HHsearch alignment of GI: 254780837 and MMDB domain: 1ydx_A_1-164

>1ydx_A (A:1-164) Type I restriction enzyme specificity protein Mg438; type-I HSDS, DNA binding protein; 2.30A {Mycoplasma genitalium}
Probab=99.84  E-value=4.8e-21  Score=149.14  Aligned_cols=147  Identities=18%  Similarity=0.129  Sum_probs=113.4

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCEEEECCCEEEEEECCCCCCCCCEEEEEEEEEEECCCEEEECCCCCCCCCCCCEEEECC
Q ss_conf             77880232589962370689886988412399850667888775368870000206412331122223466553378428
Q gi|254780837|r    4 YKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGTGKYLPKDGNSRQSDTSTVSIFAK   83 (426)
Q Consensus         4 ~~~~~~~k~s~~~w~g~iP~~We~~kL~~i~~i~~g~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (426)
                      ++.+|.++.+..+|+|++|++|++++|++||++.+|.+++...-          ...+.+..............++.+++
T Consensus        15 ~~~~~~~~~~~~~~~~~~p~~We~~~L~~i~~~~~g~~~~~~~~----------~~~g~~~~~~~~~~~~~~~~~~~~~~   84 (164)
T 1ydx_A           15 GHIDDDDKHXTPKLKLNNNINWTKRTIDSLFDLKKGEXLEKELI----------TPEGKYEYFNGGVKNSGRTDKFNTFK   84 (164)
T ss_dssp             ---------CCCSSCSSSSCCCEEEEHHHHEEEEECCCCCGGGC----------CTTCSEEEESSSSSCSCEESCCCBCS
T ss_pred             CCCCCCCCCCCCCEECCCCCCCEEEECCEEEEEECCCCCCCCCC----------CCCCCEEEEECCCCCCEEEEEEECCC
T ss_conf             34475300168726579999988999100999977988870303----------46887799976773045986763259


Q ss_pred             CCEEEEEECCCCCEEEEECCCEEEECCE--EEECCC-CCCCHHHHHHHCHHHHHHHHHHCCCCCCEEEECHHHHHHHHHH
Q ss_conf             9789994228752379834648990743--871466-6787022222111778898883156871666526663445554
Q gi|254780837|r   84 GQILYGKLGPYLRKAIIADFDGICSTQF--LVLQPK-DVLPELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMP  160 (426)
Q Consensus        84 gDil~s~~g~~~g~~~i~~~~~~~~~~~--~vl~~~-~~~~~fl~y~l~s~~~~~~~~~~~~Gs~~~~i~~~~l~~~~ip  160 (426)
                      ||+|++++|+.+.++.. +.++.+..+.  ++++++ .+++.||+|+|++  ++.++...++|+++++|+.++|++++||
T Consensus        85 gdil~~~~g~~g~~~~~-~~~~~~~~~~~~~~~~~~~~i~~~yl~~~l~s--~~~~i~~~~~G~~~~~i~~~~l~~~~i~  161 (164)
T 1ydx_A           85 NTISVIVGGSCGYVRLA-DKNFFCGQSNCTLNLLDPLELDLKFAYYALKS--QQERIEALAFGTTIQNIRISDLKELEIP  161 (164)
T ss_dssp             SCEEEECBSSTTCEEEC-SSCBEECTTEEEEEESCTTTSCHHHHHHHHHT--THHHHHTTCBCSSSCBCCHHHHHHCEEE
T ss_pred             CEEEEECCCCCEEEEEE-CCCCCCCCCEEEEEECCCHHCCHHHCCCCCCC--HHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             81999856664279995-67731125529999777122287240110013--5899875405888885257676543220


Q ss_pred             HHH
Q ss_conf             433
Q gi|254780837|r  161 IPP  163 (426)
Q Consensus       161 lPp  163 (426)
                      +|+
T Consensus       162 iPS  164 (164)
T 1ydx_A          162 FTS  164 (164)
T ss_dssp             ECC
T ss_pred             HCC
T ss_conf             112