RPSBLAST alignment of GI: 254780837 and MMDB domain: 1ydx_A_1-164

>1ydx_A (A:1-164) Type I restriction enzyme specificity protein Mg438; type-I HSDS, DNA binding protein; 2.30A {Mycoplasma genitalium}Length = 164
 Score = 63.6 bits (154), Expect = 5e-11
 Identities = 28/162 (17%), Positives = 45/162 (27%), Gaps = 16/162 (9%)

Query: 4   YKAYPQYKDSGVQWIGAIPKHWKVVPIKRFTKLNTGRTSESGKDIIYIGLEDVESGTGKY 63
                  K    +       +W    I     L  G   E              +  GKY
Sbjct: 15  GHIDDDDKHXTPKLKLNNNINWTKRTIDSLFDLKKGEXLEKEL----------ITPEGKY 64

Query: 64  LPKDGNSRQSDTSTVSIFAKGQILYGKLGPYLRKAIIADFDGICSTQFLVLQPKD---VL 120
              +G  + S  +      K  I     G       +AD +  C      L   D   + 
Sbjct: 65  EYFNGGVKNSGRTDKFNTFKNTISVIVGG-SCGYVRLADKNFFCGQSNCTLNLLDPLELD 123

Query: 121 PELLQGWLLSIDVTQRIEAICEGATMSHADWKGIGNIPMPIP 162
            +     L S    +RIEA+  G T+ +     +  + +P  
Sbjct: 124 LKFAYYALKSQ--QERIEALAFGTTIQNIRISDLKELEIPFT 163