BLAST/PSIBLAST alignment of GI: 254780837 and GI: 152973654 at iteration 1
>gi|152973654|ref|YP_001338694.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 438
>gi|294496729|ref|YP_003560422.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae] Length = 438
>gi|150958436|gb|ABR80464.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 438
>gi|293339438|gb|ADE43992.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae] Length = 438
 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 249/444 (56%), Positives = 300/444 (67%), Gaps = 27/444 (6%)

Query: 1   MKHYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDI-IYIGLEDVESG 59
           M  YKAY  YKDSGV+WIG +P+HW+V  ++     + GR S SG D   Y   + VE  
Sbjct: 1   MSQYKAYTSYKDSGVEWIGQVPEHWEVKRLR-----HVGRYSNSGVDKKSYEDQQTVELC 55

Query: 60  T------GKYLPKDGNSRQSDTSTVSI----FAKGQILYGK-------LGPYLRKAIIAD 102
                   +++  D    Q+  S   I      KG ++  K       +G  +   +  D
Sbjct: 56  NYTDVYYNEFISDDMPFMQATASAHEIEQFTLKKGDVIITKDSEDPSDIG--IPAFVPHD 113

Query: 103 FDGI-CSTQFLVLQP-KDVLPELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMP 160
             G+ C     +++   D     +   + S            G T    +   IGN P+ 
Sbjct: 114 MPGVVCGYHLTMIRALNDNYGSYIHRSIQSDHTRAHFFVESPGITRYGLNQNTIGNAPVA 173

Query: 161 IPPLAEQVLIREKIIAETVRIDTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDS 220
           +PP  EQ  I   +  ET RID L+ ++IRFIELLKEK+QAL+++ VTKGL+P+VKMKDS
Sbjct: 174 LPPPEEQATIAATLDRETARIDALVEKKIRFIELLKEKRQALITHAVTKGLDPNVKMKDS 233

Query: 221 GIEWVGLVPDHWEVKPFFALVTELNRKNTKLIESNILSLSYGNIIQKLETRNMGLKPESY 280
           G+EW+G VP+HWEVKPFFALV+ELNRKN  L E+NILSLSYGNIIQK ETRNMGL PESY
Sbjct: 234 GVEWIGQVPEHWEVKPFFALVSELNRKNVGLAETNILSLSYGNIIQKPETRNMGLTPESY 293

Query: 281 ETYQIVDPGEIVFRFIDLQNDKRSLRSAQVMERGIITSAYMAVKPHGIDSTYLAWLMRSY 340
           ETYQIV+ GE+VFRF DLQNDKRSLRSAQV +RGIITSAYMAVKPH I STY AWLMRSY
Sbjct: 294 ETYQIVESGEVVFRFTDLQNDKRSLRSAQVTQRGIITSAYMAVKPHSIGSTYFAWLMRSY 353

Query: 341 DLCKVFYAMGSGLRQSLKFEDVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIEQSI 400
           DLCKVFYAMG GLRQSLKFEDV+RLPVL+PP+ EQ +ITN IN  TARID LVEK EQSI
Sbjct: 354 DLCKVFYAMGGGLRQSLKFEDVRRLPVLIPPVGEQSEITNTINAGTARIDALVEKTEQSI 413

Query: 401 VLLKERRSSFIAAAVTGQIDLRGE 424
            LLKERR++FI AAVTGQIDLRG+
Sbjct: 414 TLLKERRAAFITAAVTGQIDLRGK 437