HHsearch alignment for GI: 254780827 and conserved domain: cd03297

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.92  E-value=0.0024  Score=42.49  Aligned_cols=45  Identities=33%  Similarity=0.414  Sum_probs=31.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHC----------------------CCCCEEEEEECCCCCCHHH
Q ss_conf             99952786667337999999999733----------------------8986899950887588268
Q gi|254780827|r   85 VVGITGSVAVGKSTFARILCILLQQI----------------------SNFKVSLITTDGFLFPNAV  129 (311)
Q Consensus        85 IIGIAG~~asGKST~Ar~L~~lL~~~----------------------~~~~V~lis~DgF~~~n~~  129 (311)
T Consensus        25 ~~~iiGpSGsGKSTll~~i~GL~~p~sG~I~~~G~~~~~~~~~~~~~~~~r~ig~VfQ~~~Lfp~lt   91 (214)
T cd03297          25 VTGIFGASGAGKSTLLRCIAGLEKPDGGTIVLNGTVLFDSRKKINLPPQQRKIGLVFQQYALFPHLN   91 (214)
T ss_pred             EEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCCCCCCCCCCEEEEECCCCCCCCCC
T ss_conf             9999999973599999999849999964999999997665412467713487589767876578891