HHsearch alignment for GI: 254780824 and conserved domain: cd03294

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.59  E-value=0.036  Score=33.81  Aligned_cols=31  Identities=39%  Similarity=0.493  Sum_probs=26.0

Q ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             4589969999878786889999999976078
Q gi|254780824|r   29 ILRLGDCLTLSGDLGSGKSFLARSIIRFLMH   59 (162)
Q Consensus        29 ~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~   59 (162)
T Consensus        46 ~i~~GE~~~ivG~SGsGKSTLLr~i~GL~~p   76 (269)
T cd03294          46 DVREGEIFVIMGLSGSGKSTLLRCINRLIEP   76 (269)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             8889999999989984899999999759999