RPSBLAST alignment for GI: 254780827 and conserved domain: KOG2878

>gnl|CDD|38089 KOG2878, KOG2878, KOG2878, Predicted kinase [General function prediction only]. Length = 282
 Score = 43.9 bits (103), Expect = 5e-05
 Identities = 38/137 (27%), Positives = 57/137 (41%), Gaps = 28/137 (20%)

Query: 61  NSAKITCHQYNKFLN------LKEESKIPFVVGITGSVAVGKSTFARILCILLQQ--ISN 112
           N  K+T  Q  +FL+       K+   +P V+G +G    GKST    L   L +  I  
Sbjct: 3   NELKLTIDQKARFLHKYIPVFFKDGDDVPLVIGFSGPQGSGKSTLVFALDYKLTKKYIQE 62

Query: 113 FKVSLITTDGFL------------FPNAVLTANNLMQRKGFPESYD---SNKLLTFLSDV 157
           +  + I+ D F              PN     N L+Q +G   ++D     ++L  LS +
Sbjct: 63  YSSATISVDDFYLTHEGQAELRKKNPN-----NALLQYRGLAGTHDLKLLVEVLNALSKL 117

Query: 158 KSGKKKVAVPRYSHSQY 174
                KV VPRY  S +
Sbjct: 118 TKDGLKVKVPRYDKSAF 134