HHsearch alignment for GI: 254780837 and conserved domain: pfam01420

>pfam01420 Methylase_S Type I restriction modification DNA specificity domain. This domain is also known as the target recognition domain (TRD). Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one heteromeric enzyme complex composed of one DNA specificity subunit (this family), two modification (M) subunits and two restriction (R) subunits.
Probab=99.86  E-value=3.7e-21  Score=150.25  Aligned_cols=160  Identities=14%  Similarity=0.164  Sum_probs=116.9

Q ss_pred             CCCCCCCCHHHHCCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCCCCEECCCCCCCEEECCCCEEEEEECCCCCEEE
Q ss_conf             665643302431013456764----4443215774045532465322121000443320242288489974216640379
Q gi|254780837|r  229 PDHWEVKPFFALVTELNRKNT----KLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQNDKRS  304 (426)
Q Consensus       229 P~~W~~~~l~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gdil~~~~~~~~~~~~  304 (426)
T Consensus         1 P~~We~~~Lg~i~~~~~G~~~~~~~~~~~g~ip~i~~~~~~~~~~~~------~~~~~~~~~~~~dil~~~~g~~g~~~-   73 (167)
T pfam01420         1 PVDWEEFKLGEIFEIKKGKTLSKKELRENGKYPYITAGDLNNGVIGG------VGYIKKKIFPGNSILISSNGSIGYVF-   73 (167)
T ss_pred             CCCCEEEEEEEEEEEECCCCCCHHHHCCCCCEEEEEEEEECCCCCCE------EECCEEEEECCCEEEEECCCCCEEEE-
T ss_conf             97989999052999927998987781237981699740220464210------00112575059816862157740478-


Q ss_pred             EEEECCCCCEEEECHHEECCCC--CCCHHHHHHHHHCHHHHHHHHH-HCCCEEEEECHHHHHCCEECCCCHHHHHHHHHH
Q ss_conf             9950235660774111430577--6886889999709899999986-258404100288982472148988999999999
Q gi|254780837|r  305 LRSAQVMERGIITSAYMAVKPH--GIDSTYLAWLMRSYDLCKVFYA-MGSGLRQSLKFEDVKRLPVLVPPIKEQFDITNV  381 (426)
Q Consensus       305 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~yl~~~l~s~~~~~~~~~-~~~g~~~~i~~~~l~~~~i~lP~leeQ~~I~~~  381 (426)
T Consensus        74 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~--~~~~~~~~~g~~~~~i~~~~i~~~~i~~Ppl~EQ~~I~~~  147 (167)
T pfam01420        74 ----YRDKPFFANQDVKVLIPKNNELLNKFLYLFLKTI--LKKLKKLKFGSGQPKLNKKRLKELKIPLPPLEEQQKIADI  147 (167)
T ss_pred             ----ECCCCEEEECCEEEEEECCCCCCHHHHHHHHHHH--HHHHHHHCCCCCCCCCCHHHHHCCCCCCCCHHHHHHHHHH
T ss_conf             ----6088757752358997311133288999999740--5778753466