RPSBLAST alignment for GI: 254780827 and conserved domain: KOG4203

>gnl|CDD|39404 KOG4203, KOG4203, KOG4203, Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms, Cytoskeleton]. Length = 473
 Score = 43.4 bits (102), Expect = 8e-05
 Identities = 55/236 (23%), Positives = 93/236 (39%), Gaps = 45/236 (19%)

Query: 79  ESKIPFVVGITGSVAVGKSTFARILCILLQQISNF----KVSLITTDGFLFPNAVLTANN 134
           E K PFV+G+ G  A GKST    +   L  I       +V L++ D F     VLT+  
Sbjct: 40  EGKEPFVIGVAGGTASGKSTVCEKIVEQLGAIERDGRQPQVVLLSQDSFY---KVLTSEE 96

Query: 135 LMQRK------GFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQP- 187
           L + +        P+++D   L   L ++K GK  V +P Y    +   + E   ++ P 
Sbjct: 97  LAKAQEGKYNFDHPDAFDFELLYLTLKNLKKGKA-VEIPVYDFVTHS-RDEEKTIVVYPA 154

Query: 188 DILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFL 247
           D++++EGI                 + D     +++D D        + R +        
Sbjct: 155 DVIILEGILAF----------YDERVRDLFTMKLFVDTDADVRLARRILRDI-------- 196

Query: 248 NPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSV 303
                      I  +         ++    P  +  ILPT+K AD+I+ +G D+ V
Sbjct: 197 --VERGRDLESILTQ---------YSTFVKPAFEEFILPTKKYADVIIPRGGDNDV 241