HHsearch alignment for GI: 254780827 and conserved domain: cd02021

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=96.86  E-value=0.0049  Score=40.38  Aligned_cols=36  Identities=28%  Similarity=0.400  Sum_probs=28.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             999527866673379999999997338986899950887588
Q gi|254780827|r   85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFP  126 (311)
Q Consensus        85 IIGIAG~~asGKST~Ar~L~~lL~~~~~~~V~lis~DgF~~~  126 (311)
T Consensus         1 liiv~GvsGsGKSTia~~La~~l------g~~~i~~D~~h~~   36 (150)
T cd02021           1 IIVVMGVSGSGKSTVGKALAERL------GAPFIDGDDLHPP   36 (150)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH------CCCEECCCCCCCH
T ss_conf             98999189999999999999971------9956415433547