Query gi|254780830|ref|YP_003065243.1| hypothetical protein CLIBASIA_03615 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 40 No_of_seqs 16 out of 18 Neff 1.7 Searched_HMMs 39220 Date Sun May 29 23:15:44 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780830.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG4800 consensus 26.9 19 0.0005 18.7 0.2 16 13-28 174-189 (248) 2 PRK09693 hypothetical protein; 23.2 22 0.00055 18.4 -0.2 20 9-28 227-246 (489) 3 COG3243 PhaC Poly(3-hydroxyalk 15.6 65 0.0017 16.3 0.9 32 7-38 398-429 (445) 4 TIGR02197 heptose_epim ADP-L-g 15.1 40 0.001 17.2 -0.3 13 23-35 23-35 (353) 5 pfam01600 Corona_S1 Coronaviru 11.3 59 0.0015 16.5 -0.4 13 24-36 208-220 (512) 6 TIGR02400 trehalose_OtsA alpha 10.7 82 0.0021 15.8 0.2 20 14-33 182-202 (476) 7 KOG2671 consensus 10.6 66 0.0017 16.2 -0.3 20 17-36 277-296 (421) 8 COG1331 Highly conserved prote 7.4 1.7E+02 0.0044 14.3 0.8 24 10-33 22-45 (667) 9 pfam11587 Prion_bPrPp Major pr 6.9 1.6E+02 0.004 14.5 0.4 14 22-35 16-29 (29) 10 pfam11229 DUF3028 Protein of u 6.5 1.7E+02 0.0042 14.4 0.3 11 13-23 484-494 (589) No 1 >KOG4800 consensus Probab=26.89 E-value=19 Score=18.66 Aligned_cols=16 Identities=25% Similarity=0.324 Sum_probs=12.6 Q ss_pred CCCCCCCCCHHHHHHH Q ss_conf 3111342000122223 Q gi|254780830|r 13 GIWWMPWHAQAMKDVI 28 (40) Q Consensus 13 g~wWMPw~~eaMKDV~ 28 (40) -..-|||+.||+|+-. T Consensus 174 q~~iv~~~~epgkvc~ 189 (248) T KOG4800 174 QFGIVPWNAEPGKVCG 189 (248) T ss_pred CEEEECCCCCCCCHHH T ss_conf 2255447778641230 No 2 >PRK09693 hypothetical protein; Validated Probab=23.22 E-value=22 Score=18.45 Aligned_cols=20 Identities=20% Similarity=0.499 Sum_probs=14.4 Q ss_pred HHHCCCCCCCCCCHHHHHHH Q ss_conf 22113111342000122223 Q gi|254780830|r 9 QARKGIWWMPWHAQAMKDVI 28 (40) Q Consensus 9 Qa~Kg~wWMPw~~eaMKDV~ 28 (40) -...++||||+|-+-..+.. T Consensus 227 ~~lr~~w~mPrrIrL~~~~~ 246 (489) T PRK09693 227 GFVRGLFWQPYHIELCIPDG 246 (489) T ss_pred CHHHHHHCCCCEEECCCCCC T ss_conf 66877640843021255778 No 3 >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Probab=15.59 E-value=65 Score=16.27 Aligned_cols=32 Identities=19% Similarity=0.356 Sum_probs=18.6 Q ss_pred CHHHHCCCCCCCCCCHHHHHHHHCCCCCCCCC Q ss_conf 11221131113420001222231133366434 Q gi|254780830|r 7 SNQARKGIWWMPWHAQAMKDVICCDKLWGAAN 38 (40) Q Consensus 7 ~~Qa~Kg~wWMPw~~eaMKDV~~CdK~rGa~n 38 (40) ..+..+|.||+-|++=.-+--..-..+++.++ T Consensus 398 ~a~~~~gsww~~w~~wl~~~~~~~~~~~~~g~ 429 (445) T COG3243 398 GAKEHPGSWWPHWQQWLEHRSGGKVPARGLGN 429 (445) T ss_pred HCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCC T ss_conf 61558986143357899861788777888886 No 4 >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria . They consist of lipid A (endotoxin) which anchors LPS to the outer membrane, a non-repeating core oligosachharide, and an immunogenic O-antigen repeat polymer, which is an oligosaccharide of 1-40 units that variesbetween different strains of bacteria. Although the O-antigen and most of the core domain are not necessary for growth in the lab, they appear to help bacteria resist environmental stresses including the complement system and antibiotics. This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of LPS in Gram-negative bacteria . This enzyme is homologous to UDP-glucose 4-epimerase (IPR005886 from INTERPRO) and belongs to the NAD dependent epimerase/dehydratase family. It participates in the biosynthetic pathway leading to incorporation of heptose, a conserved sugar, into the core region of LPS, performing the reaction shown below:ADP-D-glycero-D-manno-heptose = ADP-L-glycero-D-manno-heptose It is a homopentameric enzyme with each monomer composed of two domains: an N-terminal modified Rossman fold domain for NADP binding, and a C-terminal substrate binding domain.; GO: 0008712 ADP-glyceromanno-heptose 6-epimerase activity, 0050661 NADP binding, 0005975 carbohydrate metabolic process. Probab=15.10 E-value=40 Score=17.22 Aligned_cols=13 Identities=23% Similarity=0.437 Sum_probs=11.1 Q ss_pred HHHHHHHCCCCCC Q ss_conf 1222231133366 Q gi|254780830|r 23 AMKDVICCDKLWG 35 (40) Q Consensus 23 aMKDV~~CdK~rG 35 (40) |-+||++||++|- T Consensus 23 P~~dI~vvD~L~~ 35 (353) T TIGR02197 23 PETDILVVDNLRD 35 (353) T ss_pred CCCEEEEEEECCC T ss_conf 9542888740787 No 5 >pfam01600 Corona_S1 Coronavirus S1 glycoprotein. The coronavirus spike glycoprotein forms the characteristic 'corona' after which the group is named. The Spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 and S2 pfam01601. Probab=11.25 E-value=59 Score=16.45 Aligned_cols=13 Identities=38% Similarity=0.692 Sum_probs=10.0 Q ss_pred HHHHHHCCCCCCC Q ss_conf 2222311333664 Q gi|254780830|r 24 MKDVICCDKLWGA 36 (40) Q Consensus 24 MKDV~~CdK~rGa 36 (40) ..||+.||.|||- T Consensus 208 iqdviyCDsP~~~ 220 (512) T pfam01600 208 IQDVIYCDSPINL 220 (512) T ss_pred EEEEEEECCCCCC T ss_conf 7999980696421 No 6 >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]; InterPro: IPR012766 This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This entry excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This entry does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cut offs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see ).; GO: 0003825 alphaalpha-trehalose-phosphate synthase (UDP-forming) activity, 0005992 trehalose biosynthetic process. Probab=10.68 E-value=82 Score=15.81 Aligned_cols=20 Identities=15% Similarity=0.541 Sum_probs=16.7 Q ss_pred CCCCC-CCCHHHHHHHHCCCC Q ss_conf 11134-200012222311333 Q gi|254780830|r 14 IWWMP-WHAQAMKDVICCDKL 33 (40) Q Consensus 14 ~wWMP-w~~eaMKDV~~CdK~ 33 (40) ++-|| ||.|-|..|..||=. T Consensus 182 ~~~lP~~~~~ll~gll~yDLv 202 (476) T TIGR02400 182 YRTLPEWRRELLEGLLAYDLV 202 (476) T ss_pred HHCCHHHHHHHHHHHHHCCCC T ss_conf 851805799999998715830 No 7 >KOG2671 consensus Probab=10.58 E-value=66 Score=16.23 Aligned_cols=20 Identities=30% Similarity=0.566 Sum_probs=17.1 Q ss_pred CCCCCHHHHHHHHCCCCCCC Q ss_conf 34200012222311333664 Q gi|254780830|r 17 MPWHAQAMKDVICCDKLWGA 36 (40) Q Consensus 17 MPw~~eaMKDV~~CdK~rGa 36 (40) -|||....-|-++||-|-|. T Consensus 277 ~~~rsn~~fDaIvcDPPYGV 296 (421) T KOG2671 277 PPLRSNLKFDAIVCDPPYGV 296 (421) T ss_pred CCHHHCCEEEEEEECCCCCH T ss_conf 63010323337872798114 No 8 >COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Probab=7.43 E-value=1.7e+02 Score=14.31 Aligned_cols=24 Identities=29% Similarity=0.527 Sum_probs=19.7 Q ss_pred HHCCCCCCCCCCHHHHHHHHCCCC Q ss_conf 211311134200012222311333 Q gi|254780830|r 10 ARKGIWWMPWHAQAMKDVICCDKL 33 (40) Q Consensus 10 a~Kg~wWMPw~~eaMKDV~~CdK~ 33 (40) |.--+-|+||.-||...-..-||| T Consensus 22 a~nPV~W~pW~~eAF~~A~~edkP 45 (667) T COG1331 22 AHNPVDWYPWGEEAFAKAKEEDKP 45 (667) T ss_pred CCCCCCCCCCCHHHHHHHHHHCCC T ss_conf 599965542699999999972998 No 9 >pfam11587 Prion_bPrPp Major prion protein bPrPp - N terminal. This family represents the N-terminal domain (1-30) of the bovine prion protein (bPrPp). The proteins structure consists of mainly alpha helices. BPrPp forms a stable helix which inserts in a transmembrane location in the bilayer, with the N -terminal (1-30) functioning as a cell-penetrating peptide. Probab=6.95 E-value=1.6e+02 Score=14.50 Aligned_cols=14 Identities=29% Similarity=0.226 Sum_probs=10.0 Q ss_pred HHHHHHHHCCCCCC Q ss_conf 01222231133366 Q gi|254780830|r 22 QAMKDVICCDKLWG 35 (40) Q Consensus 22 eaMKDV~~CdK~rG 35 (40) -.--||..|.||.+ T Consensus 16 atwsdvgLcKKpKp 29 (29) T pfam11587 16 ATWSDVGLCKKPKP 29 (29) T ss_pred HHHHHCCCCCCCCC T ss_conf 98865133368998 No 10 >pfam11229 DUF3028 Protein of unknown function (DUF3028). This eukaryotic family of proteins has no known function. Probab=6.50 E-value=1.7e+02 Score=14.41 Aligned_cols=11 Identities=36% Similarity=1.280 Sum_probs=0.0 Q ss_pred CCCCCCCCCHH Q ss_conf 31113420001 Q gi|254780830|r 13 GIWWMPWHAQA 23 (40) Q Consensus 13 g~wWMPw~~ea 23 (40) +..|.|||.|. T Consensus 484 sa~Wlpw~~e~ 494 (589) T pfam11229 484 SASWLPWHQEN 494 (589) T ss_pred CCCCCCCCCCC T ss_conf 33335544446 Done!