BLAST/PSIBLAST alignment of GI: 254780837 and GI: 145642021 at iteration 1
>gi|145642021|ref|ZP_01797593.1| putative type I site-specific restriction-modification system, S subunit [Haemophilus influenzae R3021] Length = 411
>gi|145273292|gb|EDK13166.1| putative type I site-specific restriction-modification system, S subunit [Haemophilus influenzae 22.4-21] Length = 411
 Score =  226 bits (576), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 139/411 (33%), Positives = 220/411 (53%), Gaps = 8/411 (1%)

Query: 15  VQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGTGKYLPKDGNSRQSD 74
           ++W+  IP HW +   K   K    + +E  +D I     D +         +G +    
Sbjct: 1   MEWLRQIPSHWDMQRSKFIFKKVERKVNE--EDQIVTCFRDGQVTLRANRRTEGFTNALK 58

Query: 75  TSTVSIFAKGQILYGKLGPYLRKAIIADFDGICSTQFLVLQPKD---VLPELLQGWLLSI 131
                   KG ++   +  +     I+D DG  +  + V  P +   +       +L ++
Sbjct: 59  EHGYQGIRKGDLVIHAMDAFTGAIGISDSDGKATPVYSVCLPHNKQKIDVYFYAYYLRNL 118

Query: 132 DVTQRIEAICEGATMSHADWK--GIGNIPMPIPPLAEQVLIREKIIAETVRIDTLITERI 189
            ++  I ++ +G      D++      + +PIPP  EQ  I + +  +T +ID  +    
Sbjct: 119 ALSGFISSLAKGIRERSTDFRYADFAELLLPIPPYLEQQQIAQFLDDKTAKIDRAVDLAE 178

Query: 190 RFIELLKEKKQALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFFALVTELNRKNT 249
           + I LLKE KQ L+   VT+GLNPDV +KDSG+EW+G VP+HWE+     +  E  R N 
Sbjct: 179 KQIALLKEHKQILIQNAVTRGLNPDVPLKDSGVEWIGQVPEHWELTIGMNVFRENKRDNK 238

Query: 250 KLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQNDKRSLRSAQ 309
            + E+ +LSLSYG II K E +  GL PES+ETYQIV+P +I+ R  DLQND+ SLR+  
Sbjct: 239 GMKENTVLSLSYGKIIIKPEEKLFGLVPESFETYQIVEPNDIIIRCTDLQNDQTSLRTGL 298

Query: 310 VMERGIITSAYMAVKP-HGIDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKFEDVKRLPVL 368
             ++GIITSAY+ +K  +   + +L + + + D+ KV Y  GSGLRQ+L F D KRLP++
Sbjct: 299 AQDKGIITSAYLNLKVINNYSAKFLHYYLHALDITKVLYKFGSGLRQNLSFLDFKRLPII 358

Query: 369 VPPIKEQFDITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQI 419
              + EQ  I + ++ +T++ID ++      I  LKE +S  I   VTG++
Sbjct: 359 DISLAEQQQIADYLDKQTSKIDQVIALKTAHIEKLKEYKSVLINDVVTGKV 409