RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780838|ref|YP_003065251.1| hypothetical protein CLIBASIA_03665 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >gnl|CDD|38941 KOG3737, KOG3737, KOG3737, Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones]. Length = 603 Score = 26.5 bits (58), Expect = 1.7 Identities = 16/61 (26%), Positives = 21/61 (34%), Gaps = 9/61 (14%) Query: 50 GEFYVDLLPFNFASRSSYQQRSNILSHRK---EIAIDQR------RTPITQKLSMGNLSE 100 G Y L+P+ F IL + E D R P Q L G++SE Sbjct: 385 GHVYRSLMPYQFGKPPIKVGSPPILINYVRVVETWWDDYKDYFYTREPEAQALPYGDISE 444 Query: 101 L 101 Sbjct: 445 Q 445 >gnl|CDD|39457 KOG4256, KOG4256, KOG4256, Kinetochore component [Cell cycle control, cell division, chromosome partitioning]. Length = 2209 Score = 24.8 bits (53), Expect = 5.4 Identities = 15/94 (15%), Positives = 29/94 (30%), Gaps = 7/94 (7%) Query: 2 NSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFNF 61 + + FG AF +A + L E K + L FE +D P Sbjct: 1639 HKIFFGIAAFFWAILRTNHIELEEEISFPKRELLLIKDEKEFEKD----GLMLD--PAGH 1692 Query: 62 ASRSSYQQR-SNILSHRKEIAIDQRRTPITQKLS 94 + + + + + IT+++ Sbjct: 1693 SFEKKLEDDGLKLSDAKNSDLALKEDAKITERIE 1726 >gnl|CDD|146444 pfam03805, CLAG, Cytoadherence-linked asexual protein. Clag (cytoadherence linked asexual gene) is a malaria surface protein which has been shown to be involved in the binding of Plasmodium falciparum infected erythrocytes to host endothelial cells, a process termed cytoadherence. The cytoadherence phenomenon is associated with the sequestration of infected erythrocytes in the blood vessels of the brain, cerebral malaria. Clag is a multi-gene family in Plasmodium falciparum with at least 9 members identified to date. Orthologous proteins in the rodent malaria species Plasmodium chabaudi (Lawson D Unpubl. obs.) suggest that the gene family is found in other malaria species and may play a more generic role in cytoadherence. Length = 1282 Score = 24.3 bits (53), Expect = 8.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 8 FLAFLYAYGGSVVFSLFESFF 28 FL F Y Y GS++ SL S F Sbjct: 955 FLTFAYVYYGSIMDSLTNSLF 975 >gnl|CDD|36433 KOG1219, KOG1219, KOG1219, Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]. Length = 4289 Score = 23.8 bits (51), Expect = 9.8 Identities = 12/48 (25%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Query: 2 NSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSR 49 N + G L A G FSL +F V+ E + F + Sbjct: 300 NDMTIGINLSLQAKNGPQFFSLK-NFTVKFEKEVYRFSVSEFAPPNTP 346 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.140 0.400 Gapped Lambda K H 0.267 0.0696 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,263,808 Number of extensions: 62126 Number of successful extensions: 195 Number of sequences better than 10.0: 1 Number of HSP's gapped: 195 Number of HSP's successfully gapped: 10 Length of query: 103 Length of database: 6,263,737 Length adjustment: 70 Effective length of query: 33 Effective length of database: 4,751,107 Effective search space: 156786531 Effective search space used: 156786531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.5 bits)