RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780824|ref|YP_003065237.1| hypothetical protein CLIBASIA_03585 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >gnl|CDD|129254 TIGR00150, HI0065_YjeE, ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity. Length = 133 Score = 113 bits (284), Expect = 3e-26 Identities = 47/135 (34%), Positives = 74/135 (54%), Gaps = 4/135 (2%) Query: 12 PIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT 71 P+EK G+ A L G + L GDLG+GK+ L + +++ L V SPTFT Sbjct: 1 ANPDEKAMDKFGKAFAKPLDFGTVVLLKGDLGAGKTTLVQGLLQGLGIQ--GNVTSPTFT 58 Query: 72 LVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129 LV Y+ ++ V HFD YRL+ +E+ +G ++ + IC++EWPE G +LP + I Sbjct: 59 LVNEYNEGNLMVYHFDLYRLADPEELELMGLEDYFEGDGICLVEWPEEGLEILPDYDLQI 118 Query: 130 HLSQGKTGRKATISA 144 + GR+ ++A Sbjct: 119 KIDYVGDGREIELTA 133 >gnl|CDD|182615 PRK10646, PRK10646, ADP-binding protein; Provisional. Length = 153 Score = 106 bits (265), Expect = 4e-24 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (2%) Query: 10 VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69 VIP+P+E+ T+ LG +A + L GDLG+GK+ +R ++ L H V SPT Sbjct: 5 VIPLPDEQATLDLGARVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62 Query: 70 FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127 +TLV+ Y + V HFD YRL+ +E+ +G D N+ IC++EWP+ G +LP + Sbjct: 63 YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGAGVLPDPDV 122 Query: 128 DIHLSQGKTGRKATISA 144 +IHL GR+A +SA Sbjct: 123 EIHLDYQAQGREARVSA 139 >gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment. Length = 148 Score = 32.7 bits (74), Expect = 0.043 Identities = 18/93 (19%), Positives = 36/93 (38%), Gaps = 1/93 (1%) Query: 33 GDCLTLSGDLGSGKSFLARSIIRFLM-HDDALEVLSPTFTLVQLYDASIPVAHFDFYRLS 91 G+ + + G GSGK+ LAR++ R L + + L ++ D + + Sbjct: 2 GEVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVGGKKASG 61 Query: 92 SHQEVVELGFDEILNERICIIEWPEIGRSLLPK 124 S + + L + ++ EI L + Sbjct: 62 SGELRLRLALALARKLKPDVLILDEITSLLDAE 94 >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional. Length = 623 Score = 31.4 bits (71), Expect = 0.12 Identities = 17/47 (36%), Positives = 27/47 (57%) Query: 11 IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL 57 I E+ I R+L+ L+ G+ L + G+ GSGKS A +++R L Sbjct: 20 IAFMQEQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTALALMRLL 66 >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se. Length = 224 Score = 30.4 bits (69), Expect = 0.22 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 30 LRLGDCLTLSGDLGSGKSFLARSIIR 55 + G+C+ LSG G+GKS L +S+ Sbjct: 31 VNAGECVALSGPSGAGKSTLLKSLYA 56 >gnl|CDD|181455 PRK08517, PRK08517, DNA polymerase III subunit epsilon; Provisional. Length = 257 Score = 30.0 bits (68), Expect = 0.32 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Query: 79 SIPVAH---FDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126 S+ VAH FD+ +S E E+G +LN ++C I+ + R++ +Y Sbjct: 148 SVFVAHNVNFDYNFISRSLE--EIGLGPLLNRKLCTIDLAK--RTIESPRY 194 >gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional. Length = 529 Score = 29.7 bits (67), Expect = 0.37 Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 33 GDCLTLSGDLGSGKSFLARSIIRFL 57 G+ L L G+ GSGKS A SI+R L Sbjct: 35 GETLALVGESGSGKSVTALSILRLL 59 >gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. Length = 544 Score = 29.2 bits (66), Expect = 0.46 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Query: 5 EKHLTV----IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSII 54 E HL+V I P K G L+ G+ L + G GSGKS LAR I+ Sbjct: 314 EGHLSVENVTIVPPGGKKPTLRGISFR--LQAGEALAIIGPSGSGKSTLARLIV 365 >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous. Length = 230 Score = 28.9 bits (65), Expect = 0.61 Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 25 HLASILRLGDCLTLSGDLGSGKSFLARSIIRFL 57 L L+ G+ L L G+ GSGKS +I+ L Sbjct: 4 DLNLSLKRGEVLALVGESGSGKSLTCLAILGLL 36 >gnl|CDD|181233 PRK08116, PRK08116, hypothetical protein; Validated. Length = 268 Score = 28.4 bits (64), Expect = 0.76 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 36 LTLSGDLGSGKSFLARSIIRFLM 58 L L G +G+GK++LA I L+ Sbjct: 117 LLLWGSVGTGKTYLAACIANELI 139 >gnl|CDD|185183 PRK15283, PRK15283, putative fimbrial subunit StfA; Provisional. Length = 186 Score = 28.2 bits (62), Expect = 1.2 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Query: 18 NTICLGRHLASILRLGDC----LTLSGDLGSGKSFL 49 ++I +G HL S ++LGD LT++G + + K L Sbjct: 120 SSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTL 155 >gnl|CDD|129213 TIGR00107, deoD, purine-nucleoside phosphorylase, family 1 (deoD). Purine nucleoside phosphorylase (also called inosine phosphorylase) is a purine salvage enzyme. Purine nucleosides, such as guanosine, inosine, or xanthosine, plus orthophosphate, can be converted to their respective purine bases (guanine, hypoxanthine, or xanthine) plus ribose-1-phosphate. This family of purine nucleoside phosphorylase is restricted to the bacteria. Length = 232 Score = 27.4 bits (61), Expect = 1.7 Identities = 17/63 (26%), Positives = 25/63 (39%), Gaps = 16/63 (25%) Query: 29 ILRLGDCLTLSGDLG----------SGKSFLARSIIRFLMHDDALEVLSPTFTLVQL-YD 77 I+R+G C + D+ S S R +RF+ D A F LV+L Y Sbjct: 82 IIRIGSCGAIRPDVKLRDVIIAMGASTDSKYNR--VRFVEVDFA---AIADFELVELAYQ 136 Query: 78 ASI 80 + Sbjct: 137 TAK 139 >gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional. Length = 331 Score = 27.4 bits (61), Expect = 2.0 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Query: 30 LRL--GDCLTLSGDLGSGKSFLARSII 54 LRL G+ L + G+ G GKS AR+II Sbjct: 42 LRLYEGETLGVVGESGCGKSTFARAII 68 >gnl|CDD|150151 pfam09382, RQC, RQC domain. This DNA-binding domain is found in the RecQ helicase among others and has a helix-turn-helix structure. The RQC domain, found only in RecQ family enzymes, is a high affinity G4 DNA binding domain. Length = 92 Score = 27.1 bits (61), Expect = 2.1 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Query: 43 GSGKSF---LARSIIRFLMHDDALEVLSPTFTLVQLYDASIPV 82 G GK R +IR L+ + LEV + +++L V Sbjct: 49 GIGKDLSKKEWRRLIRQLIAEGYLEVDIEGYGVLKLTPKGREV 91 >gnl|CDD|129002 smart00763, AAA_PrkA, PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain. Length = 361 Score = 26.9 bits (60), Expect = 2.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 36 LTLSGDLGSGKSFLARSIIRFL 57 L L G +G GKS L + R L Sbjct: 81 LYLLGPVGGGKSSLVECLKRGL 102 >gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model. Length = 139 Score = 26.9 bits (60), Expect = 2.7 Identities = 12/44 (27%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Query: 38 LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT----LVQLYD 77 L G G+GKS LA + L + V T L + Sbjct: 4 LVGPPGTGKSELAERLAAALSNRPVFYVQLTRDTTEEDLKGRRN 47 >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005). Length = 500 Score = 26.7 bits (59), Expect = 2.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 30 LRLGDCLTLSGDLGSGKSFLAR 51 +R G+C+ L G+ G+GKS L + Sbjct: 24 VRPGECVGLCGENGAGKSTLMK 45 >gnl|CDD|177362 PHA02415, PHA02415, DNA primase domain-containing protein. Length = 930 Score = 26.5 bits (58), Expect = 3.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 22 LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL 57 LG HL ++L +T+ + G+GKS L + + R L Sbjct: 573 LGGHLKALLGFWPHITIQANKGAGKSTLIKRLERSL 608 >gnl|CDD|161851 TIGR00389, glyS_dimeric, glycyl-tRNA synthetase, dimeric type. This model describes a glycyl-tRNA synthetase distinct from the two alpha and two beta chains of the tetrameric E. coli glycyl-tRNA synthetase. This enzyme is a homodimeric class II tRNA synthetase and is recognized by pfam model tRNA-synt_2b, which recognizes His, Ser, Pro, and this set of glycyl-tRNA synthetases. Length = 551 Score = 26.3 bits (58), Expect = 3.5 Identities = 13/50 (26%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Query: 41 DLGSGKSFLARSIIR-----FLMHDDALEVLSPTFTLVQLYDASIPVAHF 85 D G + L +I F+ ++ LE+ +P T ++ AS V +F Sbjct: 31 DYGPLGAVLKNNIKNAWRKFFIKNERVLEIDTPIITPEEVLKASGHVDNF 80 >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional. Length = 506 Score = 26.4 bits (59), Expect = 3.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 30 LRLGDCLTLSGDLGSGKSFL 49 +R G+ ++L G+ G+GKS L Sbjct: 28 VRAGEIVSLCGENGAGKSTL 47 >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. Length = 571 Score = 26.2 bits (58), Expect = 3.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 33 GDCLTLSGDLGSGKSFLARSIIRFLMHD 60 G+ + L G GSGKS L I RF D Sbjct: 358 GETVALVGRSGSGKSTLVNLIPRFYEPD 385 >gnl|CDD|177488 PHA02774, PHA02774, E1; Provisional. Length = 613 Score = 26.0 bits (58), Expect = 5.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 35 CLTLSGDLGSGKSFLARSIIRFL 57 CL + G +GKS S+I+FL Sbjct: 436 CLVIYGPPDTGKSMFCMSLIKFL 458 >gnl|CDD|171876 PRK13152, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional. Length = 201 Score = 25.6 bits (56), Expect = 6.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 98 ELGFDEILNERICIIEWPEIG 118 ELGF E L E++ + + P +G Sbjct: 58 ELGFIEALKEQVLVQKKPILG 78 >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. Length = 265 Score = 25.5 bits (56), Expect = 6.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 30 LRLGDCLTLSGDLGSGKSFLARSII 54 + G+ + L G G GKS LAR ++ Sbjct: 34 IEEGETVGLLGRSGCGKSTLARLLL 58 >gnl|CDD|172945 PRK14470, PRK14470, ribosomal RNA large subunit methyltransferase N; Provisional. Length = 336 Score = 25.3 bits (55), Expect = 7.1 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Query: 11 IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMH 59 IP+ + + +CL L C T G LG +S + I+ L+ Sbjct: 90 IPLFDTHHVVCLSSQAGCALGCAFCAT--GKLGLDRSLRSWEIVAQLLA 136 >gnl|CDD|180029 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional. Length = 412 Score = 25.1 bits (56), Expect = 7.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 43 GSGKSFLARSIIRFL 57 GSGK+ LA+++ R L Sbjct: 118 GSGKTLLAQTLARIL 132 >gnl|CDD|148992 pfam07693, KAP_NTPase, KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side. Length = 301 Score = 25.4 bits (56), Expect = 7.7 Identities = 16/107 (14%), Positives = 31/107 (28%), Gaps = 18/107 (16%) Query: 35 CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQ 94 + L G GSGK+ + + + + +FD + S Sbjct: 22 VIGLYGAWGSGKTSFLNLLED-ELKEF---------------PEEFHIVYFDPWLFSGQD 65 Query: 95 EVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKAT 141 + V + + E+ + LL K + + K G Sbjct: 66 DAVASLLAALADA--LEEEYSALATKLLIGKKLLALVIGAKIGGNFG 110 >gnl|CDD|128538 smart00242, MYSc, Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin. Length = 677 Score = 25.2 bits (56), Expect = 9.0 Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 35 CLTLSGDLGSGKSFLARSIIRFL 57 + +SG+ G+GK+ + I+++L Sbjct: 94 SIIISGESGAGKTENTKKIMQYL 116 >gnl|CDD|148176 pfam06414, Zeta_toxin, Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid. Length = 191 Score = 24.9 bits (55), Expect = 9.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 38 LSGDLGSGKSFLARSIIRFLMHDDALEV 65 L G G+GK+ LAR+++ L + + + Sbjct: 17 LGGQPGAGKTELARALLEELGGGNVVRI 44 >gnl|CDD|131019 TIGR01964, chpXY, CO2 hydration protein. This small family of proteins includes paralogs ChpX and ChpY in Synechococcus sp. PCC7942 and other cyanobacteria, associated with distinct NAD(P)H dehydrogenase complexes. These proteins collectively enable light-dependent CO2 hydration and CO2 uptake; loss of both blocks growth at low CO2 concentrations. Length = 367 Score = 25.2 bits (55), Expect = 9.1 Identities = 10/41 (24%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 50 ARSII-RFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYR 89 R I + + ++L + L LY+ ++P FYR Sbjct: 195 GRPIYYHVYIDGETYDILPKSAGLTFLYETAVPYVEAVFYR 235 >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins. Length = 252 Score = 25.2 bits (55), Expect = 9.2 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 10/47 (21%) Query: 33 GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV---QLY 76 G+ + L G GSGKS +I+R LM LE + V QLY Sbjct: 26 GEKVALIGPSGSGKS----TILRILM---TLEPIDEGQIQVEGEQLY 65 >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional. Length = 257 Score = 24.9 bits (54), Expect = 9.3 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 17/82 (20%) Query: 33 GDCLTLSGDLGSGKSFLARSIIRFLMH--DDALEVLSPTFTLVQLYDASIPVAH------ 84 GD +++ G GSGKS R I FL + ++ V T LV+ D + VA Sbjct: 31 GDVISIIGSSGSGKSTFLRC-INFLEKPSEGSIVVNGQTINLVRDKDGQLKVADKNQLRL 89 Query: 85 --------FDFYRLSSHQEVVE 98 F + L SH V+E Sbjct: 90 LRTRLTMVFQHFNLWSHMTVLE 111 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.138 0.410 Gapped Lambda K H 0.267 0.0793 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,630,016 Number of extensions: 160215 Number of successful extensions: 384 Number of sequences better than 10.0: 1 Number of HSP's gapped: 378 Number of HSP's successfully gapped: 53 Length of query: 162 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,136,185 Effective search space: 314350060 Effective search space used: 314350060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.1 bits)