>cd04160 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.

Probab=95.30 E-value=0.053 Score=32.75 Aligned_cols=75 Identities=17% Similarity=0.316 Sum_probs=41.0 Q ss_pred EEEECCCCCCHHHHHHHHHHHHCCCCCC--CCCCCHHHHHHHCCCCCCEEEEEEECCCCHHHHHCCCHHHHCC--CCEEE Q ss_conf 9998787868899999999760788853--0245202011003788608999865178977753058367508--97899 Q gi|254780824|r 36 LTLSGDLGSGKSFLARSIIRFLMHDDAL--EVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN--ERICI 111 (162) Q Consensus 36 i~L~GdLGaGKTtfvr~i~~~lg~~~~~--~V~SPTF~l~~~Y~~~~~i~H~DlYRL~~~~E~~~lg~~e~~~--~~i~l 111 (162) T Consensus 2 ivilG~~~~GKTsll~~l~~~~~~~~~~~~~~~~~Tvg~~-~~~i~~~~~~l~iwD~~Gqe~~~~l-~~~y~~~a~~ii~ 79 (167) T cd04160 2 VLILGLDNAGKTTFLEQLKTLFSKYKGLPPSKITPTVGLN-IGTIEVGNARLKFWDLGGQESLRSL-WDKYYAECHAIIY 79 (167) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCEE-EEEEEECCEEEEEEECCCCHHHHHH-HHHHCCCCCEEEE T ss_conf 9999999988889999887503676777655403531326-8999989999999968987888789-9874289878999 Q ss_pred E Q ss_conf 9 Q gi|254780824|r 112 I 112 (162) Q Consensus 112 I 112 (162) T Consensus 80 V 80 (167) T cd04160 80 V 80 (167) T ss_pred E T ss_conf 9

HHsearch alignment for GI: 254780824 and conserved domain: cd04160