BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780837|ref|YP_003065250.1| putative restriction
endonuclease S subunit [Candidatus Liberibacter asiaticus str. psy62]
         (426 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780837|ref|YP_003065250.1| putative restriction endonuclease S subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040514|gb|ACT57310.1| putative restriction endonuclease S subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 426

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/426 (100%), Positives = 426/426 (100%)

Query: 1   MKHYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGT 60
           MKHYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGT
Sbjct: 1   MKHYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGT 60

Query: 61  GKYLPKDGNSRQSDTSTVSIFAKGQILYGKLGPYLRKAIIADFDGICSTQFLVLQPKDVL 120
           GKYLPKDGNSRQSDTSTVSIFAKGQILYGKLGPYLRKAIIADFDGICSTQFLVLQPKDVL
Sbjct: 61  GKYLPKDGNSRQSDTSTVSIFAKGQILYGKLGPYLRKAIIADFDGICSTQFLVLQPKDVL 120

Query: 121 PELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIPPLAEQVLIREKIIAETVR 180
           PELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIPPLAEQVLIREKIIAETVR
Sbjct: 121 PELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIPPLAEQVLIREKIIAETVR 180

Query: 181 IDTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFFAL 240
           IDTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFFAL
Sbjct: 181 IDTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFFAL 240

Query: 241 VTELNRKNTKLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQN 300
           VTELNRKNTKLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQN
Sbjct: 241 VTELNRKNTKLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQN 300

Query: 301 DKRSLRSAQVMERGIITSAYMAVKPHGIDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKFE 360
           DKRSLRSAQVMERGIITSAYMAVKPHGIDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKFE
Sbjct: 301 DKRSLRSAQVMERGIITSAYMAVKPHGIDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKFE 360

Query: 361 DVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQID 420
           DVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQID
Sbjct: 361 DVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQID 420

Query: 421 LRGESQ 426
           LRGESQ
Sbjct: 421 LRGESQ 426


>gi|152973654|ref|YP_001338694.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|294496729|ref|YP_003560422.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae]
 gi|150958436|gb|ABR80464.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|293339438|gb|ADE43992.1| putative restriction endonuclease S subunit [Klebsiella pneumoniae]
          Length = 438

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 249/444 (56%), Positives = 300/444 (67%), Gaps = 27/444 (6%)

Query: 1   MKHYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDI-IYIGLEDVESG 59
           M  YKAY  YKDSGV+WIG +P+HW+V  ++     + GR S SG D   Y   + VE  
Sbjct: 1   MSQYKAYTSYKDSGVEWIGQVPEHWEVKRLR-----HVGRYSNSGVDKKSYEDQQTVELC 55

Query: 60  T------GKYLPKDGNSRQSDTSTVSI----FAKGQILYGK-------LGPYLRKAIIAD 102
                   +++  D    Q+  S   I      KG ++  K       +G  +   +  D
Sbjct: 56  NYTDVYYNEFISDDMPFMQATASAHEIEQFTLKKGDVIITKDSEDPSDIG--IPAFVPHD 113

Query: 103 FDGI-CSTQFLVLQP-KDVLPELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMP 160
             G+ C     +++   D     +   + S            G T    +   IGN P+ 
Sbjct: 114 MPGVVCGYHLTMIRALNDNYGSYIHRSIQSDHTRAHFFVESPGITRYGLNQNTIGNAPVA 173

Query: 161 IPPLAEQVLIREKIIAETVRIDTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDS 220
           +PP  EQ  I   +  ET RID L+ ++IRFIELLKEK+QAL+++ VTKGL+P+VKMKDS
Sbjct: 174 LPPPEEQATIAATLDRETARIDALVEKKIRFIELLKEKRQALITHAVTKGLDPNVKMKDS 233

Query: 221 GIEWVGLVPDHWEVKPFFALVTELNRKNTKLIESNILSLSYGNIIQKLETRNMGLKPESY 280
           G+EW+G VP+HWEVKPFFALV+ELNRKN  L E+NILSLSYGNIIQK ETRNMGL PESY
Sbjct: 234 GVEWIGQVPEHWEVKPFFALVSELNRKNVGLAETNILSLSYGNIIQKPETRNMGLTPESY 293

Query: 281 ETYQIVDPGEIVFRFIDLQNDKRSLRSAQVMERGIITSAYMAVKPHGIDSTYLAWLMRSY 340
           ETYQIV+ GE+VFRF DLQNDKRSLRSAQV +RGIITSAYMAVKPH I STY AWLMRSY
Sbjct: 294 ETYQIVESGEVVFRFTDLQNDKRSLRSAQVTQRGIITSAYMAVKPHSIGSTYFAWLMRSY 353

Query: 341 DLCKVFYAMGSGLRQSLKFEDVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIEQSI 400
           DLCKVFYAMG GLRQSLKFEDV+RLPVL+PP+ EQ +ITN IN  TARID LVEK EQSI
Sbjct: 354 DLCKVFYAMGGGLRQSLKFEDVRRLPVLIPPVGEQSEITNTINAGTARIDALVEKTEQSI 413

Query: 401 VLLKERRSSFIAAAVTGQIDLRGE 424
            LLKERR++FI AAVTGQIDLRG+
Sbjct: 414 TLLKERRAAFITAAVTGQIDLRGK 437


>gi|113477871|ref|YP_723932.1| restriction modification system DNA specificity subunit
           [Trichodesmium erythraeum IMS101]
 gi|110168919|gb|ABG53459.1| restriction modification system DNA specificity domain
           [Trichodesmium erythraeum IMS101]
          Length = 415

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 171/422 (40%), Positives = 251/422 (59%), Gaps = 19/422 (4%)

Query: 3   HYKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGTGK 62
           +++ YP YK SGV+W+G IP+HW++  +K  + L  G +         +G E+ E G   
Sbjct: 5   NWQKYPVYKSSGVEWLGEIPEHWEMKRLKFISHLVYGDS---------LGSENREDGNIN 55

Query: 63  YLPKDGN-SRQSDTSTVSIFAKGQILYGKLGPYLRKAIIADFDGIC-STQFLVLQPKDVL 120
               +G     S  +T+S      I+ G+ G +  K   + F   C  T +L+ Q K   
Sbjct: 56  VYGSNGMIGLHSKANTLSPV----IIVGRKGSF-GKIQYSLFPCFCIDTAYLIDQRKT-- 108

Query: 121 PELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIPPLAEQVLIREKIIAETVR 180
            + L+ WL        ++ I +   +     +      +P+ PL+EQ  I   +  +  +
Sbjct: 109 KQNLK-WLCYALQILELDKISQDTGVPGLSREKAYQKLVPVSPLSEQQAIANFLDEKLAQ 167

Query: 181 IDTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFFAL 240
           ID  I ++ R IELLKE+K  +++  VTKG+NPDV MK SGIEW+G VP+HWEV P FA+
Sbjct: 168 IDEYIAKKQRIIELLKEQKTVIINQAVTKGINPDVSMKYSGIEWLGEVPEHWEVLPAFAV 227

Query: 241 VTELNRKNTKLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQN 300
             E    N  L+E N+LSLSYG II+K  T N GL PES+ETYQIV PG I+ R  DLQN
Sbjct: 228 FKEQCVINRDLVEKNLLSLSYGKIIRKSFTNNFGLLPESFETYQIVTPGNIILRLTDLQN 287

Query: 301 DKRSLRSAQVMERGIITSAYMAVKPHGIDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKFE 360
           DKRSLR   V E+GIITSAY+ + P  +   Y+  L+  YD+ K+FY+MGSG+RQ++KF+
Sbjct: 288 DKRSLRVGLVKEKGIITSAYLCLNPQNVIPEYVYTLLHIYDILKIFYSMGSGVRQNMKFK 347

Query: 361 DVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQID 420
           D+KRLP+  PP+ EQ +I + I  +  +I+  +  IE+ I L++E R++ I+  VTG+ID
Sbjct: 348 DLKRLPITFPPVSEQKEIVSFIEKKLEKIERSLTVIEKEIKLIQEYRTTLISETVTGKID 407

Query: 421 LR 422
           +R
Sbjct: 408 VR 409


>gi|326201377|ref|ZP_08191249.1| hypothetical protein Cpap_4212 [Clostridium papyrosolvens DSM 2782]
 gi|325988945|gb|EGD49769.1| hypothetical protein Cpap_4212 [Clostridium papyrosolvens DSM 2782]
          Length = 631

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 145/354 (40%), Positives = 217/354 (61%), Gaps = 8/354 (2%)

Query: 74  DTSTVSIFAKGQILYG-----KLGPYLRKAIIADFDGICSTQFLVLQP--KDVLPELLQG 126
           DTS+ ++  KG  ++      K G      +++D         ++ +P  KDV  +    
Sbjct: 62  DTSSQALIKKGDFVFADTSEDKGGSGNFTCLVSDSSIFAGYHTVIARPVSKDVFYKYFAY 121

Query: 127 WLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIPPLAEQVLIREKIIAETVRIDTLIT 186
              S +   +I+    G  +       + N     P +  Q++I   +  +T +ID++I 
Sbjct: 122 LFDSQNFRAQIQQAVSGIKVFTISQGTLKNTIASFPNIDAQIVIANYLDRKTTQIDSIIA 181

Query: 187 ERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDSGIEWVGLVPDHWEVKPFFALVTELNR 246
           ++ + IELLKEK+QA++S  VT+GL+P V MKDSG++W+G +P+HWEVKP F +  E   
Sbjct: 182 DKEKLIELLKEKRQAIISEAVTRGLDPSVPMKDSGVDWIGQIPEHWEVKPLFTVAFENKA 241

Query: 247 KNTKLIESNILSLSYGNIIQKLETRNMGLKPESYETYQIVDPGEIVFRFIDLQNDKRSLR 306
           KN+     N+LSLSYG I++K    N GL PES+ETYQIV+ G  + R  DLQNDKRSLR
Sbjct: 242 KNSGNQCVNLLSLSYGKIVKKDIDTNFGLLPESFETYQIVEGGYTILRLTDLQNDKRSLR 301

Query: 307 SAQVMERGIITSAYMAVKPHG-IDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKFEDVKRL 365
           S  V E+GIITSAY+ + P   +D  +L+ L+ +YDL K+FY++G+G+RQS+ ++D+KRL
Sbjct: 302 SGFVREKGIITSAYVGLIPSDEVDGLFLSDLLHAYDLMKIFYSLGNGVRQSMNYKDLKRL 361

Query: 366 PVLVPPIKEQFDITNVINVETARIDVLVEKIEQSIVLLKERRSSFIAAAVTGQI 419
           P+L+PP  EQ  I+N +  +TA ID L+   EQ + L KE R S I+ AVTG+I
Sbjct: 362 PILLPPKSEQKQISNYLRNKTAEIDDLISTTEQQVSLFKEYRQSIISEAVTGKI 415



 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 105/221 (47%), Gaps = 20/221 (9%)

Query: 11  KDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIY--------IGLEDVESGTGK 62
           KDSGV WIG IP+HW+V P+  FT     +   SG   +         I  +D+++  G 
Sbjct: 213 KDSGVDWIGQIPEHWEVKPL--FTVAFENKAKNSGNQCVNLLSLSYGKIVKKDIDTNFG- 269

Query: 63  YLPKDGNSRQSDTSTVSIFAKGQILYGKLGPYLRKAIIADFDGICSTQFLVLQPKDVLPE 122
            LP+   + Q      +I     +   K    LR   + +  GI ++ ++ L P D +  
Sbjct: 270 LLPESFETYQIVEGGYTILRLTDLQNDKRS--LRSGFVRE-KGIITSAYVGLIPSDEVDG 326

Query: 123 L-LQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIPPLAEQVLIREKIIAETVRI 181
           L L   L + D+ +   ++  G   S  ++K +  +P+ +PP +EQ  I   +  +T  I
Sbjct: 327 LFLSDLLHAYDLMKIFYSLGNGVRQS-MNYKDLKRLPILLPPKSEQKQISNYLRNKTAEI 385

Query: 182 DTLITERIRFIELLKEKKQALVSYIVTKGLNPDVKMKDSGI 222
           D LI+   + + L KE +Q+++S  VT      +K+ DS I
Sbjct: 386 DDLISTTEQQVSLFKEYRQSIISEAVT----GKIKVADSEI 422



 Score = 41.2 bits (95), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 86/203 (42%), Gaps = 17/203 (8%)

Query: 233 EVKPFFALVTELNRKNTKLIESNILSLSYGNIIQK------LETRNMGLKPESY---ETY 283
           ++K  F     L+     L E+ I  +SYG +  K      +    +    ESY    + 
Sbjct: 7   KLKYLFKFGKGLSITKENLSETGIPCVSYGQVHSKYGVILDMSKHVLPFVSESYLDTSSQ 66

Query: 284 QIVDPGEIVFRFIDLQNDKR-SLRSAQVMERGIITSAYMAV--KPHGID--STYLAWLMR 338
            ++  G+ VF   D   DK  S     ++    I + Y  V  +P   D    Y A+L  
Sbjct: 67  ALIKKGDFVF--ADTSEDKGGSGNFTCLVSDSSIFAGYHTVIARPVSKDVFYKYFAYLFD 124

Query: 339 SYDLCKVFYAMGSGLRQ-SLKFEDVKRLPVLVPPIKEQFDITNVINVETARIDVLVEKIE 397
           S +         SG++  ++    +K      P I  Q  I N ++ +T +ID ++   E
Sbjct: 125 SQNFRAQIQQAVSGIKVFTISQGTLKNTIASFPNIDAQIVIANYLDRKTTQIDSIIADKE 184

Query: 398 QSIVLLKE