           F S  ++ +L L    +   Q A D    + N    ++  +       P   S WL+RL 
Sbjct: 578 FFSNDVRRELGLPDRAQRFAQQARDLAEVLLNQPEVVLTWQRHGGRGEPHRLSGWLERLQ 637

Query: 720 --LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
             L + G     ++          T     TT QP    P P  P    P T S +    
Sbjct: 638 RRLAVSGVRIDTSV----------TLPSLQTTSQP-TDMPAPAAPTLV-PSTLSAAAYNS 685

Query: 778 LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNII----TELIKKRINKNTPEINH 833
           L   PY  +  R+L+L  +     + ++ D G + H I+     +L++  ++     ++ 
Sbjct: 686 LRRCPYQFFVGRMLRLGELEEVSDELEKRDIGEILHAILHRFHRQLLETPMHDPADRLS- 744

Query: 834 LMKQIIDSHF-----EKEN-----------LPPHIDIIWRHLFHKISHSFLEHEEKIQSS 877
           L++ I D  F     E  N           +P +  + W+         F   E  + +S
Sbjct: 745 LLQTITDEQFGPLLAEDGNALRFYRRWLGVMPSY--LAWQAAREADGWRFEAGEVDVDTS 802

Query: 878 IEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKT 920
           I      +P + A     + L G  DRID+     V + DYKT
Sbjct: 803 I-----TLPDERA-----LRLRGRIDRIDVHDEHGVAVLDYKT 835


>gi|218660128|ref|ZP_03516058.1| hypothetical protein RetlI_11042 [Rhizobium etli IE4771]
          Length = 102

 Score = 65.9 bits (159), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 55/82 (67%), Gaps = 7/82 (8%)

Query: 959  NLFYIRLK--QKFKIDCITNDK-----KKYSADELSEKSLKNLIEIVTLLQNGEQPFISH 1011
            +L Y+RL+   +F++D + N+      K  SA +L+E+S+  LI+ V+LLQ+GE+ F S 
Sbjct: 9    DLLYVRLRPGNRFQVDMVNNENAARSDKAKSAIDLAEESVDQLIKFVSLLQSGEKGFTSR 68

Query: 1012 LRLSEKSNIQSEYDHLARVAEW 1033
            L  +++ +   +YDHLARV+EW
Sbjct: 69   LIPAQQFDFGGDYDHLARVSEW 90


>gi|91215421|ref|ZP_01252392.1| hypothetical protein P700755_09913 [Psychroflexus torquis ATCC
           700755]
 gi|91186373|gb|EAS72745.1| hypothetical protein P700755_09913 [Psychroflexus torquis ATCC
           700755]
          Length = 900

 Score = 65.5 bits (158), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 89/336 (26%), Positives = 149/336 (44%), Gaps = 30/336 (8%)

Query: 605 WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFL 664
           +IDI++     ET+  +      L I+G LESR+L+F  +I+  LNEGV P   ++N F+
Sbjct: 477 YIDILS----SETLDFEGSPYEGLQIMGMLESRVLDFKNVIITSLNEGVLPSGKSQNSFI 532

Query: 665 SRVMQSDLNLKT-AEKYIGQAAHDFEMANGTR--HLIYTRSLRENNIPTIASRWLQRLLV 721
              ++    L T  EK    A H F +   +   H IY  +          SR+L +L +
Sbjct: 533 PFDLKKAYKLPTYKEKDAIYAYHFFRLIQRSSQCHFIYNNATSGIE-KAEKSRFLTQLEI 591

Query: 722 LGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR-TYSFSEIKQLIN 780
                       +    +  T++     K+   K P+    LE+  +   S S +   I 
Sbjct: 592 FKAPQH----SVKNHTAVSNTQQKKTILKEVR-KTPQMIEKLESLFQYGISPSALAAYIR 646

Query: 781 DPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK--NTPEINHLMKQ- 837
           +P   Y R +L +  + H ++D      GT+ H+ +  L      K  ++ +I+ ++K+ 
Sbjct: 647 NPIDFYRRYVLDIKEVDHIEEDISFRTHGTVIHDCLDFLYSNYKGKLLDSSDIDSMLKEY 706

Query: 838 ------IIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFV---NIPAK 888
                 + +  F KE L    ++I   +  +    FL  E++I  S + I +   NI  K
Sbjct: 707 PNVIKTLFEKKFPKEALQNGKNLIDFKIAKQQIKRFLIQEKEIVKSNQVIILELENIAEK 766

Query: 889 -MAIESI--GIHLTGFADRIDLLKSGFVDITDYKTG 921
            + I+ I   I L G  DRIDL  +  + I DYKTG
Sbjct: 767 SITIDDIDFSIKLKGAVDRIDLCNNQ-LRIIDYKTG 801


>gi|241662729|ref|YP_002981089.1| hypothetical protein Rpic12D_1125 [Ralstonia pickettii 12D]
 gi|240864756|gb|ACS62417.1| conserved hypothetical protein [Ralstonia pickettii 12D]
          Length = 947

 Score = 63.9 bits (154), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 118/571 (20%), Positives = 218/571 (38%), Gaps = 56/571 (9%)

Query: 369 EEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSS 428
           +EA   A  L   L+  ++  AL+  DR +ARRV+  L R  + +    G  LSTT  ++
Sbjct: 302 DEAAFAAHTLVDWLNAGRRSLALVAQDRIVARRVRALLARVNVPVRDETGWKLSTTRAAA 361

Query: 429 ILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDL 488
            L   ++ +    D  A+  L+K P           + A  A     +R +  S     L
Sbjct: 362 ALMRWVDVVQGDGDTAALLDLIKSPFCLRDADAGTATPAWVAELERRVRRHNVSGGWGRL 421

Query: 489 KSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNL 548
           + LV DR A+          ++++S     L VL  +  L                 G+ 
Sbjct: 422 RRLVTDRPASDAEG------EAKVSRLADRLGVLADEAALW-------------RRAGSA 462

Query: 549 SISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-----IETGSCIKANAI 603
            +  W  L    L  + +     L N   ++ G+ L     ++       T +  + +  
Sbjct: 463 KLDAWVALLAGTLDRLHM--RTGLQN---DDAGRQLLDWIDRLRTSIHGSTDAGARYSLT 517

Query: 604 EWIDIITRLIDGETV-KPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
           EW  +++ L++     +P       + IL    +R+  FD +++ G ++   P    +  
Sbjct: 518 EWRALLSMLLESAVFSEPSPPADRRVVILPLNGARMRRFDGVVVVGCDDAQLPSAQPEWL 577

Query: 663 FLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIPTIASRWLQRL- 719
           F S  ++ +L L    +   Q A D    + N    ++  +       P   S WL+RL 
Sbjct: 578 FFSNDVRRELGLPDRAQRFAQQARDLAEVLLNQPEVVLTWQRHGGRGEPHRLSGWLERLQ 637

Query: 720 --LVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
             L + G     ++          T     TT QP    P P  P    P T S +    
Sbjct: 638 RRLAVSGVRIDTSV----------TLPSLQTTSQP-TDMPAPAAPTLV-PSTLSAAAYNS 685

Query: 778 LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNII----TELIKKRINKNTPEINH 833
           L   PY  +  R+L+L  +     + ++ D G + H I+     +L++  ++     ++ 
Sbjct: 686 LRRCPYQFFVGRMLRLGELEEVSDELEKRDIGGILHAILHRFHRQLLETPMHDPADRLS- 744

Query: 834 LMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSS---IEKIFVNIPAKMA 890
           L++ I D  F          + +   +  +  S+L  +   ++     E   V++   + 
Sbjct: 745 LLQTITDEQFGPLLAEDGNALRFYRRWLGVMPSYLAWQAAREADGWRFEAGEVDVDTSIT 804

Query: 891 I-ESIGIHLTGFADRIDLLKSGFVDITDYKT 920
           + +   + L G  DRID+     V + DYKT
Sbjct: 805 LSDERALRLRGRIDRIDVHDEHGVAVLDYKT 835


>gi|299067241|emb|CBJ38438.1| putative helicase, C_term RecB family exonuclease [Ralstonia
           solanacearum CMR15]
          Length = 966

 Score = 63.9 bits (154), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 129/585 (22%), Positives = 219/585 (37%), Gaps = 76/585 (12%)

Query: 369 EEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSS 428
           +EA   A  L   L+  ++  AL+  DR +ARRV+  L R  + +    G  LSTT  ++
Sbjct: 305 DEAAFAAHTLVDWLNAGRRSLALVAQDRIVARRVRALLARVNVPVRDETGWKLSTTRAAA 364

Query: 429 ILTSLLNAIFKLNDFMAIATLVKHP--LAKFGFPEKYLSRAKNALELVALRGNKNSYDIM 486
            L   ++ +    D  A+  L+K P  L     P          LE    R N  S    
Sbjct: 365 ALMRWIDVVQGDGDTAALLDLLKSPFCLRDAEAPSSVAPAWVAELERRVRRRNV-SGGWG 423

Query: 487 DLKSLVLDR-----IATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNK 541
            L+ LV  R     +A   +    P    RL+E    L +L  +  L             
Sbjct: 424 RLRRLVAPRGTDTEVAEAADTGDGPP-AGRLAER---LGLLADEAALW------------ 467

Query: 542 NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSCIKA 600
               G+ ++  W    VT L    LD  R    L  ++ G+ L     ++ +       A
Sbjct: 468 -RRAGHATLEAW----VTLLAGT-LDRLRMRAGLQNDDAGRQLLDWLDRLRVSVHGSADA 521

Query: 601 NA----IEWIDIITRLIDGETV-KPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
            A     EW  +++ L++     +P       + IL    +R+  FD +++ G ++   P
Sbjct: 522 GARFSLQEWRALLSMLLESAVFSEPAPPADRRVVILPLNGARMRRFDGVVVVGCDDAQLP 581

Query: 656 KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIPTIAS 713
               +  F S  ++ +L L    +   Q A D    + N    ++  +       P   S
Sbjct: 582 SAQPEWLFFSNDVRRELGLPDRAQRFAQQARDLAEVLLNQPEVVLTWQRHGGRGEPNRLS 641

Query: 714 RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDY--------TTKQPHYKRPKPFPPLEA 765
            WL+RL           L   G        ++D         T +QP    P P  P+  
Sbjct: 642 GWLERLQ--------RRLAAAGM-------RIDVPVVLPALQTARQP-TDMPAPAAPVLV 685

Query: 766 QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRIN 825
            P T S +    L   PY  +  R+L+L  +     + ++ D G + H I+    ++ + 
Sbjct: 686 -PSTLSAAAYNSLRRCPYQFFVGRMLRLGELEEVSDELEKRDIGEVLHAILHRFHRQLL- 743

Query: 826 KNTPEINHLMKQIIDSHFEKENLPP------HIDIIWRHLFHKISHSFLEHEEKIQSS-- 877
            +TP  + + +  +      E   P      H+   +R  +  +  S+L  +   ++   
Sbjct: 744 -DTPMADPVDRFALLQTLTDERFAPLLAEDGHVLRFYRR-WQGVMPSYLAWQAAREADGW 801

Query: 878 -IEKIFVNIPAKMAIESI-GIHLTGFADRIDLLKSGFVDITDYKT 920
             E   V+  A +A+     +HL G  DRID      V + DYKT
Sbjct: 802 RFEAGEVDAEASIALTGAPALHLRGRIDRIDTHPEHGVAVLDYKT 846


>gi|74316052|ref|YP_313792.1| DNA helicase/exodeoxyribonuclease V subunit B [Thiobacillus
           denitrificans ATCC 25259]
 gi|74055547|gb|AAZ95987.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 836

 Score = 63.2 bits (152), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 124/600 (20%), Positives = 227/600 (37%), Gaps = 81/600 (13%)

Query: 345 LENKIPNIQKCFSDVALIE------ADNEREEAISIAIALRMSLDENKKKSALITADRNL 398
           L+ +   +   F+D  ++E      A +   EA ++A  +   L   ++  ALI  DR  
Sbjct: 200 LQARATALATRFADSPVVEQITVAPAPHLEAEARAVASWVAAQLRAGRQALALIALDRET 259

Query: 399 ARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFG 458
           ARRV+  L R  + +    G  LSTT+ ++++   L  +      + +  L+K P     
Sbjct: 260 ARRVRALLERLDVLVADETGWALSTTVAAAVVDRWLECVASDFPHVELLDLLKSPFVL-- 317

Query: 459 FPEKYLSRAKNALEL-VALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDK 517
             +   +R    L+L +ALR  + +    D+     +R+A Q+    +P W + L +  +
Sbjct: 318 --DDPAARQDQVLQLELALRRQRVAQGAADI-----ERVARQEFGA-LPAWLASLFDARQ 369

Query: 518 ELA------VLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRK 571
             A       L +  +   +  L      +    G   +     L     +++  D  + 
Sbjct: 370 RFARTSAPLALWLQRLADSLDQLAARAPLEADAAGARVLETLAALG----RDLAQDSEKY 425

Query: 572 LPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFIL 631
             N W    G  L S  +  ++ G                 +D           S + + 
Sbjct: 426 DFNEWRRWLGLALES--ASFVDAG-----------------VD-----------SPIVLT 455

Query: 632 GTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMA 691
               +R  +FD + + G +    P       F S+  +  L L+T+      A  D    
Sbjct: 456 SLPAARGRSFDAIAVIGADARHLPALPTPGLF-SQATRRQLGLRTSADDAADAVTDLIAL 514

Query: 692 NGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQ 751
            G    + +     ++ P  AS  + RL  L    +   L ++G            +T  
Sbjct: 515 LGQGPALLSWRAWNDDEPNPASPLVLRLQALHLAAWSSALPEQGIG----EPPARASTLP 570

Query: 752 PHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTL 811
               RP P  P    PR YS +  + L++ PY  +AR +L +  +       D++D G  
Sbjct: 571 GRCTRPAPVVPAARLPRRYSPTAYQTLLDCPYHFFARAVLGIRELDEADDALDKSDYGNA 630

Query: 812 FHNIITELIKKRINKNTPEINHLMK-QIIDSHFEKE--NLPPHIDIIWRHLFHKISHSFL 868
            H I+     KR +   P  +      ++D+  E E   LP +    WR  +  I+ +++
Sbjct: 631 LHRIL-----KRFHDGDPPHDPAQALALLDACAEAEFAALPAYTAAAWRSKWSAIAPAYV 685

Query: 869 E------HEEKIQSSIEKIFVNIPAKMAIESIG-IHLTGFADRIDLLKSGFVDITDYKTG 921
           +       E    +S E  F      +A+  +G + L G  DR+D  +   + + DYKTG
Sbjct: 686 DAWLEWAGEGWRHASSESEFA---VAVAVAGLGEVTLHGRVDRVD-RRGDALAVIDYKTG 741


>gi|86143637|ref|ZP_01062013.1| hypothetical protein MED217_00050 [Leeuwenhoekiella blandensis
           MED217]
 gi|85829680|gb|EAQ48142.1| hypothetical protein MED217_00050 [Leeuwenhoekiella blandensis
           MED217]
          Length = 900

 Score = 61.6 bits (148), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 143/326 (43%), Gaps = 22/326 (6%)

Query: 611 RLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQS 670
            L+  ET+  K +    L I+G LESR+L+F  +I+  LNEG +P   ++N F+   ++ 
Sbjct: 481 ELLSQETLDFKGDPYQGLQIMGVLESRVLDFKNIIITSLNEGTFPSGKSQNSFIPFDLKI 540

Query: 671 DLNLKTA-EKYIGQAAHDFEMANGTR--HLIYTRSLRENNIPTIASRWLQRLLVLGGTDF 727
           +  L T  EK    A H F +    +  +LIY      N    + S    R L+   TD 
Sbjct: 541 EAKLPTYREKDAIYAYHFFRILQRAQKVNLIYN-----NEAGGLNSGEKSRFLLQLATDP 595

Query: 728 FDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT-YSFSEIKQLINDPYAVY 786
               + + Q           T KQ   K P+    ++    + +S S +   I +P   Y
Sbjct: 596 NARYQYQEQSASAPVSLEPVTLKQVE-KTPEIIEAIKKHAASGFSPSALSTYIRNPIDFY 654

Query: 787 ARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE--INHLMKQI------ 838
            + +L ++ +   +        GT+ H  +  L K  +N    E  +  ++KQ+      
Sbjct: 655 YKYVLGVEELEAVEDVIAHNTLGTVVHESLENLYKPYLNTILTEEILQQILKQVNAEVQH 714

Query: 839 -IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE-EKIQSSIEKIFVNIPAKMAIE-SIG 895
             + H+   N+    ++I  ++  +   +FL  E + ++S  E I   + AK  I+ +  
Sbjct: 715 QFELHYNALNIKTGKNLIIFNVAKQFVLNFLNLELQSVKSGKEIIIKALEAKYTIQLTPE 774

Query: 896 IHLTGFADRIDLLKSGFVDITDYKTG 921
           I L G  DR+D L++    I DYKTG
Sbjct: 775 IKLKGTVDRLD-LENKVTRILDYKTG 799


>gi|17545908|ref|NP_519310.1| hypothetical protein RSc1189 [Ralstonia solanacearum GMI1000]
 gi|17428203|emb|CAD14891.1| probable homologous recombinational repair protein [Ralstonia
           solanacearum GMI1000]
          Length = 962

 Score = 60.5 bits (145), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 128/584 (21%), Positives = 216/584 (36%), Gaps = 74/584 (12%)

Query: 369 EEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSS 428
           +EA   A  L   L+  ++  AL+  DR +ARRV+  L R  + +    G  LSTT  ++
Sbjct: 305 DEAAFAAHTLVDWLNAGRRSLALVAQDRIVARRVRALLARVNVPVRDETGWKLSTTRAAA 364

Query: 429 ILTSLLNAIFKLNDFMAIATLVKHP--LAKFGFPEKYLSRAKNALELVALRGNKNSYDIM 486
            L   ++ +    D  A+  L+K P  L     P          LE    R N  S    
Sbjct: 365 ALMRWIDVVQGDGDTAALLDLLKSPFCLRDAEAPSSVAPAWVAELERRVRRHNV-SGGWG 423

Query: 487 DLKSLVLDR-----IATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNK 541
            L+ LV  R     +A   +    P    RL+E       LL D   Q            
Sbjct: 424 RLRRLVALRGTDTDVAEAADTGDGPP-AGRLAERLG----LLADEAAQW----------- 467

Query: 542 NSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSCIKA 600
               G+ ++  W    VT L    LD  R    L  ++ G+ L     ++ +       A
Sbjct: 468 -RRAGHATLEAW----VTLLAGT-LDRLRMRAGLQNDDAGRQLLDWLDRLRVSVHGSADA 521

Query: 601 NA----IEWIDIITRLIDGETV-KPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
            A     EW  +++ L++     +P       + IL    +R+  FD +++ G ++   P
Sbjct: 522 GARFSLQEWRALLSMLLESAVFSEPAPPADRRVVILPLNGARMRRFDGVVVVGCDDAQLP 581

Query: 656 KNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIPTIAS 713
               +  F S  ++ +L L    +   Q A D    + N    ++  +       P   S
Sbjct: 582 SAQPEWLFFSNDVRRELGLPDRAQRFAQQARDLAEVLLNQPEVVLTWQRHGGRGEPNRLS 641

Query: 714 RWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDY--------TTKQPHYKRPKPFPPLEA 765
            WL+RL           L   G        ++D         T +QP    P P  P+  
Sbjct: 642 GWLERLQ--------RRLAAAGM-------RIDVPVVLPALQTARQP-TDMPAPAAPVLV 685

Query: 766 QPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRIN 825
            P T S +    L   PY  +  R+L+L  +     + ++ D G + H I+    ++ + 
Sbjct: 686 -PSTLSAAAYNSLRRCPYQFFVGRMLRLGELEEVSDELEKRDIGEVLHAILHRFHRQLL- 743

Query: 826 KNTPEIN-----HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSS--- 877
            +TP  +      L++ + D  F          + +   +  +  S+L  +   ++    
Sbjct: 744 -DTPMADPADRLALLQALTDERFAPLLAEDGHALRFYRRWQGVMASYLAWQAAREADGWR 802

Query: 878 IEKIFVNIPAKMAIESI-GIHLTGFADRIDLLKSGFVDITDYKT 920
            E   V+  A +A+     + L G  DRID      V + DYKT
Sbjct: 803 FEAGEVDADASIALPGAQALRLRGRIDRIDTHPEHGVAVLDYKT 846


>gi|189463366|ref|ZP_03012151.1| hypothetical protein BACCOP_04083 [Bacteroides coprocola DSM 17136]
 gi|189429795|gb|EDU98779.1| hypothetical protein BACCOP_04083 [Bacteroides coprocola DSM 17136]
          Length = 972

 Score = 60.5 bits (145), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 141/639 (22%), Positives = 246/639 (38%), Gaps = 89/639 (13%)

Query: 358 DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
           +V  IE+  E  +   +   +R +L   +K++A++  +  L + V   L     +I+I+ 
Sbjct: 296 EVTFIESPTENGQVRYLPQWIRENLTSQEKETAVVLCNEALLQPVLHALPDNVKHINITM 355

Query: 418 GIPLSTTLHSSILTSLL---NAIFKLND----FMAIATLVKHPLAKFGFPEKYLSRAKNA 470
           G PLS T   S + +L+    + +  N+    F  + +++KHP  +       LS     
Sbjct: 356 GFPLSQTPAYSFVNALMELHTSGYNPNNGRYLFAEVISVLKHPYTR------QLSPEAEK 409

Query: 471 LELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQC 530
           LE    R N+                         P     L  E K+      D++L+ 
Sbjct: 410 LEQNLTRDNR-----------------------FYP-----LPSELKQ------DNVLEL 435

Query: 531 ITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKT--LSSLF 588
              L T + N    C  LS  +  K      Q            L+ E   KT  L + F
Sbjct: 436 ---LFTPRRNNLDLCSMLS--EALKEVAVIYQQQAASHSDAFDQLYRESLFKTYTLVNRF 490

Query: 589 SKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGG 648
             +IE+   +   A  +  ++TR++   ++    E +  + ++G LE+R L+F  LI+  
Sbjct: 491 HTLIESKE-LNVQAGTFQRLLTRVMSSSSIPFHGEPAIGMQVMGVLETRNLDFRHLIMLS 549

Query: 649 LNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTR-HLIYTRSLRE 705
           +NEG  PK    + F+   ++    + T +  I   A+ F   M    +  L+Y  +   
Sbjct: 550 VNEGQLPKAGGDSSFIPYNLRKAFGMTTIDHKIAVYAYYFYRLMQRAEKVTLVYNTATDG 609

Query: 706 NNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH-YKRPKPFPPLE 764
            N   + SR++ + L+  G        +  Q   D T  +    K P   +R K    + 
Sbjct: 610 INRGEL-SRFMLQFLIEWGYPVLRKQLEAAQSPQDSTPII--IEKTPDVMERMKSVFDIR 666

Query: 765 AQPRTY-SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK-- 821
             P+   S S +   ++ P   Y + +  L        D D    G++FH     + K  
Sbjct: 667 NNPKALISPSALNCYLDCPLKFYYKYVALLSAPDEVTADIDSAKFGSIFHYAAEHIYKAL 726

Query: 822 ----KRINKNTPEI----NHLMKQIIDSHFEK--ENLPPH-------IDIIWRHLFHKIS 864
               K I+K   E        ++  +D+ F++   NLPP+       I +I   +  K  
Sbjct: 727 TAHGKLISKENLETLLKDEVRLQTYVDNGFKELFFNLPPNEQPEYNGIQLINSAVIVKYI 786

Query: 865 HSFLEHEEKIQ-----SSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYK 919
              L ++ +        S ++IF NI    +   I   + G  DRID  K   + I DYK
Sbjct: 787 QQLLRNDLRYAPFTFVGSEQRIFENIEICTSTGDIQSRIGGIIDRID-SKGESLRIVDYK 845

Query: 920 T-GDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKV 957
           T GD       Q L  P         +   ++ I C+K+
Sbjct: 846 TGGDADTPANVQSLFIPDKKRSNYVFQTFLYASIVCKKL 884


>gi|126662604|ref|ZP_01733603.1| hypothetical protein FBBAL38_04595 [Flavobacteria bacterium BAL38]
 gi|126625983|gb|EAZ96672.1| hypothetical protein FBBAL38_04595 [Flavobacteria bacterium BAL38]
          Length = 925

 Score = 60.1 bits (144), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 156/348 (44%), Gaps = 54/348 (15%)

Query: 608 IITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
           I  ++ID   V  + E  S L ++G LESR+L+F+ +I+  +NEG +P   ++N F+   
Sbjct: 494 IYKQIIDLAEVSFEGEPLSGLQVMGVLESRVLDFENVIITSVNEGKFPAGKSQNSFIPYD 553

Query: 668 MQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDF 727
           ++ +L L T ++      + F       HL+    LR  N+      WL       G D 
Sbjct: 554 VKKELGLPTYKEKDAIYCYHF------YHLL----LRAKNV------WLLYNTDNEGIDA 597

Query: 728 FDNLKKRGQCYLDWTRKLDYTTKQPHYKR---PKPFPPLE--------------AQPRTY 770
            +  K R    L+  ++  +T     Y      K + P+               A  + +
Sbjct: 598 GE--KSRFITQLEIEKQPKHTITSTIYNAVLPEKAYEPVTIPKTDKILTRLQEIASEKGF 655

Query: 771 SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE 830
           S S +   I +P   Y +RIL+++     +++      GT+ HN + EL    +N+    
Sbjct: 656 SPSSLTNYIRNPLQFYMQRILRINEAEDVEENIAANTLGTIIHNALEELYTPYLNQFLA- 714

Query: 831 INHL------MKQIIDSHFEKENLPPHI----DIIWRHLFHKISHSFLEHEEKIQSSIEK 880
           ++H+      + ++I  HF++      I    +++   +  +  ++FL+ E+K   + + 
Sbjct: 715 LHHIEAMETKIDEVILKHFKEIYKEGEITKGKNLLAFEVAKRNVYNFLQVEKKDIEAGQA 774

Query: 881 IFV-----NIPAKMAIES--IGIHLTGFADRIDLLKSGFVDITDYKTG 921
           I V     ++  ++ ++S    I + G  DRI+  ++G + I DYKTG
Sbjct: 775 IKVLLLEASLSCEIEVKSFPFPIKIAGKVDRIE-ERNGAIRIIDYKTG 821


>gi|86134921|ref|ZP_01053503.1| conserved hypothetical protein [Polaribacter sp. MED152]
 gi|85821784|gb|EAQ42931.1| conserved hypothetical protein [Polaribacter sp. MED152]
          Length = 912

 Score = 60.1 bits (144), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 150/335 (44%), Gaps = 37/335 (11%)

Query: 611 RLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQS 670
           +LID E++  + E    L ++G LE+R+L+F+ +IL   NEGV P ++ +N F+   ++ 
Sbjct: 482 QLIDSESLSFQGEPLKGLQLMGMLETRVLDFENVILTSANEGVLPASSQQNSFIPFDVKI 541

Query: 671 DLNLKTA-EKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIA--SRWLQRLLVLGGTDF 727
           +  L T  EK    + H F +    ++ IY     E+++      SR++ +L +L  TD 
Sbjct: 542 EFGLPTYREKDAIFSYHFFRLMQRAKN-IYILYNTEHDVFGSGEKSRFVTQLEMLR-TDI 599

Query: 728 FDNL---KKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPL-EAQPRTYSFSEIKQLINDPY 783
              +   K   Q          +T  +   K       L E     +S S +   + +P 
Sbjct: 600 VHKIVSPKVVAQ----------HTALKQVAKNNDVLERLKEIAKSGFSPSSLTNYLYNPI 649

Query: 784 AVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK-----NTPEINHLMKQI 838
           A Y ++ILK+      ++       GT+ H  + EL K  + K     N  E+  + K +
Sbjct: 650 AFYKQKILKIKEFDDVEETVAYNTLGTIVHETLDELYKPFVGKFLQEENVEEMQKIAKDL 709

Query: 839 IDSHFEKENLPPHIDIIWRHLFHKISHSFLEH----------EEKIQSSIEKIFVNIPAK 888
           I  +F+ E     I      L  ++++ F+ +          +E  Q  I     N+ A+
Sbjct: 710 IIKYFKIEFKNGDISTGKNRLIFEVANRFVANFLTKERALLKDENNQLKIVATEENLSAE 769

Query: 889 MAIESIG--IHLTGFADRIDLLKSGFVDITDYKTG 921
           + ++ +   I L G  DR+D L +G + I DYK+G
Sbjct: 770 ITVDGLDFPIKLHGNVDRVDEL-NGELRIIDYKSG 803


>gi|227536349|ref|ZP_03966398.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227243725|gb|EEI93740.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 979

 Score = 60.1 bits (144), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 147/331 (44%), Gaps = 47/331 (14%)

Query: 626 STLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAA 685
           S L ++G LE+R LNFD +++ GLN+G+ P+N+  N F+   ++    L   E     +A
Sbjct: 535 SGLQVMGLLETRNLNFDHVVILGLNDGIIPQNSVGNSFIPDSLRRAYGLPVLENQDAISA 594

Query: 686 HDF-EMANGTRHLIYT-RSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTR 743
           + F  +    + L +   SL + +     SR+L++L      +F  N + R   Y D   
Sbjct: 595 YIFYRLVQRAQKLSFVYNSLTDESNTGEPSRFLKQL------EFESNFEFR---YQDQHL 645

Query: 744 KLDYTTKQPHYKRPKPFPPLE------AQPRTYSFSEIKQLINDPYAVYARRILKLDFIP 797
           ++    +Q     PK    ++      +  RT S S +   I +P   + + + ++    
Sbjct: 646 QIKVEDQQ-ELVIPKTTVIMDKLGLYLSGNRTLSASALTTYIANPIDFFYKYVAEISEPE 704

Query: 798 HFKKDPDRTDRGTLFHNIITEL---IKKRINKNTPE-INHLMK---QIIDSHFEKENLPP 850
              +  +  + GT+ H  + +    +K   N  +PE I    K   ++I+ +F KE  P 
Sbjct: 705 EVNEVVEANNLGTILHGAMEDFYNQLKAESNFISPERIAQKRKDLTKLIEHNFIKEFYPE 764

Query: 851 -----HIDIIWRHLFHKIS---HSFLEHEEK------IQSSIEKIFVNIPAKMAIESIG- 895
                H   I R +   +    H  L+H+E+      +Q   E I   +P +   +S G 
Sbjct: 765 NTKKIHFTGIQRVIMAIVKEYIHIILDHDERSAPFTILQMEEEMI---VPFEFN-DSYGR 820

Query: 896 ---IHLTGFADRIDLLKSGFVDITDYKTGDN 923
              IH+ G  DR+D+ + G   I DYKTG +
Sbjct: 821 KQIIHMKGIIDRVDIGQDGVTRIVDYKTGSD 851


>gi|56416656|ref|YP_153730.1| hypothetical protein AM419 [Anaplasma marginale str. St. Maries]
 gi|56387888|gb|AAV86475.1| hypothetical protein AM419 [Anaplasma marginale str. St. Maries]
          Length = 946

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 142/751 (18%), Positives = 287/751 (38%), Gaps = 137/751 (18%)

Query: 245 LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
           LM +V++     IVLP +D  +    W T+             +S H QY + +LL  L 
Sbjct: 217 LMHSVSD---AVIVLPYVDLGLSDREWQTL-------------HSEHYQYYVMQLLKDLG 260

Query: 305 IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
           + R +V+RLG V       + V+ + F         N ++  +   N      D+ LI  
Sbjct: 261 VGRNEVERLGQVKV-----NHVVERLF---------NFELTSHLAMNYGT-GEDIELIAC 305

Query: 365 DNEREEAISIAIALRMSLDENKKKS------------------ALITADRNLARRVKLEL 406
            +E EEA+ +   L+    E  + +                    +  D++  R ++ + 
Sbjct: 306 SSEAEEAVKVVEILKSCTTEAHRGAKAEFSCIGGWAASAKPTQTAVDVDKDTIRSLEGKS 365

Query: 407 TRF------GINIDISAGIPLSTTLHSSILTSL----LNAIFKLNDFMAIATLVKHPLAK 456
             F         +D    I  +   +  I+++L    +  +    D + +  ++KHPL +
Sbjct: 366 VTFVGSDSLAARVDALLRIGANYCDYDEIISALVLCSIEVVVSSGDAVQLLCMLKHPLVR 425

Query: 457 FGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEED 516
            G+      +     E+  +RG+  +      +++                  S + EE 
Sbjct: 426 LGYDADEYCKLLAEFEIRVVRGHSAA----GFEAI-----------------GSAIREEF 464

Query: 517 KELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLW 576
           ++L      ++++ I+P+V  +  + ST G ++ +      V CL+ + +D   KL    
Sbjct: 465 QQLEEFW-RNVVEAISPMVAVR--EGSTIGEIAAAH-----VQCLERL-MD---KLDTSA 512

Query: 577 FEEEGKTLSSLFSKIIETGSCIKANAIE---WIDIITRLIDGETVKPKIEKSSTLFILGT 633
                  +S+ FS  +    C+         + ++ T L+        +E++    +   
Sbjct: 513 CTHALNKISTFFS--LFDNYCVGVAVFSLTSYKEVCTLLVRAFFT---VERNKLFGV--N 565

Query: 634 LESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANG 693
           L +R    D  +L G +E  +    +    L+  ++  L L   E+Y G+  +       
Sbjct: 566 LATR----DAAVLAGFSEAEFKPRCSH--LLNNWVRERLGLPLLEEYCGRMMYVLYSFFY 619

Query: 694 TRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH 753
            + L  T+S +   +      W++ L  L        LK R + Y      +        
Sbjct: 620 AKKLRITKSAKSFGVAVAEPIWIRYLTFL--------LKDRTERYAATQAVVGSNVVTDP 671

Query: 754 YKRPKPFPPLEAQPRTYSF---SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRG- 809
           Y+   P P L+ + +  S      +  LI++PY  Y + ILK+   P    +     RG 
Sbjct: 672 YRASAPNPGLDVRKKAMSVLTAKAVDTLISNPYVFYVQYILKM--FPTKTVNTQHLVRGF 729

Query: 810 -TLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSF 867
             + H I+ E +   I     + N L+ +I    F+   +  P+  ++W   F +++ +F
Sbjct: 730 NIIAHKILREYLVS-IGTEAGDYN-LLLEIAKRQFDAIAVTHPYAHVLWWPKFKEMARNF 787

Query: 868 --LEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPK 925
             ++ E +  +S  +   +    ++ E   I +    DR++ +K G V +   K G  P 
Sbjct: 788 FAVDSERRYAASRTESGKSFVWHVSEE---IQVIARCDRVEYMKDGSVMVACNKVGAAPS 844

Query: 926 KE------TAQKLIDPQLSLEAAALKAGSFS 950
           K        ++ ++D     E+      SF+
Sbjct: 845 KADMRCGFASRAIVDAVCVAESTGANVASFA 875


>gi|332829180|gb|EGK01844.1| hypothetical protein HMPREF9455_01992 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 963

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 142/339 (41%), Gaps = 27/339 (7%)

Query: 605 WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFL 664
           +  ++ +LI G +V  + E  S L I+G LE+R L+FD LI+  +NEG++P   A + F+
Sbjct: 509 YFKLLRKLIVGISVPFRGEPLSGLQIMGVLETRALDFDNLIILSMNEGIFPLKKAASSFI 568

Query: 665 SRVMQSDLNLKTAEKYIG-QAAHDFEMANGTRHLIYTRSLRENNIPTI-ASRWLQRLLVL 722
              ++   +L T E      + H + M N  + +      R   + T   SR+  ++  L
Sbjct: 569 PYNLRKGFDLPTYEHQDSIFSYHFYRMINRAKRIYLLYDTRTEGLQTGEVSRYYNQIKHL 628

Query: 723 GGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDP 782
              D FD  +K     +  T  L  + ++      K    L+   +  S S I   +N P
Sbjct: 629 YN-DSFDIREKLAVYKVSSTESLAISIQKTPQIMEKMNVFLQGGDKRLSASSINTYLNCP 687

Query: 783 YAVYARRILKLDFIPHFKKDPDRTDRGTLFHNII--------TELIKKRINKNTPEINHL 834
              Y   +  ++      +  + +  GT+FH+I+         ++I   +  N  + N L
Sbjct: 688 LQFYFSVVENMEEEDEIAETIEASTFGTIFHSIMEWLYEPFKGKMITADLLHNISKNNKL 747

Query: 835 MKQIIDSHF-------EKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSI-----EKIF 882
           + ++I+  F       EK       + +   +  K     L  + K+   I     E+I 
Sbjct: 748 LTEMIERSFAENYFKSEKVKRLTGQNYLTGEVLRKYIRQVLATDAKLTPFIYIDSEERIK 807

Query: 883 VNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTG 921
            + P         + L G  DR+D + SG   I DYKTG
Sbjct: 808 KDYPLP---SGKVVSLKGIIDRVDEV-SGHTRIIDYKTG 842


>gi|300771530|ref|ZP_07081405.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300761519|gb|EFK58340.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 979

 Score = 59.7 bits (143), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 142/330 (43%), Gaps = 45/330 (13%)

Query: 626 STLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAA 685
           S L ++G LE+R LNFD +++ GLN+G+ P+N+  N F+   ++    L   E     +A
Sbjct: 535 SGLQVMGLLETRNLNFDHVVILGLNDGIIPQNSVGNSFIPDSLRRAYGLPVLENQDAISA 594

Query: 686 HDF-EMANGTRHLIYT-RSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTR 743
           + F  +    + L +   SL + +     SR+L++L      +F  N + R   Y D   
Sbjct: 595 YIFYRLVQRAKKLSFVYNSLTDESNTGEPSRFLKQL------EFESNFEFR---YQDQHL 645

Query: 744 KLDYTTKQPHYKRPKPFPPLE------AQPRTYSFSEIKQLINDPYAVYARRILKLDFIP 797
           ++    +Q     PK    ++      +  RT S S +   I +P   + + + ++    
Sbjct: 646 QIKVEDQQ-ELVIPKTTAIMDKLGLYLSGERTLSASALTTYIANPIDFFYKYVAEISEPE 704

Query: 798 HFKKDPDRTDRGTLFHNIITELIKK-----------RINKNTPEINHLMKQIIDSHFEKE 846
              +  +  + GT+ H  + +   +           RI +   E++ L++      F  E
Sbjct: 705 EVNEVVEANNLGTILHGTMEDFYNQLKAESNFISPERIAQKRKELSKLIEHNFIKEFYPE 764

Query: 847 NLPP-HIDIIWRHLFHKIS---HSFLEHEEKIQSSIEKIFVNIPAKMAI-----ESIG-- 895
           N    H   I R +   +    H  L+H+E+   +     + +  +M +     +S G  
Sbjct: 765 NTKKIHFTGIQRVIMAIVKEYIHIILDHDER---AAPFTILQMEEEMTVPFEFNDSNGRK 821

Query: 896 --IHLTGFADRIDLLKSGFVDITDYKTGDN 923
             IH+ G  DR+D+ + G   I DYKTG +
Sbjct: 822 QVIHMKGIIDRVDIGQDGVTRIVDYKTGSD 851


>gi|254785005|ref|YP_003072433.1| hypothetical protein TERTU_0822 [Teredinibacter turnerae T7901]
 gi|237686099|gb|ACR13363.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 909

 Score = 59.7 bits (143), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 77/361 (21%), Positives = 147/361 (40%), Gaps = 50/361 (13%)

Query: 626 STLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAA 685
           S + ILG+LE+  L FD L + GL++  WP   + NP L   +Q               A
Sbjct: 487 SPVQILGSLEAAGLPFDQLWVMGLDDEAWPPAPSPNPLLPLAVQ--------------VA 532

Query: 686 HDFEMANGTRHLIYTRSLRENNIPTI--------ASRWLQRLLVLGGTDFFDNLKKRGQC 737
           H+   ++  R   Y R+L +  + +         A+R  ++L        F   ++    
Sbjct: 533 HNTPQSSAEREFRYARNLTQRWLASASQVTFSYAATRDDKQLQPSPLVQAFAQTREAVPL 592

Query: 738 YLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIP 797
           +  W +    + +    +        E Q      + ++     P+  +AR  L+   +P
Sbjct: 593 FTAWEQLQWQSREMESIEDTNAGGVAEVQRIRGGAAILRDQAACPFQAFARHRLRASEVP 652

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNT---PEINHLMKQIIDSHFEKENLPPHIDI 854
                 D  +RG L H+ + E++ +++        + N  +  ++D     E +   +  
Sbjct: 653 EVVLGLDAAERGNLLHHAM-EIVWRKLGDQAGLLAQSNERLLALVD-----EAIADALRD 706

Query: 855 IWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESI------------GIHLTGFA 902
           I R  F  +   F+E E +  + +   ++ +  K A  ++            G+ L+   
Sbjct: 707 IRRKSF--VGFRFVELETRRLAGLVCAWLELEKKRAPFTVVFNESRKDLTLAGLPLSVRY 764

Query: 903 DRIDLLKSGFVDITDYKTGDNPKKE-TAQKLIDPQLSLEAAA----LKAGSFSQIDCRKV 957
           DR+D L  G + + DYKTG    K    ++   PQ+ L A A    + A +F+QI+ R++
Sbjct: 765 DRVDALADGGLFVIDYKTGLTAVKSWEGERPDQPQVPLYAIANREKVVAAAFAQINSREI 824

Query: 958 A 958
           A
Sbjct: 825 A 825


>gi|152981969|ref|YP_001352314.1| hypothetical protein mma_0624 [Janthinobacterium sp. Marseille]
 gi|151282046|gb|ABR90456.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 892

 Score = 59.3 bits (142), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 127/587 (21%), Positives = 221/587 (37%), Gaps = 92/587 (15%)

Query: 359 VALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAG 418
           ++L  A N   EA + A  +   L + K   A++  DR +ARR++  L R  + +    G
Sbjct: 274 LSLYAAHNLEAEAKAGAQTIMDWLQQGKTNIAIVAQDRVVARRIRALLERAQVIVADETG 333

Query: 419 IPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRG 478
             LSTT  ++ L S L  +    + +A+   +K P        K  +    A EL   R 
Sbjct: 334 WKLSTTRAAAALASWLELVAARAETIALLDFLKSPFVFANTDNK--ADLVMASELALRRA 391

Query: 479 NKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYK 538
           N     ++    LV D +      T +P  Q+            +V  + Q  T     K
Sbjct: 392 N-----VLGGWELVGDAL------TVIPAAQN------------MVKLLAQQATGFSKGK 428

Query: 539 TNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCI 598
           T          + DW    +T  Q   LD       L  +  G  +  L   I +  + +
Sbjct: 429 T----------LCDW----ITASQQT-LDALGMRGALQADGAGAQVLQLLQDIEQDCTAV 473

Query: 599 KA--NAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPK 656
               +  EW   +   ++  T   ++ +   + +L    +RL +FD ++L G +    P 
Sbjct: 474 GHVFSFAEWRAFLNLQLEA-TAYVQLNRDRRVVMLPLNGARLRSFDAVLLVGADAEHLPS 532

Query: 657 NTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF-EMANGTRHLIYTRSLRENNIPTIASRW 715
              +  F + V++ +L L T E    Q   D  E+      ++ +    +N  P   S W
Sbjct: 533 QPTETLFFANVVRRELGLATRESRQRQQLRDVTELLAANEQVLMSWQAHKNGEPNPVSPW 592

Query: 716 LQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPF--PPLEA---QPRTY 770
           ++RL +        +L + G   +       +    P +  P P   P   A   +P   
Sbjct: 593 IERLEL--------SLARAGLPKI----ARHHVGIAPRHLTPVPLTMPAPHAAALRPHKL 640

Query: 771 SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNT-P 829
           S S    L+  PY  +A R+L L  +      P++ D G   H I+  +   R+++ T  
Sbjct: 641 SASGYNSLVACPYQFFATRMLGLSGLDELSDMPEKRDYGDWLHQILA-IFHTRLHEVTLA 699

Query: 830 EINHLMKQIIDSHFE----------------KENLPPHIDIIWRHLFHKISHSFLEHEEK 873
               L+++I D  F                 ++ +P +++  W          F+  EEK
Sbjct: 700 GRATLLREISDQVFGLALDKSAAALGYYARWQKAMPAYLE--WLAEREAQGWHFVLGEEK 757

Query: 874 IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKT 920
                EKI       +  +   I L G  DR+D   +G   + DYK+
Sbjct: 758 ----FEKI-------LRWDDGEIILHGRVDRMDENATGERAVLDYKS 793


>gi|225012051|ref|ZP_03702488.1| conserved hypothetical protein [Flavobacteria bacterium MS024-2A]
 gi|225003606|gb|EEG41579.1| conserved hypothetical protein [Flavobacteria bacterium MS024-2A]
          Length = 907

 Score = 59.3 bits (142), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 100/393 (25%), Positives = 163/393 (41%), Gaps = 69/393 (17%)

Query: 608 IITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
           +   LI  +T+    +  S L I+G LE+RLL+FD +I+  +NEG+ P       ++   
Sbjct: 477 VFEMLIQNQTLDFSGDALSKLQIMGILETRLLDFDNVIITHVNEGIIPFGKTSVSWIPFD 536

Query: 668 MQSDLNLKTAEKYIGQ----AAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLG 723
           ++    + T   +I Q    A H F +    + +     L   N   + S    R LV  
Sbjct: 537 VKKKFGMNT---FIEQDHLYAYHFFRLLQRAKKVFL---LYNANPEGLFSGEKSRFLV-- 588

Query: 724 GTDFFDNLKKR---GQCYLDWTRKLDYTTKQPHYKRPKPFPPL-EAQPRTYSFSEIKQLI 779
             ++F + K      Q  L +   +D  + +P  K       L E     +S S + Q I
Sbjct: 589 QLEYFKSPKHELTFRQVDLPFNNLID--SVKPAIKTKAVLVQLNEMAKEGFSPSSLTQYI 646

Query: 780 NDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKN------------ 827
            +PY  Y +R+LK+  +   + +    D+GT+ H ++  L    +N++            
Sbjct: 647 RNPYLFYEQRMLKIKPLDTLELNLSAMDKGTIMHKVLEVLYLPFVNQSLSLNDFDQMLHK 706

Query: 828 TPE-----INHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQS------ 876
            PE      N L K   D H   +N      I++R +  +I  SF+  E ++ S      
Sbjct: 707 LPETLKDCFNDLYKN--DDHRTGKN-----HIVFR-VMEQILRSFILMERELVSQGNTLI 758

Query: 877 --SIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTG-----DNPKKE 927
             ++E IF      + +E I   +   G  DRID L +G +   DYKTG     D    E
Sbjct: 759 IKALEHIFC---KPLWVEKIKKEVVFKGTVDRIDSL-NGVLRFVDYKTGNVEANDLAYYE 814

Query: 928 TAQKLIDP------QLSLEAAALKAGSFSQIDC 954
            ++   DP      Q+ L +  LK   FS  DC
Sbjct: 815 MSEVTSDPKKSALFQVFLYSYVLKE-EFSNQDC 846


>gi|218563083|ref|YP_002344862.1| hypothetical protein Cj1482c [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|112360789|emb|CAL35589.1| hypothetical protein Cj1482c [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
          Length = 788

 Score = 58.9 bits (141), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 134/312 (42%), Gaps = 44/312 (14%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK----IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGF 912
           +  F + + +  EH  K    + + +E   +N   K+  +SI   L G  DRID  K G 
Sbjct: 647 KLKFMQFAKNEKEHFSKGFYVVHTELE---LNNILKLGTDSIK--LKGTIDRIDSSKEGN 701

Query: 913 VDITDYKTGDNP 924
           + I DYK+G  P
Sbjct: 702 L-IIDYKSGKVP 712


>gi|144897146|emb|CAM74010.1| helicase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 291

 Score = 58.9 bits (141), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 64/264 (24%), Positives = 105/264 (39%), Gaps = 34/264 (12%)

Query: 406 LTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGF-PEKYL 464
           + R+ I ID SAG PL  T   + L  L  A+       A   L KHPLA  G  P ++ 
Sbjct: 1   MERWDIAIDDSAGRPLMLTEPGAFLRLLAEAVADGFPPHATLALCKHPLAAAGLDPIRFR 60

Query: 465 SRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLV 524
           +  +       LRG + +  +  L+       A    +  +  W               +
Sbjct: 61  ALTRRLETKEILRGPRPAPGLGGLR-------AACAGDARLIGW---------------L 98

Query: 525 DHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLP-NLWFEEEGKT 583
           D +   + P +T    +++      ++D  +  +   + +  D     P  LW  E G+ 
Sbjct: 99  DALESALAPFITLMAAESA-----PLADLLRAHMEAAEALAADHANPGPARLWRGEAGEA 153

Query: 584 LSSLFSKIIETGSCIKANAIE-----WIDIITRLIDGETVKPKIEKSSTLFILGTLESRL 638
           L+     + E  + I A         +  +   L+ G  V+P   +   LFI G +E+RL
Sbjct: 154 LARFAGDLAEALATIGAMFTPLPPRFYPALFDELLSGRVVRPHWGRHPRLFIWGPMEARL 213

Query: 639 LNFDTLILGGLNEGVWPKNTAKNP 662
            + D +IL GLNEG WP     +P
Sbjct: 214 QHADVMILAGLNEGTWPGKAEADP 237


>gi|315927430|gb|EFV06768.1| hypothetical protein CSQ_1123 [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 694

 Score = 58.9 bits (141), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 134/312 (42%), Gaps = 44/312 (14%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 334 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 383

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 384 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 437

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 438 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 495

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 496 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFANLLDKEYQKYNISE-LDLEVF 552

Query: 857 RHLFHKISHSFLEHEEK----IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGF 912
           +  F + + +  EH  K    + + +E   +N   K+  +SI   L G  DRID  K G 
Sbjct: 553 KLKFMQFAKNEKEHFSKGFYVVHTELE---LNNILKLGTDSIK--LKGTIDRIDSSKEGN 607

Query: 913 VDITDYKTGDNP 924
           + I DYK+G  P
Sbjct: 608 L-IIDYKSGKVP 618


>gi|256840087|ref|ZP_05545596.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256739017|gb|EEU52342.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 959

 Score = 58.2 bits (139), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 139/357 (38%), Gaps = 43/357 (12%)

Query: 596 SCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWP 655
           +C++     +  ++ R+ D  T+    E  S L I+G LE+R L+FD LI+  +NEG++P
Sbjct: 495 ACVEMKIDTFFRLLKRVTDTITIPFHGEPLSGLQIMGVLETRALDFDRLIILSMNEGIFP 554

Query: 656 KNTAKNPFLSRVMQSDLNLKTAEKYIGQ-AAHDFEMANGTRHLIYTRSLRENNIPTI-AS 713
           +  A N F+   ++    L T E      A H + +     H+      R N + T   S
Sbjct: 555 QRKAANSFIPYNLRRGFGLPTYEHQDSVWAYHFYRLIERASHVSLLYDTRSNGLQTGEVS 614

Query: 714 RWLQRLLVLGGTDFFD-----NLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
           R++ +L         D     N+       L   ++ D   +   Y++           +
Sbjct: 615 RFVHQLHYHYEVPMRDKLVVYNVSSSKTPPLAVPKREDIMRRLDAYRK--------GGSK 666

Query: 769 TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK------- 821
             S S I   ++ P   Y   +  +       +  +    G++ H ++ EL K       
Sbjct: 667 AISASAINTYLDCPLKFYFSVVEGIREEEEVSETIESDVFGSILHKVMEELYKPFQGKMV 726

Query: 822 -----KRINKNTPEINHLMKQIIDSHFEKENLPPHI---DIIWRHLFHKISHSFLEHEEK 873
                K I K+T  +   + +   S F K  +   +   + +   +  K     LE + K
Sbjct: 727 TVDLLKAIRKDTALLTGAIARAFASEFFKTEVVRSLTGQNYLIGEMIRKYVEKILERDGK 786

Query: 874 IQSSIEKIFVNIPAKMAIESI-------GIHLTGFADRIDLLKSGFVDITDYKTGDN 923
           +       FV I ++  I  +        I L GF DR+D +    + I DYK+G  
Sbjct: 787 LTP-----FVYIESERKINGLISLSDHSEIRLKGFIDRVDEVLDA-IRIIDYKSGSG 837


>gi|163786813|ref|ZP_02181261.1| hypothetical protein FBALC1_16547 [Flavobacteriales bacterium
           ALC-1]
 gi|159878673|gb|EDP72729.1| hypothetical protein FBALC1_16547 [Flavobacteriales bacterium
           ALC-1]
          Length = 919

 Score = 58.2 bits (139), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 82/344 (23%), Positives = 142/344 (41%), Gaps = 49/344 (14%)

Query: 608 IITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
           I   L+  ET+  K E    L I+G LESR+L+F+T+I+  +NEG+ P     N F+   
Sbjct: 486 IYKELLSLETLDFKGEPLEGLQIMGMLESRVLDFETVIISSVNEGILPSGKTNNSFIPFD 545

Query: 668 MQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDF 727
           ++ + NL T ++      + F          Y    R  N+  + +  +  L     + F
Sbjct: 546 VKVENNLPTYKEKDAVYTYHF----------YRLLQRAKNVYILYNTEVDTLKGGEKSRF 595

Query: 728 FDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRT--------------YSFS 773
              L+  G        K+ + T  P  + P    PL+  P+T              +S S
Sbjct: 596 ITQLEIEG------IHKIKHITISP--EVPIIESPLKQIPKTPLVTEKIKALALKGFSPS 647

Query: 774 EIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRIN-----KNT 828
            +   I +P   Y  +IL +      +++      G++ HN + +L K         ++ 
Sbjct: 648 SLTNYIRNPIDFYFEKILGVKEFEDVEENIAANTLGSVIHNSLEDLYKPLEGSFLTVEHL 707

Query: 829 PEINHLMKQIIDSHF----EKENLPPHIDIIWRHLFHKISHSFLEHE-EKIQSS--IEKI 881
               H +KQI+  HF    +  +     ++I   +  +   +F+  E E + +   I+ I
Sbjct: 708 KTFKHQIKQIVTKHFKGLYKDGDFSKGKNLIIFEIAQRYISNFITSEIESLNNGNQIKII 767

Query: 882 FVNIPAKMAIESIG----IHLTGFADRIDLLKSGFVDITDYKTG 921
            +     + IE  G    I L G  DRID L +G   + DYK+G
Sbjct: 768 AIEADETIDIEIDGLVFPIKLNGKVDRIDEL-NGVTRVIDYKSG 810


>gi|57238505|ref|YP_179636.1| hypothetical protein CJE1655 [Campylobacter jejuni RM1221]
 gi|57167309|gb|AAW36088.1| conserved hypothetical protein [Campylobacter jejuni RM1221]
 gi|315058936|gb|ADT73265.1| hypothetical protein CJS3_1562 [Campylobacter jejuni subsp. jejuni
           S3]
          Length = 788

 Score = 58.2 bits (139), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 134/312 (42%), Gaps = 44/312 (14%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK----IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGF 912
           +  F + + +  EH  K    + + +E   +N   K+  +SI   L G  DRID  K G 
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVVHTELE---LNNILKLGTDSIK--LKGTIDRIDSSKEGN 701

Query: 913 VDITDYKTGDNP 924
           + I DYK+G  P
Sbjct: 702 L-IIDYKSGKVP 712


>gi|325953681|ref|YP_004237341.1| hypothetical protein Weevi_0035 [Weeksella virosa DSM 16922]
 gi|323436299|gb|ADX66763.1| hypothetical protein Weevi_0035 [Weeksella virosa DSM 16922]
          Length = 896

 Score = 58.2 bits (139), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 134/584 (22%), Positives = 226/584 (38%), Gaps = 111/584 (19%)

Query: 378 LRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAI 437
           LR   +E  K +ALI AD  L   +   +     +I+IS GIPL                
Sbjct: 282 LRHKTEEELKNTALILADEMLLPALLNAMPNNVKHINISMGIPLKNI------------- 328

Query: 438 FKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR---GN------KNSYDIMDL 488
                          PLA F          K+ LEL   R   GN      KN  DI++ 
Sbjct: 329 ---------------PLAHF---------FKSILELHMNREKLGNSTAFYFKNILDILEN 364

Query: 489 KSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNL 548
            SL +      +    + H Q+++    K L   L+D I    +PL +   N N     L
Sbjct: 365 PSLKIFHCKNDEQLIAIIHSQNKVFSSVKFLQDFLIDSIF---SPLFSRPNNLNDL---L 418

Query: 549 SISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAI--EWI 606
           SI +  K       N  +D       L++         +F+ +    + +KA+       
Sbjct: 419 SIIE--KFIADLFVNPKIDNDLMREYLFY------FQQIFTSLRTEIATLKASTSFRTLY 470

Query: 607 DIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSR 666
            +  +L+  ET+    E    L ++G LE+RL+NFD LI+  +N+G+ P     N F+  
Sbjct: 471 LLYQKLLQSETLSFIGEPLDGLQVMGLLETRLINFDHLIMTSVNDGILPLGRQNNTFIPY 530

Query: 667 VMQSDLNLKT-AEKYIGQAAHDFEMAN--GTRHLIYTRSLRENNIPTIASRWLQRLLVLG 723
            ++ +  L T  E     A H + + +   T H +Y       +   + S    R L   
Sbjct: 531 DIRKEKGLNTFTENDAIYAYHFYRLLSRAKTVHFLYN-----TDSDAMGSGEKSRFL--- 582

Query: 724 GTDFFDNLKKRGQCYLDWTRKLDYTTKQPHY-----------KRPKPFPPLE--AQPRTY 770
                       Q   + + ++     +PH+           K PK    L   A+    
Sbjct: 583 -----------EQIAYESSHEVVINYAKPHFEIIPKNKLVIPKTPKTMEKLIDWAENIGI 631

Query: 771 SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRIN----- 825
           S + +   I +P   Y R IL  D     ++       G + H  +  L +  +N     
Sbjct: 632 SPTLLSTYIRNPIEFYERVILSNDETEEAEETISAKTLGKIVHGTLETLYQDYLNIALHE 691

Query: 826 KNTPEINHLMKQIIDSHFEKENLPPHID----IIWRHLFHKISHSFLEHEEKIQSSIEKI 881
           K+  EI + + ++++++ +KE     +D    ++ +++  KI    L+ ++KI    E +
Sbjct: 692 KDFEEIKNKVDEVLEANLKKEYKEGELDRGENLLIKNVARKIVEGVLQRDKKIAQENELV 751

Query: 882 FVNIPAK----MAIESIGIHLTGFADRIDLLKSGFVDITDYKTG 921
            + +  K    M I    + + GF DRID + +G   I DYKTG
Sbjct: 752 ILFLEKKYNFLMDIGDRKVKVKGFIDRIDSV-NGTKRIIDYKTG 794


>gi|145589487|ref|YP_001156084.1| hypothetical protein Pnuc_1306 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047893|gb|ABP34520.1| DNA helicase/exodeoxyribonuclease V, subunit B [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 994

 Score = 58.2 bits (139), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 92/411 (22%), Positives = 157/411 (38%), Gaps = 78/411 (18%)

Query: 604 EWIDIITRLIDGETVKPKI-EKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNP 662
           EW+ +I  +++G + + +  +  + L IL    +RL  FD ++L G +E   P  +    
Sbjct: 548 EWLSLIKTVVEGASYQEEGGDARANLSILPLSSARLREFDAIVLVGCDEQQLPAYSEPPL 607

Query: 663 FLSRVMQSDLNLKTAEKYIGQAAHDFE--MANGTRHLIYTRSLRENNIPTIASRWLQRLL 720
           F S  +   L   T E    Q A D    + + ++  +  +S  +N  P   S W+QRL 
Sbjct: 608 FFSDALNQLLKTSTIEMQFVQQARDLSQLLVSCSQVDLLWQSKSKNGEPLRPSAWIQRL- 666

Query: 721 VLGGTDFFDNLKKRGQCYLDW---TRKLDYTTKQP--------HYKRPKPFPPLEAQPRT 769
                          Q  +DW   + ++     +P        H++   P P L   P  
Sbjct: 667 ---------------QSKVDWHALSPQIQKRVFEPNPIDMAVAHFEEDLPMP-LSMSPSA 710

Query: 770 YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITEL---IKKRINK 826
           Y     K L + PY  Y R +L L  I    +  D +  G   H ++      +K   +K
Sbjct: 711 Y-----KALRDCPYRYYVRSLLGLRKIKSVDEGFDASLAGQTLHQVLKSFYHSLKTEEHK 765

Query: 827 N------TPEINHLMKQIIDSHFEKE--------------------NLPPHIDIIWRHLF 860
           N        E +  M+  ++   E+E                     +P  ID  W+   
Sbjct: 766 NPNLKTQDEERHEWMEARLNMESEQEFAPLIEGDARVMGALRDWQKQIPSFID--WQLQR 823

Query: 861 HKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLL--KSGFVDITDY 918
            +    + + E K+    +  F +I          I + GFADR D+    S    + DY
Sbjct: 824 EQAGWQYFDGELKV--GFDLPFADIDGNFKT----IRIEGFADRFDIHIDDSKLASVIDY 877

Query: 919 KTG--DNPKKETAQKLIDPQLSLEA-AALKAGSFSQIDCRKVANLFYIRLK 966
           K    +  K+     L DPQL + A AA ++    ++  R+V    ++ LK
Sbjct: 878 KNQRFERVKQRAEHLLDDPQLLIYARAANESQENHKLLGRQVKQAEWVALK 928


>gi|255002999|ref|ZP_05277963.1| hypothetical protein AmarPR_01685 [Anaplasma marginale str. Puerto
           Rico]
          Length = 937

 Score = 57.8 bits (138), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 140/751 (18%), Positives = 281/751 (37%), Gaps = 137/751 (18%)

Query: 245 LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
           LM +V++     IVLP +D  +    W T+             +S H QY + +LL  L 
Sbjct: 208 LMHSVSD---AVIVLPYVDLGLSDREWQTL-------------HSEHYQYYVMQLLKNLG 251

Query: 305 IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
           + R +V+RLG V       + V+ + F         N ++  +   N      D+ LI  
Sbjct: 252 VGRNEVERLGQVKV-----NHVVERLF---------NFELTSHLAMNYGT-GEDIELIAC 296

Query: 365 DNEREEAISIAIALRMSLDENKKKS------------------ALITADRNLARRVKLEL 406
            +E EEA+ +   L+    E  + +                    +  D++  R ++ + 
Sbjct: 297 SSEAEEAVKVVEILKSCTTEAHRGAKAEFSCIGGWAASAKPTQTAVDVDKDTIRSLEGKS 356

Query: 407 TRF------GINIDISAGIPLSTTLHSSILTSL----LNAIFKLNDFMAIATLVKHPLAK 456
             F         +D    I  +   +  I+++L    +  +    + + +  ++KHPL +
Sbjct: 357 VTFVGSDSLAARVDALLRIGANYCDYDEIISALVLCSIEVVVSSGNAVQLLCMLKHPLVR 416

Query: 457 FGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEED 516
            G+      +     E+  +RG+                     + T      S + EE 
Sbjct: 417 LGYDADEYRKLLAEFEIRVVRGH---------------------SATGFEAIGSAIREEF 455

Query: 517 KELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLW 576
           ++L       +++ I+P++  +  + ST G ++ +      V CL+ +      KL    
Sbjct: 456 QQLEEFW-RKVVEAISPMINVR--EGSTIGEIAAAH-----VQCLERL----MNKLDTSE 503

Query: 577 FEEEGKTLSSLFSKIIETGSCIKANAIE---WIDIITRLIDGETVKPKIEKSSTLFILGT 633
                  +S+ FS  +    C+         + ++ T L+        IE++    +   
Sbjct: 504 CTHALNKISTFFS--LFDNYCMGVAVFSLTSYKEVCTLLVRAFFT---IERNKLFGV--N 556

Query: 634 LESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANG 693
           L +R    D +IL G +E  +    +    L+  ++  L L   E+Y G+  +       
Sbjct: 557 LATR----DAVILSGFSEAEFKPRCSH--LLNNWVRERLGLPLLEEYCGRMMYVLYSFFY 610

Query: 694 TRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH 753
            + L  T+S     +      W++ L  L        LK R + Y      +        
Sbjct: 611 AKKLRITKSAESFGVAVAEPIWIRYLTFL--------LKDRTERYAATQAVVSSNVVADP 662

Query: 754 YKRPKPFPPLEAQPRTYSF---SEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRG- 809
           ++   P P L+ + +  S      +  LI++PY  Y + ILK+   P    +   + RG 
Sbjct: 663 HRASAPNPGLDVRKKAMSVLTAKAVDTLISNPYVFYVQYILKM--FPTKTVNTQHSVRGF 720

Query: 810 -TLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHLFHKISHSF 867
             + H I+ E +   I     + N L+ +I    F+   +  P+  ++W   F +++ +F
Sbjct: 721 NIIAHKILREYLVS-IGTEAGDYN-LLLEIAKRQFDAIAVTHPYAHVLWWPKFEEMARNF 778

Query: 868 LEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDYKTGDNPK 925
              + + +S+  +       K  +  +   I +    DR++ +K G V +   K G  P 
Sbjct: 779 FAVDSERRSAASR---TESGKSFVWYVSEEIQVIARCDRVEYMKDGSVMVACNKVGAAPS 835

Query: 926 KE------TAQKLIDPQLSLEAAALKAGSFS 950
           K        ++ ++D     E+      SF+
Sbjct: 836 KADMRCGFASRAIVDAVCVAESTGANVASFA 866


>gi|222475020|ref|YP_002563435.1| hypothetical protein AMF_308 [Anaplasma marginale str. Florida]
 gi|222419156|gb|ACM49179.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 946

 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 148/759 (19%), Positives = 276/759 (36%), Gaps = 153/759 (20%)

Query: 245 LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
           LM +V++     IVLP +D  +    W T+             +S H QY + +LL  L 
Sbjct: 217 LMHSVSD---AVIVLPYVDLGLSDREWQTL-------------HSEHYQYYVMQLLKNLG 260

Query: 305 IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
           + R +V+RLG V       + V+ + F         N ++  +   N      D+ LI  
Sbjct: 261 VGRNEVERLGQVKV-----NHVVERLF---------NFELTSHLAMNYGT-GEDIELIAC 305

Query: 365 DNEREEAISIAIALRMSLDENKK-----------------------------------KS 389
            +E EEA+ +   L+    E  +                                   KS
Sbjct: 306 SSEAEEAVKVVEILKSCTTEAHRGAKAEFSCIGGWAASAKPTQTAVDVDKDTIRSLEGKS 365

Query: 390 ALITADRNLARRVKLELTRFGIN-IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIAT 448
                  +LA RV   L R G N  D    I         ++ S  NA+        +  
Sbjct: 366 VTFVGSDSLAARVD-ALLRIGANYCDYDEIISALVLCSIEVVVSSGNAV-------QLLC 417

Query: 449 LVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHW 508
           ++KHPL + G+      +     E+  +RG+                     + T     
Sbjct: 418 MLKHPLVRLGYDADEYRKLLAEFEIRVVRGH---------------------SATGFEAI 456

Query: 509 QSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDE 568
            S + EE ++L       +++ I+P++  +  + ST G ++ +      V CL+ +    
Sbjct: 457 GSAIREEFQQLEEFW-RKVVEAISPMINVR--EGSTIGEIAAAH-----VQCLERL---- 504

Query: 569 HRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIE---WIDIITRLIDGETVKPKIEKS 625
             KL           +S+ FS  +    C+         + ++ T L+        IE++
Sbjct: 505 MNKLDTSECTHALNKISTFFS--LFDNYCMGVAVFSLTSYKEVCTLLVRAFFT---IERN 559

Query: 626 STLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAA 685
               +   L +R    D +IL G +E  +    +    L+  ++  L L   E+Y G+  
Sbjct: 560 KLFGV--NLATR----DAVILSGFSEAEFKPRCSH--LLNNWVRERLGLPLLEEYCGRMM 611

Query: 686 HDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKL 745
           +        + L  T+S     +      W++ L  L        LK R + Y      +
Sbjct: 612 YVLYSFFYAKKLRITKSAESFGVAVAEPIWIRYLTFL--------LKDRTERYAATQAVV 663

Query: 746 DYTTKQPHYKRPKPFPPLEAQPRTYSF---SEIKQLINDPYAVYARRILKLDFIPHFKKD 802
                   ++   P P L+ + +  S      +  LI++PY  Y + ILK+   P    +
Sbjct: 664 SSNVVADPHRASAPNPGLDVRKKAMSVLTAKAVDTLISNPYVFYVQYILKM--FPTKTVN 721

Query: 803 PDRTDRG--TLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHL 859
              + RG   + H I+ E +   I     + N L+ +I    F+   +  P+  ++W   
Sbjct: 722 TQHSVRGFNIIAHKILREYLVS-IGTEAGDYN-LLLEIAKRQFDAIAVTHPYAHVLWWPK 779

Query: 860 FHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITD 917
           F +++ +F   + + +S+  +       K  +  +   I +    DR++ +K G V +  
Sbjct: 780 FEEMARNFFAVDSERRSAASR---TESGKSFVWYVSEEIQVIARCDRVEYMKDGSVMVAC 836

Query: 918 YKTGDNPKKE------TAQKLIDPQLSLEAAALKAGSFS 950
            K G  P K        ++ ++D     E+      SF+
Sbjct: 837 NKVGAAPSKADMRCGFASRAIVDAVCVAESTGANVASFA 875


>gi|86131070|ref|ZP_01049669.1| probable DNA repair protein [Dokdonia donghaensis MED134]
 gi|85818481|gb|EAQ39641.1| probable DNA repair protein [Dokdonia donghaensis MED134]
          Length = 896

 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 82/329 (24%), Positives = 146/329 (44%), Gaps = 31/329 (9%)

Query: 612 LIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSD 671
           +I  ET+  K +    L I+G LESR+L++D +IL  +NEG+ P   ++N ++   ++  
Sbjct: 481 IISSETIDLKGDPDQGLQIMGVLESRVLDYDHVILTSVNEGILPSGKSQNSYIPYDLKKL 540

Query: 672 LNLKT-AEKYIGQAAHDFEMAN--GTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFF 728
            +L T +EK    A H + + +   T  L+YT      +   + S    R +     +  
Sbjct: 541 YDLPTYSEKDAVYAYHFYHLLHRASTVDLLYT-----THSSGLGSSEQSRFIRQIEEEGI 595

Query: 729 DNLKKRGQCYLDWTRKLDYTTKQPHY--KRPKPFPPL-EAQPRTYSFSEIKQLINDPYAV 785
            NL K        T     T+K+     K P+    L +   R  S S +   + +P   
Sbjct: 596 HNLTK-----YTVTPASHSTSKKSQVIAKTPEVVTKLSQFLKRGISPSALTTYLRNPVLF 650

Query: 786 YARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPE--INHLMKQI---ID 840
           Y R IL +D     ++       GT+ HN + EL K  I     E  + +L+K I   + 
Sbjct: 651 YERYILGIDSSDEVEETVAANTMGTIVHNTLEELYKPHIGIILTEDILKNLIKGIEQEVR 710

Query: 841 SHFEKENLPPHID-----IIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG 895
           + F+ E    HI      II+  +  +  H++L+ E  +    + + +    +  +  I 
Sbjct: 711 NQFKSEYGLTHIQEGKNKIIYA-VICRYVHNYLKREISLLKKGDTVIIQ-AVEDDLRDIS 768

Query: 896 IHLT-GFADRIDLL--KSGFVDITDYKTG 921
           +  T     ++DL+  ++G ++I DYKTG
Sbjct: 769 LTDTITLRGKVDLVEQRNGHLNIIDYKTG 797


>gi|269958928|ref|YP_003328717.1| hypothetical protein ACIS_00878 [Anaplasma centrale str. Israel]
 gi|269848759|gb|ACZ49403.1| hypothetical protein ACIS_00878 [Anaplasma centrale str. Israel]
          Length = 937

 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 149/758 (19%), Positives = 276/758 (36%), Gaps = 151/758 (19%)

Query: 245 LMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLD 304
           LM +V++     IVLP +D  +    W T+             +S H QY + +LL  L 
Sbjct: 208 LMHSVSD---AVIVLPYVDLGLSDREWQTL-------------HSEHYQYYVMQLLKDLG 251

Query: 305 IKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEA 364
           + R +V+RLG V       + V+ + F    TS +   D    K         D+ LI  
Sbjct: 252 VGRNEVERLGQVKV-----NHVVERLFNFELTSHL-AMDYGTGK---------DIELIAC 296

Query: 365 DNEREEAISIAIALRMSLDEN-----------------------------------KKKS 389
            +E EEA+ +   L+    E                                    + KS
Sbjct: 297 SSEAEEAVKVVEILKSCTTEAHCGAKAEFSRISGWAASAKPTQTAVDVDKDTIRFLEGKS 356

Query: 390 ALITADRNLARRVKLELTRFGIN-IDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIAT 448
                  +LA RV   L R G N  D    I       S+++   +  +    D + +  
Sbjct: 357 VTFVGSDSLAARVD-ALLRIGANYCDYDEII-------SALVLCSIEVVVSSGDAVQLLC 408

Query: 449 LVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHW 508
           ++KHPL + G+      +     E+  +RG+                     + T     
Sbjct: 409 MLKHPLVRLGYDADEYCKLLAEFEIRVVRGH---------------------SATGFEAI 447

Query: 509 QSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVC--L 566
            S + EE ++L       +++ I+P++  +  + ST G ++ +      V CL+ +   L
Sbjct: 448 GSAIREEFQQLEEFW-RKVVEAISPMINVR--EGSTIGEIAAAH-----VQCLERLMNKL 499

Query: 567 DEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSS 626
           D       L    +  T  SLF       +     + +  ++ T L+        +E++ 
Sbjct: 500 DTSECTHAL---NKICTFFSLFDNYCMGVAVFSLTSYK--EVCTLLVRAFFT---VERNK 551

Query: 627 TLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAH 686
              +   L +R    D  +L G +E  +    +    L+   +  L L   E+Y G+  +
Sbjct: 552 LFGV--NLATR----DAAVLAGFSEAEFKPRCSH--LLNNWARERLGLPLLEEYCGRMMY 603

Query: 687 DFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLD 746
                   + L  T+S +   +      W++ L  L        LK R + Y      + 
Sbjct: 604 VLYSFFYAKKLRITKSAKSFGVAVAEPIWIRYLTFL--------LKDRTERYAATQAVVG 655

Query: 747 YTTKQPHYKRPKPFPPLEAQPRTYSF---SEIKQLINDPYAVYARRILKLDFIPHFKKDP 803
                  Y+   P P L+ + +  S      +  LI++PY  Y + ILK+   P    + 
Sbjct: 656 SNVVTDPYRASAPNPGLDVRKKAMSVLTAKAVDTLISNPYVFYVQYILKM--FPTKTVNT 713

Query: 804 DRTDRG--TLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLP-PHIDIIWRHLF 860
               RG   + H I+ E +   I     + N L+ +I    F+   +  P+  ++W   F
Sbjct: 714 QHLVRGFNIIAHKILREYLVS-IGTEAGDYN-LLLEIAKRQFDAIAVTHPYAHVLWWPKF 771

Query: 861 HKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGFVDITDY 918
            +++ +F   + + +S+  +       K  +  +   I +    DR++ +K G V +   
Sbjct: 772 KEMARNFFVVDSERRSAASR---TESGKSFVWHVSEEIQVIARCDRVEYMKDGSVMVACN 828

Query: 919 KTGDNPKKE------TAQKLIDPQLSLEAAALKAGSFS 950
           K G  P K        ++ ++D     E+      SF+
Sbjct: 829 KVGAAPSKADMRCGFASRAIVDAVCVAESTGANVASFA 866


>gi|332885567|gb|EGK05813.1| hypothetical protein HMPREF9456_02077 [Dysgonomonas mossii DSM
           22836]
          Length = 963

 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 96/432 (22%), Positives = 178/432 (41%), Gaps = 64/432 (14%)

Query: 580 EGKTLSSLFSKIIETGSCIKANAIE-----WIDIITRLIDGETVKPKIEKSSTLFILGTL 634
           EG+ +   +  I +    ++  + E     +  ++ +LI   +V    E  S L I+G L
Sbjct: 479 EGEFIVEYYKTINKMNDALQNVSFEMNIETYFKLLKKLIVNISVPFTGEPLSGLQIMGVL 538

Query: 635 ESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIG-QAAHDFEMANG 693
           E+R L+FD LI+  +NEG++P   A + F+   ++   +L T E      A H + + N 
Sbjct: 539 ETRALDFDNLIILSMNEGIFPLKRATSSFIPYNLRKGFDLPTYEHQDSIFAYHFYRLINR 598

Query: 694 TR--HLIY---TRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCY-LDWTRKLDY 747
            +  +L+Y   T  L+   +    SR+ +++  L    F  ++K++   Y +  T  L  
Sbjct: 599 AKRIYLLYDTRTEGLQSGEV----SRYFKQIKHLYADSF--DIKEKLTVYKVSSTESLPI 652

Query: 748 TTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTD 807
           +  +    + K    L+   +  S S I   +N P   Y   +  +       +  + + 
Sbjct: 653 SISKTPEIQEKMNVFLQGGDKQLSASAINMYLNCPLQFYFSVVENMAEEDEVVETIEASM 712

Query: 808 RGTLFHNI---------------------------ITELIKKRINKNTPEINHLMKQIID 840
            GT+FH+I                           +TE I++   +N  + + + K    
Sbjct: 713 FGTIFHSIMEWLYEPFKGKMITADLLHKIRKDEKLLTENIERSFAENYFKTDKIKKLTGQ 772

Query: 841 SHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTG 900
           ++   E L  +I  +           +++ EE+I     K+  ++P+   +      L G
Sbjct: 773 NYLTGEVLRKYIKQVLVTDAGLTPFIYVDSEERI-----KMEYSLPSGKTVS-----LKG 822

Query: 901 FADRIDLLKSGFVDITDYKTGDNPKKETAQK-LIDPQL-SLEAAALKAGSFSQIDCRKVA 958
           F DR+D LK G   I DYKTG    +    K L D  L     A ++   +S +  RK  
Sbjct: 823 FIDRVDELK-GRTRIIDYKTGKGVLRYKEMKDLFDKDLKDRPKAVMQVFMYSHLYMRKYP 881

Query: 959 N------LFYIR 964
           N      ++Y+R
Sbjct: 882 NKIIEPGIYYLR 893


>gi|313157476|gb|EFR56895.1| conserved hypothetical protein [Alistipes sp. HGB5]
          Length = 960

 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/319 (21%), Positives = 137/319 (42%), Gaps = 31/319 (9%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKN-TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF 688
           I+G LE+R ++F+ +IL  +N+  +P N  A++ F+   +++   L T E + G  A+ F
Sbjct: 527 IMGILETRNVDFENVILLSMNDDNFPGNHVAQSSFIPYNLRAAYELPTPEHHEGVYAYYF 586

Query: 689 ----EMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRK 744
               + A    H++Y  S  ++      SR++ +L    G D    ++      L  T  
Sbjct: 587 YRLIQRAKSV-HMLYC-SHADDKSTGEPSRYIYQLDYESGFDV-RKIEVGVDVNLAETAP 643

Query: 745 LDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPD 804
           ++        +R + F   E+ P   S +   + +  P   Y   + +L+      ++ D
Sbjct: 644 IEVAKDGEVMRRLERFVDAES-PAALSPTAFFRYVACPLRFYFHSVARLEADDEISEEVD 702

Query: 805 RTDRGTLFHNIITELIKKRINKNTP-----------EINHLMKQIIDSHFEKE------- 846
               GT+ H  +  L  + + +  P           E+   +++ I+ ++ ++       
Sbjct: 703 APMFGTILHAAVQTLYARIVGEEHPGQTLRAMIRSGEVAAAVERAINENYLQDERASAED 762

Query: 847 ---NLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE-KIFVNIPAKMAIESIGIHLTGFA 902
              NL    DI+ R+L   +      H+    S +E ++  + P +     + +   G A
Sbjct: 763 YTGNLLLVKDIVTRYLRGGVMPYDAAHDAFAVSGLEERVAYSFPFRAGERELEMKFGGIA 822

Query: 903 DRIDLLKSGFVDITDYKTG 921
           DRID+L  G + + DYKTG
Sbjct: 823 DRIDMLGDGALRVVDYKTG 841


>gi|88596293|ref|ZP_01099530.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|88191134|gb|EAQ95106.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           84-25]
          Length = 788

 Score = 57.0 bits (136), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 133/309 (43%), Gaps = 38/309 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNNFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGTDSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTGDNP 924
            DYK+G  P
Sbjct: 704 IDYKSGKVP 712


>gi|86149363|ref|ZP_01067594.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85840145|gb|EAQ57403.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|284926689|gb|ADC29041.1| hypothetical protein CJSA_1405 [Campylobacter jejuni subsp. jejuni
           IA3902]
          Length = 788

 Score = 57.0 bits (136), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 133/309 (43%), Gaps = 38/309 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNNFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGTDSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTGDNP 924
            DYK+G  P
Sbjct: 704 IDYKSGKVP 712


>gi|88801967|ref|ZP_01117495.1| hypothetical protein PI23P_04872 [Polaribacter irgensii 23-P]
 gi|88782625|gb|EAR13802.1| hypothetical protein PI23P_04872 [Polaribacter irgensii 23-P]
          Length = 917

 Score = 57.0 bits (136), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 144/330 (43%), Gaps = 27/330 (8%)

Query: 611 RLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQS 670
           +LI  ET+  + E    L ++G LE+R+L+F+ +IL   NEGV P  + +N F+   ++ 
Sbjct: 487 QLIASETLSFQGEPLRGLQLMGMLETRVLDFENIILTSTNEGVLPAGSQQNSFIPFDVKL 546

Query: 671 DLNLKTA-EKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTI-ASRWLQRLLVLGGTDFF 728
              L T  EK    + H F +    +++    +   +   +   SR++ +L ++      
Sbjct: 547 AFGLPTYREKDAIFSYHFFRLIQRAKNIFILYNTEHDAFGSGEKSRFVTQLEMMRPDIIQ 606

Query: 729 DNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYAR 788
            N+  +       T   + +  +   +R K     E   +  S S +   +++P + Y +
Sbjct: 607 KNIAPK--VIPSKTELKEVSKNEATLERLK-----ELATKGISPSALTNYLHNPISFYKQ 659

Query: 789 RILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINK-----NTPEINHLMKQIIDSHF 843
           ++LK+      ++       GT+ H  + EL +  + K     N   +  + K ++  HF
Sbjct: 660 KVLKIKEFDEVEETVAFNTLGTVVHEALDELYRPFVGKFLSLTNVVNMQKIAKDLVIKHF 719

Query: 844 EKENLPPHIDIIWRHLFHKISHSF----------LEHEEKIQSSIEKIFVNIPAKMAIES 893
           + +     +      L  ++++ F          L  +EK Q  I     N+  ++ IE 
Sbjct: 720 KLQFKNGDLKTGKNRLIFEVANRFVANFLSKEIDLLQDEKNQLKIIATEENLATEITIEG 779

Query: 894 IG--IHLTGFADRIDLLKSGFVDITDYKTG 921
           I   I L G  DR+D L +G + I DYKTG
Sbjct: 780 IDFPIKLHGQVDRVDEL-NGVLRIIDYKTG 808


>gi|86153163|ref|ZP_01071368.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|121613506|ref|YP_001001131.1| hypothetical protein CJJ81176_1475 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167006024|ref|ZP_02271782.1| hypothetical protein Cjejjejuni_07785 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|85844048|gb|EAQ61258.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|87249581|gb|EAQ72540.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           81-176]
          Length = 788

 Score = 57.0 bits (136), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 133/309 (43%), Gaps = 38/309 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGTDSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTGDNP 924
            DYK+G  P
Sbjct: 704 IDYKSGKVP 712


>gi|315930995|gb|EFV09970.1| hypothetical protein CSU_1749 [Campylobacter jejuni subsp. jejuni
           327]
          Length = 788

 Score = 57.0 bits (136), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 133/309 (43%), Gaps = 38/309 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFALSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGTDSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTGDNP 924
            DYK+G  P
Sbjct: 704 IDYKSGKVP 712


>gi|150007829|ref|YP_001302572.1| hypothetical protein BDI_1187 [Parabacteroides distasonis ATCC
           8503]
 gi|149936253|gb|ABR42950.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 959

 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 136/348 (39%), Gaps = 43/348 (12%)

Query: 605 WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFL 664
           +  ++ R+ D  T+    E  S L I+G LE+R L+FD LI+  +NEG++P+  A N F+
Sbjct: 504 FFRLLKRVTDTITIPFHGEPLSGLQIMGVLETRALDFDRLIILSMNEGIFPQRKAANSFI 563

Query: 665 SRVMQSDLNLKTAEKYIGQ-AAHDFEMANGTRHLIYTRSLRENNIPTI-ASRWLQRLLVL 722
              ++    L T E      A H + +     H+      R N + T   SR++ +L   
Sbjct: 564 PYNLRRGFGLPTYEHQDSVWAYHFYRLIERASHVSLLYDTRSNGLQTGEVSRFVHQLHYH 623

Query: 723 GGTDFFD-----NLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
                 D     N+       L   ++ D   +   Y++           +  S S I  
Sbjct: 624 YEVPMRDKLVVYNVSSSKTPPLAVPKREDIMRRLDAYRK--------GGSKAISASAINT 675

Query: 778 LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK------------KRIN 825
            ++ P   Y   +  +       +  +    G++ H ++ EL K            K I 
Sbjct: 676 YLDCPLKFYFSVVEGIREEEEVSETIESDVFGSILHKVMEELYKPFQGKMVTVDLLKAIR 735

Query: 826 KNTPEINHLMKQIIDSHFEKENLPPHI---DIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
           K+T  +   + +   S F K  +   +   + +   +  K     LE + K+       F
Sbjct: 736 KDTALLTGAIARAFASEFFKTEVVRSLTGQNYLIGEMIRKYVEKILERDGKLTP-----F 790

Query: 883 VNIPAKMAIESI-------GIHLTGFADRIDLLKSGFVDITDYKTGDN 923
           V I ++  I  +        I L GF DR+D ++   + I DYK+G  
Sbjct: 791 VYIESERKINGLISLSDYSEIRLKGFIDRVDEVRDA-IRIIDYKSGSG 837


>gi|157415706|ref|YP_001482962.1| hypothetical protein C8J_1387 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|157386670|gb|ABV52985.1| hypothetical protein C8J_1387 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|307748347|gb|ADN91617.1| Putative uncharacterized protein [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 788

 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 133/309 (43%), Gaps = 38/309 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFALSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGTDSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTGDNP 924
            DYK+G  P
Sbjct: 704 IDYKSGKVP 712


>gi|255013470|ref|ZP_05285596.1| hypothetical protein B2_06150 [Bacteroides sp. 2_1_7]
          Length = 959

 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 136/348 (39%), Gaps = 43/348 (12%)

Query: 605 WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFL 664
           +  ++ R+ D  T+    E  S L I+G LE+R L+FD LI+  +NEG++P+  A N F+
Sbjct: 504 FFRLLKRVTDTITIPFHGEPLSGLQIMGVLETRALDFDRLIILSMNEGIFPQRKAANSFI 563

Query: 665 SRVMQSDLNLKTAEKYIGQ-AAHDFEMANGTRHLIYTRSLRENNIPTI-ASRWLQRLLVL 722
              ++    L T E      A H + +     H+      R N + T   SR++ +L   
Sbjct: 564 PYNLRRGFGLPTYEHQDSVWAYHFYRLIERASHVSLLYDTRSNGLQTGEVSRFVHQLHYH 623

Query: 723 GGTDFFD-----NLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
                 D     N+       L   ++ D   +   Y++           +  S S I  
Sbjct: 624 YEVPMRDKLVVYNVSSSKTPPLAVPKREDIMRRLDAYRK--------GGSKAISASAINT 675

Query: 778 LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK------------KRIN 825
            ++ P   Y   +  +       +  +    G++ H ++ EL K            K I 
Sbjct: 676 YLDCPLKFYFSVVEGIREEEEVSETIESDVFGSILHKVMEELYKPFQGKMVTVDLLKAIR 735

Query: 826 KNTPEINHLMKQIIDSHFEKENLPPHI---DIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
           K+T  +   + +   S F K  +   +   + +   +  K     LE + K+       F
Sbjct: 736 KDTALLTGAIARAFASEFFKTEVVRSLTGQNYLIGEMIRKYVEKILERDGKLTP-----F 790

Query: 883 VNIPAKMAIESI-------GIHLTGFADRIDLLKSGFVDITDYKTGDN 923
           V I ++  I  +        I L GF DR+D ++   + I DYK+G  
Sbjct: 791 VYIESERKINGLISLSDYSEIRLKGFIDRVDEVRDA-IRIIDYKSGSG 837


>gi|153951609|ref|YP_001398783.1| hypothetical protein JJD26997_1829 [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939055|gb|ABS43796.1| conserved hypothetical protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 788

 Score = 56.2 bits (134), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 132/309 (42%), Gaps = 38/309 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL  N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMNNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++ E+  K    N  +I +    ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKML-EIYYKNYANNDFDIRNFA-NLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGTDSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTGDNP 924
            DYK+G  P
Sbjct: 704 IDYKSGKVP 712


>gi|258648077|ref|ZP_05735546.1| conserved hypothetical protein [Prevotella tannerae ATCC 51259]
 gi|260851938|gb|EEX71807.1| conserved hypothetical protein [Prevotella tannerae ATCC 51259]
          Length = 905

 Score = 56.2 bits (134), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 149/352 (42%), Gaps = 37/352 (10%)

Query: 608 IITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
           +I RL    ++    E    L ++G LE+R L+F+ ++L   NEG+ P +  +  F+   
Sbjct: 452 LIRRLAAQASIPFHGEPVVGLQLMGILETRNLDFENILLLSTNEGIMPASGIELSFIPFA 511

Query: 668 MQSDLNL-KTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNI-PTIASRWLQRLLVLGGT 725
           ++    L  T  +    A + F +    RH+ +T +   + +     SR++ +LLV    
Sbjct: 512 IRRAFGLPSTTHRSAVYAYYFFRLLQRARHVTFTYNATPDGLRGGEMSRFMMQLLVS--- 568

Query: 726 DFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPF-----PPLEAQPRTYSFSEIKQLIN 780
              D  + R +  L+  R L   T      RP        P    Q    S S I + I+
Sbjct: 569 ---DRFRIRQEA-LNAPRLLPQPTPI-EVARPADLFERLNPVRGGQQVPLSPSSINKYID 623

Query: 781 DPYAVYARRILKLDFIPHFKKDPDRTDR--GTLFHNIITELIKKRINKNTPEINHL---- 834
            P   Y  R+ +L   PH   D    +R  G +FH +  +  K    K   +   L    
Sbjct: 624 CPLQFYYHRVARL--TPHEDTDAALDNRIFGNVFHQLAEDFYKPFEGKGKIDPQRLAYYH 681

Query: 835 -----MKQIIDSHFEKENLPPHI--DIIWRHLFHK-ISHSFLEHEEKIQSSIEKIFVNIP 886
                +  +I+  F K N P  +    I R+LF + +++ +   + +I      + +++P
Sbjct: 682 EHPERLNPLIEEAFAKNNAPYRLVDATIVRNLFRRMLAYDYRLADLEIVRLECDVDISLP 741

Query: 887 AKMAIESIGIHLTGFADRIDLL--KSGF--VDITDYKTGDNPKKETAQKLID 934
            K+       ++ G  DR+D+    SG   + + DYKTG   K++ A K+ D
Sbjct: 742 LKIDGTVRPFNVGGRIDRLDIACTPSGLRTLRVVDYKTGT--KEQKANKMED 791


>gi|283953894|ref|ZP_06371424.1| hypothetical protein C414_000020075 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794673|gb|EFC33412.1| hypothetical protein C414_000020075 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 788

 Score = 56.2 bits (134), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 86/310 (27%), Positives = 134/310 (43%), Gaps = 40/310 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSINELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      +FF       Q YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFEFFYETHTHQQAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L   P
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPVLKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLA-EP 588

Query: 798 HFKKDPDRT-DRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-I 855
            F  D  +  ++G   H ++ E+  K    N  +I  +   +++  ++K N+   +D+ +
Sbjct: 589 RFLSDESKAKNQGNFIHKML-EIYYKNYANNDFDIK-VFTNLLEKEYQKYNIGE-LDLEV 645

Query: 856 WRHLFHKISHSFLEH-EEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVD 914
           ++  F + + +  EH  +    +  ++ +N   K+  + I   L G  DRID  K G + 
Sbjct: 646 FKLKFIQFAKNEKEHFSQGFYVAHTELELNNILKLGTDKIK--LKGTIDRIDSSKEGNL- 702

Query: 915 ITDYKTGDNP 924
           I DYK+G  P
Sbjct: 703 IIDYKSGKVP 712


>gi|255535481|ref|YP_003095852.1| hypothetical protein FIC_01342 [Flavobacteriaceae bacterium
           3519-10]
 gi|255341677|gb|ACU07790.1| hypothetical protein FIC_01342 [Flavobacteriaceae bacterium
           3519-10]
          Length = 911

 Score = 55.8 bits (133), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 146/341 (42%), Gaps = 40/341 (11%)

Query: 608 IITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
           +I +L++ ET+  + E    L ++G LE+RLLNF+ +IL   NEG  P    +N +L   
Sbjct: 470 LINQLVNSETIDFQGEPLEGLQVMGLLETRLLNFENIILLSANEGKLPLGNTQNTYLPFD 529

Query: 668 MQSDLNLKT-AEKYIGQAAHDFEMANGTR--HLIYTRSLRENNIPTIASRWLQRLLVLGG 724
           ++   NL T  E     A H + +   ++  HL++  +L         SR++ ++ +   
Sbjct: 530 IRRHFNLHTFLENDSIYAYHYYRLIQESQNVHLLFN-ALNSGVNTGEKSRFITQMEIEDR 588

Query: 725 TDFFDNLKKRGQCYLDWTRKLDYTTKQPHY--KRPKPFPPLEAQPRTYSFSEIKQLINDP 782
                N+              D   ++P +  K PK    LEA     S S +   I +P
Sbjct: 589 HHQITNVIIENAA--------DPILQKPMHIAKTPKVIEILEAWKARISASHLTSYIYNP 640

Query: 783 YAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHL------MK 836
              Y  +IL        +++  +   G L H  + ++ +K + K T  +  L      + 
Sbjct: 641 ADFYLNKILNTREADEMEEELSQRSYGNLVHYALQDIYEKFVGK-TLTVKDLDLTDQNIV 699

Query: 837 QIIDSHFEKEN-----LPPHIDIIWRHLFHKISHSFLEHEEKI---QSSIEKIFVNIPAK 888
           + +D   EK N         ++ I + +  ++    +E++ K+    +++E I V     
Sbjct: 700 EALDHAIEKLNHQIEFYQNGMNFIHKSIAERVVRGVVEYDRKLVAGGNTLEIIGVEGKFD 759

Query: 889 MA--------IESIGIHLTGFADRIDLLKSGFVDITDYKTG 921
            A         + +G +  GF DRID L +G V I D+KT 
Sbjct: 760 QAEYFLDEEKKDRVGFY--GFIDRIDRL-NGTVRIIDFKTA 797


>gi|86151958|ref|ZP_01070171.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|85841066|gb|EAQ58315.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
          Length = 788

 Score = 55.8 bits (133), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 132/306 (43%), Gaps = 38/306 (12%)

Query: 630 ILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFE 689
           ++G LESR L FD +IL   NE   PK +    FL+  ++         K  G  ++D  
Sbjct: 428 VMGLLESRGLCFDGVILVDFNEEFIPKRSVNELFLNNEVR---------KKAGLISYD-R 477

Query: 690 MANGTRHLIYTRSLREN----------NIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYL 739
             N  R   Y  SL +N          N     SR+L  L      DFF       + YL
Sbjct: 478 RENLQR--FYYESLMKNALEVSICFVENEEKSKSRFLDEL----DFDFFYETHIHQKAYL 531

Query: 740 DWTRKLDYTTKQPHYKRPKPFPPLEAQPRTY--SFSEIKQLINDPYAVYARRILKLDFIP 797
           +   KLDY   +P+   P   P L+  P  +  SFS    L N     Y R IL L    
Sbjct: 532 N-ALKLDYEGIKPNL-TPIKAPILKHNPFEFPLSFSRFNLLENQKRTYYYRYILNLAEPR 589

Query: 798 HFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDI-IW 856
              ++    ++G   H ++    K  +N N  +I  +   ++D  ++K N+   +D+ ++
Sbjct: 590 VLSEESKAKNQGNFIHKMLEIYYKNYVN-NDFDIK-VFANLLDKEYQKYNISE-LDLEVF 646

Query: 857 RHLFHKISHSFLEHEEK-IQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI 915
           +  F + + +  EH  K    +  ++ +N   K+  +SI   L G  DRID  K G + I
Sbjct: 647 KLKFIQFAKNEKEHFSKGFYVAHTELELNNILKLGADSIK--LKGTIDRIDSSKEGNL-I 703

Query: 916 TDYKTG 921
            DYK+G
Sbjct: 704 IDYKSG 709


>gi|298207225|ref|YP_003715404.1| hypothetical protein CA2559_03200 [Croceibacter atlanticus
           HTCC2559]
 gi|83849861|gb|EAP87729.1| hypothetical protein CA2559_03200 [Croceibacter atlanticus
           HTCC2559]
          Length = 911

 Score = 55.8 bits (133), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 144/350 (41%), Gaps = 55/350 (15%)

Query: 608 IITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRV 667
           I   ++  ET+    +K   L I+G LE+R+L+F+ +I+  +NEG+ P   + N +L   
Sbjct: 476 IYKDMLSNETLDFIGKKHDGLQIMGVLETRVLDFENIIITSVNEGILPSGKSANSYLPYD 535

Query: 668 MQSDLNLKTAEK----YIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLG 723
           ++ +  L T ++    Y     H  +  N   H+I+     + N     SR++ +L V  
Sbjct: 536 LKKEYGLPTYKEKDAIYTYHFYHMLQRCNQA-HIIFNTEAGDLNSGE-KSRFITQLQVEA 593

Query: 724 GT---DFFDNLKK-----RGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI 775
                  ++NL       +    L   +K      Q  Y+    F P          S +
Sbjct: 594 QNYPKHSYNNLITLPKVPKITSQLRTVQKTAQVMDQIKYRAKSGFSP----------SAL 643

Query: 776 KQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLM 835
              + +P   Y R +L +      ++       GT+ H+ + +L        TP I  L+
Sbjct: 644 TLYMRNPIDFYTRYVLGVGDTEEVEETVAYNTLGTVVHDTLEQLY-------TPYIGELL 696

Query: 836 -------------KQI---IDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIE 879
                        KQ+    ++ + K +L   ++++   +  +  H+FL+ E+K   + E
Sbjct: 697 NADIIKVMTTKADKQVALEFNNTYSKSSLDKGMNLLIFEVAKRYVHNFLKLEKKRLDNGE 756

Query: 880 KIFV-------NIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGD 922
            I +       N+P  +      ++L G  DR++   +G   I DYKTG+
Sbjct: 757 DIQILKIEEDNNVPITINGIDFPVNLRGKVDRVE-KTNGITRIIDYKTGN 805


>gi|260061424|ref|YP_003194504.1| hypothetical protein RB2501_07485 [Robiginitalea biformata
           HTCC2501]
 gi|88785556|gb|EAR16725.1| hypothetical protein RB2501_07485 [Robiginitalea biformata
           HTCC2501]
          Length = 911

 Score = 55.5 bits (132), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 87/369 (23%), Positives = 158/369 (42%), Gaps = 48/369 (13%)

Query: 584 LSSLFSKIIE-TGSCIKANAIEWIDIITR-LIDGETVKPKIEKSSTLFILGTLESRLLNF 641
            + LF+++I+ TG+    + ++ + ++ R L+  E V  + +  S L ++G LESR L+F
Sbjct: 456 FNQLFNQLIQLTGAYPFVSDLKSLQLLYRQLLADEKVDFEGQPLSGLQVMGMLESRNLDF 515

Query: 642 DTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKT-AEKYIGQAAHDFEMANGTRHLIYT 700
           DT+I+  +NEG+ P   +   F+   ++ +  + T  EK      H + +    R ++  
Sbjct: 516 DTVIITSVNEGILPSGKSNASFIPFDVKREFGMPTYKEKDAVYTYHFYRLLQRARRVVIC 575

Query: 701 RSLRENNIPTIASRWLQRLLVLGG--TDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPK 758
                N  P +         + GG  + F + L  R    L    +L +   +   +RP 
Sbjct: 576 Y----NTEPEV---------IEGGEPSRFINQL--RTDPVLGPQTELAFAVPETGAERPG 620

Query: 759 PF-----PPL-----EAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR 808
                  P L     E     +S + + + I DP   Y R +L LD     ++       
Sbjct: 621 ELRIHKGPELLERLQEMASSGFSPTSLSRFIADPLLFYQRNVLGLDETEELEETVAANTF 680

Query: 809 GTLFHNIITELIK----KRINK-NTPEINHLMKQIIDSHFEKENLPPH---------IDI 854
           GT+ H+ + EL +      +N+ N  E+ +     I+  F K  L            + +
Sbjct: 681 GTVLHDALEELYRPLEGAFLNRDNLAELRNRSDSAIERAFRKNYLRDGKARGKNLIALQV 740

Query: 855 IWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIG--IHLTGFADRIDLLKSGF 912
           + +HL H +  S +   EK +  I  +      ++A+  +   + L G  DRI+ +  G 
Sbjct: 741 LRQHLDHFLG-SEVTRAEKHRIRILGVEKKFRQELAVPGLQHPVTLKGTVDRIEEV-DGQ 798

Query: 913 VDITDYKTG 921
           V I DYKTG
Sbjct: 799 VRIVDYKTG 807


>gi|298376810|ref|ZP_06986765.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
 gi|298266688|gb|EFI08346.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
          Length = 959

 Score = 55.5 bits (132), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 136/348 (39%), Gaps = 43/348 (12%)

Query: 605 WIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFL 664
           +  ++ R+ D  T+    +  S L I+G LE+R L+FD LI+  +NEG++P+  A N F+
Sbjct: 504 FFRLLKRVTDTITIPFHGDPLSGLQIMGVLETRALDFDRLIILSMNEGIFPQRKAANSFI 563

Query: 665 SRVMQSDLNLKTAEKYIGQ-AAHDFEMANGTRHLIYTRSLRENNIPTI-ASRWLQRLLVL 722
              ++    L T E      A H + +     H+      R N + T   SR++ +L   
Sbjct: 564 PYNLRRGFGLPTYEHQDSVWAYHFYRLIERASHVSLLYDTRSNGLQTGEVSRFVHQLHYH 623

Query: 723 GGTDFFD-----NLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQ 777
                 D     N+       L   ++ D   +   Y++           +  S S I  
Sbjct: 624 YEVPMRDKLVVYNVSSSKTPPLAVPKREDIMRRLDAYRK--------GGSKAISASAINT 675

Query: 778 LINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK------------KRIN 825
            ++ P   Y   +  +       +  +    G++ H ++ EL K            K I 
Sbjct: 676 YLDCPLKFYFSVVEGIREEEEVSETIESDVFGSILHKVMEELYKPFQGKMVTVDLLKAIR 735

Query: 826 KNTPEINHLMKQIIDSHFEKENLPPHI---DIIWRHLFHKISHSFLEHEEKIQSSIEKIF 882
           K+T  +   + +   S F K  +   +   + +   +  K     LE + K+       F
Sbjct: 736 KDTALLTGAIARAFASEFFKTEVVRSLTGQNYLIGEMIRKYVEKILERDGKLTP-----F 790

Query: 883 VNIPAKMAIESI-------GIHLTGFADRIDLLKSGFVDITDYKTGDN 923
           V I ++  I  +        I L GF DR+D ++   + I DYK+G  
Sbjct: 791 VYIESERKINGLISLSDYSEIRLKGFIDRVDEVRDA-IRIIDYKSGSG 837


>gi|300726046|ref|ZP_07059504.1| conserved hypothetical protein [Prevotella bryantii B14]
 gi|299776653|gb|EFI73205.1| conserved hypothetical protein [Prevotella bryantii B14]
          Length = 955

 Score = 55.1 bits (131), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 171/400 (42%), Gaps = 76/400 (19%)

Query: 345 LENKIPNIQKCFS---DVALIEADNEREEAISIAIALRMSLD-ENKKKSALITADRNLAR 400
           L+N   NI   F+    V  I A  E  +A  ++  L+ +   E  +++A++ AD  L  
Sbjct: 263 LDNTNSNIYHNFTRPKQVTYISAATENIQARYVSEWLKANNRIEAGRRTAVVMADEALLN 322

Query: 401 RVKLELTRFGINIDISAGIPLSTTLHSSILTSL--LNAI--------FKLNDFMAIATLV 450
            V   L      ++++ G PL+ T  SS + +L  L  I        F+L+   AI   +
Sbjct: 323 TVIHSLPEEVTKVNVTTGYPLAQTPVSSFVETLIQLQTIGHPKDTDRFRLHQVNAI---L 379

Query: 451 KHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQS 510
           +HP A+      Y+S               N  ++ D  ++V  R        + P  + 
Sbjct: 380 RHPYAR------YIS--------------DNCKEVYDNINIVSKR--------YYPSMKD 411

Query: 511 RLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNV--CLDE 568
            L+ ED+ LA+L  D  L   T  +                  TK  VT L +V  C   
Sbjct: 412 -LAGEDENLALLFSD--LSAETQYL-----------------HTKRLVTWLCDVLQCTGH 451

Query: 569 HRKL-PNLWFEEEGKTLSSLFSKII---ETGSCIKANAIEWIDIITRLIDGETVKPKIEK 624
           H K   +  F+E    + +L ++++   +TG  ++ +   +  ++T+LI   T+    E 
Sbjct: 452 HAKDDKDALFQESLFRMYTLLNRLVGLMDTGD-LEIDIQTFTRLLTQLIQSTTIPFHGEP 510

Query: 625 SSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQA 684
           +  + ++G LE+R L+FD +++   NEG  PK    + F+   ++    L T +  +   
Sbjct: 511 AVGIQVMGVLETRNLDFDHVLILSCNEGNLPKGVNDSSFIPYSIRKAYGLTTVDNKVAIY 570

Query: 685 AHDFE---MANGTRHLIYTRSLRENNIPTIASRWLQRLLV 721
           A+ F       G   LIY  S  + +   + SR++ ++LV
Sbjct: 571 AYYFHSLLQRAGDVTLIYNNSTEDGHTGEM-SRFMLQMLV 609


>gi|224023771|ref|ZP_03642137.1| hypothetical protein BACCOPRO_00487 [Bacteroides coprophilus DSM
           18228]
 gi|224016993|gb|EEF75005.1| hypothetical protein BACCOPRO_00487 [Bacteroides coprophilus DSM
           18228]
          Length = 971

 Score = 55.1 bits (131), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 133/645 (20%), Positives = 255/645 (39%), Gaps = 101/645 (15%)

Query: 358 DVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISA 417
           ++  IE+  E  +A  +   +R +L E++K++A++  + ++ + V   L     +++I+ 
Sbjct: 295 EITYIESPTENGQARYLPQWIRTNLTEDEKETAVVLCNESMLQPVLHSLPENVSHLNITM 354

Query: 418 GIPLSTTLHSSILTSLL---NAIFKLND----FMAIATLVKHPLAKFGFPEKYLSRAKNA 470
           G PLS T   S + +L+    A +  N+    F  + ++++HP  +   PE         
Sbjct: 355 GFPLSQTPAYSFVNALMELHTAGYNPNNGRYRFDEVISVLRHPYTRQLSPE--------- 405

Query: 471 LELVALRGNKNSYDIMDLKSLVLDRIATQKNNTH-VPHWQSRLSEEDKELAVLLVDHILQ 529
                              +  L++  TQ N  + +P      SE +K+ A+ L      
Sbjct: 406 -------------------AGKLEKALTQDNRFYPLP------SELEKDEALEL------ 434

Query: 530 CITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEE--EGKTLSSL 587
               L   +    S C  + +++  K    C Q            L+ E      TL + 
Sbjct: 435 ----LFQPREGNLSLC--IMLAEALKRMAACYQQQAASADAAFDQLYREALFNAFTLINR 488

Query: 588 FSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILG 647
           F  + E+G  ++     +  ++TR++   ++    E +  + ++G LE+R L+F  LI+ 
Sbjct: 489 FHTLTESGE-LQVQPATFKRLLTRVMSAASIPFHGEPAIGMQVMGVLETRNLDFRHLIML 547

Query: 648 GLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDF----EMANGTRHLIYTRSL 703
            +NEG  PK+  +  F+   ++    + T +  I   A+ F    + A     L+Y  S 
Sbjct: 548 SVNEGQLPKSGGEASFIPYNLRKAFGMTTIDHKIAVYAYYFYRLLQRAEKVT-LVYNTST 606

Query: 704 RENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH-YKRPKPFPP 762
              N   + SR++ + L+         + +  Q     T       K P   +R +    
Sbjct: 607 DGINRGEM-SRFMLQFLIEWEYPVRRMVLEAAQS--PQTTAPITIEKTPDVMRRMQSVFD 663

Query: 763 LEAQPRTY-SFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK 821
           +   P+ + S S +   ++ P   Y + + +L        + D +  G++FH+    + K
Sbjct: 664 VRVNPKAFLSPSALNCYLDCPLKFYYKYVAQLSAPDEVSAEVDASHFGSIFHDAAEHIYK 723

Query: 822 ------KRINKNTPEI----NHLMKQIIDSHFEK--ENLPPH-------IDIIWRHLFHK 862
                 K INK   E        +++ +D+ F+K   N+P         I +I   +  +
Sbjct: 724 DLTAHGKVINKEAIETLLKDEVRLQEYVDNGFKKLFFNIPKEERAEYNGIQLINSAVITR 783

Query: 863 ISHSFLEHEEKIQSSI---------EKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFV 913
                LE++ +              E I +  P  +    IG    G  DR+D  K G +
Sbjct: 784 YLKQLLENDLRYAPFTFSGSEHFVSEDIDIRTPRGILKSRIG----GIIDRLD-TKDGTL 838

Query: 914 DITDYKT-GDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKV 957
            I DYKT GD       + L  P     A   +   ++ I CRK+
Sbjct: 839 RIVDYKTGGDADTPANVESLFLPDKKRSAYVFQTFLYASIVCRKL 883


>gi|207723137|ref|YP_002253536.1| homologous recombinational repair protein (partial sequence c
           terminus) [Ralstonia solanacearum MolK2]
 gi|206588330|emb|CAQ35293.1| probable homologous recombinational repair protein (partial
           sequence c terminus) [Ralstonia solanacearum MolK2]
          Length = 755

 Score = 54.7 bits (130), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 123/598 (20%), Positives = 210/598 (35%), Gaps = 108/598 (18%)

Query: 369 EEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSS 428
           +EA   A  L   L+  ++  AL+  DR +ARRV+  L R  + +    G  LSTT  ++
Sbjct: 104 DEAAFAAHTLVDWLNAGRRSLALVAQDRIVARRVRALLARVNVPVRDETGWKLSTTRAAA 163

Query: 429 ILTSLLNAIFKLNDFMAIATLVKHP--LAKFGFPEKYLSRAKNALELVALRGNKNSYDIM 486
            L   L+ +    D  A+  L+K P  L +   P          LE    R N +     
Sbjct: 164 ALMRWLDVVQGDGDTAALLDLLKSPFCLREADAPSSVAPAWVAELERRVRRRNVSG---- 219

Query: 487 DLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCG 546
                 L R+A Q+               D + A +     L     L+  +       G
Sbjct: 220 --GWGRLRRLAAQRGT-------------DTDAADVTDAGPLAERLGLLADEAALWRRAG 264

Query: 547 NLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKI-IETGSCIKANA--- 602
           + ++  W    VT L    LD  R    L  ++ G+ L     ++ +       A A   
Sbjct: 265 HATLEAW----VTLLAGT-LDRLRMRTGLQNDDAGRQLLDWLDRLRVSVHGSADAGARFS 319

Query: 603 -IEWIDIITRLIDGETV-KPKIEKSSTLFILG