BLAST/PSIBLAST alignment of GI: 254780837 and GI: 152973654 at iteration 1
>gi|152973654|ref|YP_001338694.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 438
>gi|294496729|ref|YP_003560422.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae] Length = 438
>gi|150958436|gb|ABR80464.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 438
>gi|293339438|gb|ADE43992.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae] Length = 438
 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 249/444 (56%), Positives = 300/444 (67%), Gaps = 27/444 (6%)

Query: 1   MKHYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDI-IYIGLEDVESG 59
           M  YKAY  YKDSGV+WIG +P+HW+V  ++     + GR S SG D   Y   + VE  
Sbjct: 1   MSQYKAYTSYKDSGVEWIGQVPEHWEVKRLR-----HVGRYSNSGVDKKSYEDQQTVELC 55

Query: 60  T------GKYLPKDGNSRQSDTSTVSI----FAKGQILYGK-------LGPYLRKAIIAD 102
                   +++  D