>cd04118 Rab24 Rab24 subfamily. Rab24 is distinct from other Rabs in several ways. It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments. It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita

Probab=94.62 E-value=0.13 Score=30.41 Aligned_cols=88 Identities=10% Similarity=0.065 Sum_probs=53.0 Q ss_pred EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHH---HCCCCCCEEEEEEECCCCHHHHHCCCHHHHCC--CCEE Q ss_conf 999878786889999999976078885302452020110---03788608999865178977753058367508--9789 Q gi|254780824|r 36 LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ---LYDASIPVAHFDFYRLSSHQEVVELGFDEILN--ERIC 110 (162) Q Consensus 36 i~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~---~Y~~~~~i~H~DlYRL~~~~E~~~lg~~e~~~--~~i~ 110 (162) T Consensus 3 ivlvGd~~VGKTsLi~r~~~~~f~~~---~y~~tig~~~~~k~i~v~~~~v~l~iwDtaG~e~~~~l~~-~y~~~a~~~i 78 (193) T cd04118 3 VVMLGKESVGKTSLVERYVHHRFLVG---PYQNTIGAAFVAKRMVVGERVVTLGIWDTAGSERYEAMSR-IYYRGAKAAI 78 (193) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCC---CCCCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHH-HHHCCCCEEE T ss_conf 99999699879999999985979989---9787630588999999999999999991999731235579-8834774457 Q ss_pred EE-------------ECHHHHHCCCCCCEE Q ss_conf 99-------------985563204995409 Q gi|254780824|r 111 II-------------EWPEIGRSLLPKKYI 127 (162) Q Consensus 111 lI-------------EWpe~~~~~lp~~~i 127 (162) T Consensus 79 lvydit~~~Sf~~i~~W~~~i~~~~~~~~i 108 (193) T cd04118 79 VCYDLTDSSSFERAKFWVKELQNLEEHCKI 108 (193) T ss_pred EEECCCCHHHHHHHHHHHHHHHHHCCCCCE T ss_conf 883069879999899999999974899997

HHsearch alignment for GI: 254780824 and conserved domain: cd04118