BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780824|ref|YP_003065237.1| hypothetical protein CLIBASIA_03585 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780824|ref|YP_003065237.1| hypothetical protein CLIBASIA_03585 [Candidatus Liberibacter asiaticus str. psy62] Length = 162 Score = 335 bits (858), Expect = 3e-94, Method: Compositional matrix adjust. Identities = 162/162 (100%), Positives = 162/162 (100%) Query: 1 MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60 MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD Sbjct: 1 MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60 Query: 61 DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS 120 DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS Sbjct: 61 DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS 120 Query: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ Sbjct: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162 >gi|254780826|ref|YP_003065239.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Score = 25.4 bits (54), Expect = 0.58, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 34 DCLTLSGDLGSGKSFLARSIIRFLMHDD 61 D G G+GK+ L+ S+ RFL+ DD Sbjct: 219 DVALFFGLSGTGKTTLSASVDRFLIGDD 246 >gi|254780925|ref|YP_003065338.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus Liberibacter asiaticus str. psy62] Length = 833 Score = 25.0 bits (53), Expect = 0.76, Method: Compositional matrix adjust. Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 7/115 (6%) Query: 7 HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66 H +I +P E++ L + L + ++ L + S K F+ +RFL D + L Sbjct: 187 HRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNN--SKKGFMFG--VRFLRDSDGNQYL 242 Query: 67 SPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSL 121 + + A+FD +H+ VV++ FDE+ R + IG+ L Sbjct: 243 VEDKVEISGIHLNGATANFD---PKTHKPVVDISFDEMGARRFFEVTRDNIGKPL 294 >gi|255764514|ref|YP_003065586.2| DNA repair protein RecN [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Score = 24.6 bits (52), Expect = 0.80, Method: Compositional matrix adjust. Identities = 11/17 (64%), Positives = 13/17 (76%) Query: 38 LSGDLGSGKSFLARSII 54 LSGD GSGKS L ++I Sbjct: 26 LSGDTGSGKSILLDALI 42 >gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Score = 24.3 bits (51), Expect = 1.3, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 33 GDCLTLSGDLGSGKSFLARSIIRF 56 G+ + L GD G+GK+ + I+RF Sbjct: 316 GETIALVGDSGAGKTSIFSLILRF 339 >gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 23.9 bits (50), Expect = 1.7, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 30 LRLGDCLTLSGDLGSGKSFLARSI 53 ++ G+ L L G G+GKS L RSI Sbjct: 52 VKKGEILVLMGLSGAGKSTLLRSI 75 >537021.9.peg.472_1 Length = 369 Score = 23.9 bits (50), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 16/32 (50%) Query: 31 RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDA 62 R+ LSG G GK+ AR I R L + A Sbjct: 19 RIAQSYMLSGTRGIGKTTTARIIARSLNYKTA 50 >gi|254780724|ref|YP_003065137.1| component of type IV pilus [Candidatus Liberibacter asiaticus str. psy62] Length = 483 Score = 23.5 bits (49), Expect = 1.8, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 24/50 (48%) Query: 23 GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72 R L I R+ + +SG GSGK+ L + R++ D+ + T L Sbjct: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289 >gi|254780531|ref|YP_003064944.1| flagellin domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 452 Score = 23.1 bits (48), Expect = 2.6, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 38 LSGDLGSGKSFLARSIIRFLMHDDALEV 65 L DLGS + +A+S+I + DD +V Sbjct: 134 LRTDLGSSTASIAKSVIGSFIRDDNGKV 161 >gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 22.7 bits (47), Expect = 3.3, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 8 LTVIPIPNEKNTICLGRHLASILRLGDCLTLS 39 L V+ IP EKN I + L+ I + + + LS Sbjct: 13 LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLS 44 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 22.7 bits (47), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 38 LSGDLGSGKSFLA 50 L GD+GSGK+ +A Sbjct: 298 LQGDVGSGKTLVA 310 >gi|254780881|ref|YP_003065294.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 22.3 bits (46), Expect = 4.0, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 8 LTVIPIPNEKNTICLGRHLASILRLGDCLTLS 39 L V+ IP EKN I + L+ I + + + LS Sbjct: 13 LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLS 44 >gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 22.3 bits (46), Expect = 4.0, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 8 LTVIPIPNEKNTICLGRHLASILRLGDCLTLS 39 L V+ IP EKN I + L+ I + + + LS Sbjct: 13 LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLS 44 >gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 22.3 bits (46), Expect = 4.5, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 38 LSGDLGSGKSFLARSIIRFL 57 L G G GK++LA+++ R + Sbjct: 118 LVGPTGCGKTYLAQTLARII 137 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 22.3 bits (46), Expect = 4.8, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 23/42 (54%) Query: 86 DFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127 D +RL+S + + ++L E I ++EW ++ KKY+ Sbjct: 231 DAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYL 272 >gi|255764501|ref|YP_003064973.2| thiamine transporter membrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 535 Score = 21.9 bits (45), Expect = 5.1, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Query: 93 HQEVVELGFDEILNERICIIEWPEIGRSLLP 123 Q ++LG + R +EWP + R +LP Sbjct: 170 RQLALQLGMNPWYFFRF--VEWPYLRRQILP 198 >gi|254780498|ref|YP_003064911.1| putative glycerol-3-phosphate acyltransferase PlsX [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 21.9 bits (45), Expect = 5.3, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 42 LGSGKSFLARSIIRFLMHDDA 62 LG+ K A IRFLM+ DA Sbjct: 31 LGASKFLEAHPRIRFLMYGDA 51 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.138 0.410 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,036 Number of Sequences: 1233 Number of extensions: 4146 Number of successful extensions: 25 Number of sequences better than 100.0: 19 Number of HSP's better than 100.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 19 length of query: 162 length of database: 328,796 effective HSP length: 67 effective length of query: 95 effective length of database: 246,185 effective search space: 23387575 effective search space used: 23387575 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)