HHSEARCH alignment of GI: 254780837 and SCOP domain: d1ydxa1

Alignment
>d1ydxa1 d.287.1.2 (A:1-193) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]}
Probab=99.82  E-value=2.2e-19  Score=136.35  Aligned_cols=170  Identities=14%  Similarity=0.079  Sum_probs=115.6

Q ss_pred             CCCCCCCCCCHHHHCCCCCCCC---CCCC-CCEEEEECCCCCCCCCCCCCCCEECCCCCCCEEECCCCEEEEEECCCCCE
Q ss_conf             6866564330243101345676---4444-32157740455324653221210004433202422884899742166403
Q gi|254780837|r  227 LVPDHWEVKPFFALVTELNRKN---TKLI-ESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQNDK  302 (426)
Q Consensus       227 ~IP~~W~~~~l~~~~~~~~~~~---~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gdil~~~~~~~~~~  302 (426)
                      .+|.+|++++|++++....+..   ..+. ++.+|++..++.....            ........+|++++..+..+..
T Consensus         8 ~~~~~W~~~~Lg~i~~i~~G~~~~~~~~~~~g~~p~~~~~~~~~~~------------~~~~~~~~~~il~~~~g~~g~~   75 (193)
T d1ydxa1           8 NNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKNSGR------------TDKFNTFKNTISVIVGGSCGYV   75 (193)
T ss_dssp             SSSCCCEEEEHHHHEEEEECCCCCGGGCCTTCSEEEESSSSSCSCE------------ESCCCBCSSCEEEECBSSTTCE
T ss_pred             CCCCCCEEEEEEEEEEEECCCCCCHHHCCCCCCEEEEEEECCCCCE------------EEEEEECCCCEEEEECCCCCCE
T ss_conf             9999989999317999958988986450457876899730000323------------6677531771799832654521


Q ss_pred             EEEEEECCCCCEEEECH--HEECCC-CCCCHHHHHHHHHCHHHHHHHHHHCC-CEEEEECHHHHHCCEECCC-CHHHHHH
Q ss_conf             79995023566077411--143057-76886889999709899999986258-4041002889824721489-8899999
Q gi|254780837|r  303 RSLRSAQVMERGIITSA--YMAVKP-HGIDSTYLAWLMRSYDLCKVFYAMGS-GLRQSLKFEDVKRLPVLVP-PIKEQFD  377 (426)
Q Consensus       303 ~~~~~~~~~~~~~~~~~--~~~~~~-~~~~~~yl~~~l~s~~~~~~~~~~~~-g~~~~i~~~~l~~~~i~lP-~leeQ~~  377 (426)
                      + ..    .....++.+  ++.+.+ ..+++.|+||++...  ...+...++ +++++|+.++++++.||+| +++||++
T Consensus        76 ~-~~----~~~~~~~~~~~~~~~~~~~~~~~~yl~~~~~~~--~~~~~~~~~gs~~~~i~~~~i~~~~i~lpP~~~eQ~~  148 (193)
T d1ydxa1          76 R-LA----DKNFFCGQSNCTLNLLDPLELDLKFAYYALKSQ--QERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHA  148 (193)
T ss_dssp             E-EC----SSCBEECTTEEEEEESCTTTSCHHHHHHHHHTT--HHHHHTTCBCSSSCBCCHHHHHHCEEEECCCHHHHHH
T ss_pred             E-EE----CCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHH--HHHHHHHHCCCCCCEECHHHHHHHHHHHCCCHHHHHH
T ss_conf             4-30----443201364379996683324689987666668--9998875057755342198898877665226999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEE
Q ss_conf             999999999999999999999999999999997788622336
Q gi|254780837|r  378 ITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQI  419 (426)
Q Consensus       378 I~~~l~~~~~~id~li~~~~~~i~~L~~lk~sLl~~a~tGki  419 (426)
                      |+++|+.    +|++|+.++++++.|+++|++||+++||++-
T Consensus       149 I~~~l~~----ld~~i~~~~~~i~~l~~~~~~ll~~lft~~~  186 (193)
T d1ydxa1         149 IANTLSV----FDERLENLASLIEINRKLRDEYAHKLFSLDE  186 (193)
T ss_dssp             HHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             9999999----9999999999999999999999999876682


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: DNA methylase specificity domain
superfamily: DNA methylase specificity domain
family: Type I restriction modification DNA specificity domain
domain: Bipartite methylase S protein MG438
species: Mycoplasma genitalium [TaxId: 2097]