>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

Probab=95.40  E-value=0.018  Score=35.60  Aligned_cols=31  Identities=29%  Similarity=0.430  Sum_probs=26.5

Q ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             4589969999878786889999999976078
Q gi|254780824|r   29 ILRLGDCLTLSGDLGSGKSFLARSIIRFLMH   59 (162)
Q Consensus        29 ~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~   59 (162)
T Consensus        22 ~i~~Gei~~lvG~nGaGKSTl~~~i~Gl~~p   52 (163)
T cd03216          22 SVRRGEVHALLGENGAGKSTLMKILSGLYKP   52 (163)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             9879989999988998999999999577689