Query         gi|254780840|ref|YP_003065253.1| hypothetical protein CLIBASIA_03675 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 52
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 18:13:41 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780840.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3bnw_A Riboflavin kinase, put  20.1      44  0.0013   16.0   1.2   18    1-18     13-30  (181)
  2 >1n08_A Putative riboflavin ki  14.3      47  0.0014   15.8   0.3   18    1-18     19-36  (163)
  3 >2p0v_A Hypothetical protein B  13.6      34   0.001   16.6  -0.7   14    4-17      1-14  (74)
  4 >1xg7_A Hypothetical protein;   12.9      34 0.00099   16.6  -0.9   24    4-27     52-82  (104)
  5 >1mrz_A Riboflavin kinase/FMN   12.5      52  0.0015   15.6   0.0   18    1-18      2-19  (140)
  6 >1nb0_A Hypothetical protein F  12.0      58  0.0017   15.3   0.1   17    2-18      1-17  (147)
  7 >2uv8_G Fatty acid synthase su  11.2      56  0.0017   15.4  -0.2   14   17-30     29-42  (43)
  8 >3b4s_A Protein LUXT; APC91483   7.4 1.6E+02  0.0047   12.9   0.9   10   23-32      2-11  (55)
  9 >2qcu_A Aerobic glycerol-3-pho   7.3 1.1E+02  0.0033   13.7   0.1   24    4-27     49-74  (212)
 10 >2gki_A Nuclease; anti-DNA ant   7.2 1.7E+02  0.0049   12.8   0.9   10    2-11    125-134 (151)

No 1  
>>3bnw_A Riboflavin kinase, putative; APO structure, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP, transferase; 2.40A {Trypanosoma brucei} (A:)
Probab=20.09  E-value=44  Score=15.97  Aligned_cols=18  Identities=39%  Similarity=0.704  Sum_probs=15.4

Q ss_pred             CCCCCEEEEEEHHHHHHH
Q ss_conf             987742522102123788
Q gi|254780840|r    1 MTGYPFYFWGKISHGIGL   18 (52)
Q Consensus         1 mtgypfyfwgkishgigl   18 (52)
                      |-|+||.+-|++-||-|+
T Consensus        13 lLG~py~i~G~Vv~G~~~   30 (181)
T 3bnw_A           13 GSFQPFFLRGKVVHGKGR   30 (181)
T ss_dssp             TTSCCEEEEEEEEC----
T ss_pred             CCCCCEEEEEEEECCCCC
T ss_conf             796898899899818988


No 2  
>>1n08_A Putative riboflavin kinase; phophoryl transferases, flavin cofactors, metal binding; HET: ADP; 1.60A {Schizosaccharomyces pombe} (A:)
Probab=14.35  E-value=47  Score=15.77  Aligned_cols=18  Identities=44%  Similarity=0.853  Sum_probs=14.6

Q ss_pred             CCCCCEEEEEEHHHHHHH
Q ss_conf             987742522102123788
Q gi|254780840|r    1 MTGYPFYFWGKISHGIGL   18 (52)
Q Consensus         1 mtgypfyfwgkishgigl   18 (52)
                      |-|+||.+-|++.||-|+
T Consensus        19 llg~py~i~G~Vv~G~~~   36 (163)
T 1n08_A           19 QSPYPIRFEGKVVHGFGR   36 (163)
T ss_dssp             CTTCCEEEEEEEECCSSS
T ss_pred             CCCCCEEEEEEEECCCCC
T ss_conf             998888989899618974


No 3  
>>2p0v_A Hypothetical protein BT3781; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacteroides thetaiotaomicron vpi-5482} (A:380-453)
Probab=13.63  E-value=34  Score=16.55  Aligned_cols=14  Identities=43%  Similarity=1.042  Sum_probs=12.1

Q ss_pred             CCEEEEEEHHHHHH
Q ss_conf             74252210212378
Q gi|254780840|r    4 YPFYFWGKISHGIG   17 (52)
Q Consensus         4 ypfyfwgkishgig   17 (52)
                      -|+||-|+.-.|||
T Consensus         1 NPyy~~G~~~~GIG   14 (74)
T 2p0v_A            1 NPYFFKGSAGEGIG   14 (74)
T ss_dssp             STTEEECSSCEEEC
T ss_pred             CCCCCCCCCCCCCC
T ss_conf             98622178752055


No 4  
>>1xg7_A Hypothetical protein; southeast collaboratory for structural genomics, secsg, hyperthermophIle, protein structure initiative, PSI; 1.88A {Pyrococcus furiosus dsm 3638} (A:1-31,A:178-250)
Probab=12.92  E-value=34  Score=16.58  Aligned_cols=24  Identities=33%  Similarity=0.735  Sum_probs=18.2

Q ss_pred             CCEEEEEEHHHH-------HHHHHHHHHCCH
Q ss_conf             742522102123-------788999875416
Q gi|254780840|r    4 YPFYFWGKISHG-------IGLFLWDVLDGR   27 (52)
Q Consensus         4 ypfyfwgkishg-------iglflwdvldgr   27 (52)
                      .|--||++||.-       |.-.||.||.|-
T Consensus        52 ~P~~fW~~VAresgIPPLHIDSILWpVLGg~   82 (104)
T 1xg7_A           52 KPTKFWMKIGQESGVPPLHIDSLIWPLLGNA   82 (104)
T ss_dssp             CHHHHHHHHHHHHTCCHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHCCCC
T ss_conf             4899999999964998310277898871775


No 5  
>>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel, nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} (A:154-293)
Probab=12.55  E-value=52  Score=15.56  Aligned_cols=18  Identities=17%  Similarity=0.152  Sum_probs=14.8

Q ss_pred             CCCCCEEEEEEHHHHHHH
Q ss_conf             987742522102123788
Q gi|254780840|r    1 MTGYPFYFWGKISHGIGL   18 (52)
Q Consensus         1 mtgypfyfwgkishgigl   18 (52)
                      |-|+||.+-|++-||-|+
T Consensus         2 lLg~py~i~G~Vv~G~~~   19 (140)
T 1mrz_A            2 YLGRYFEIEGIVHKDREF   19 (140)
T ss_dssp             HHSSCCEEEEEC------
T ss_pred             HCCCCEEEEEEEECCCCC
T ss_conf             459977999888558420


No 6  
>>1nb0_A Hypothetical protein FLJ11149; beta barrel, transferase; HET: ADP; 1.70A {Homo sapiens} (A:)
Probab=12.00  E-value=58  Score=15.29  Aligned_cols=17  Identities=24%  Similarity=0.718  Sum_probs=14.0

Q ss_pred             CCCCEEEEEEHHHHHHH
Q ss_conf             87742522102123788
Q gi|254780840|r    2 TGYPFYFWGKISHGIGL   18 (52)
Q Consensus         2 tgypfyfwgkishgigl   18 (52)
                      .|+||.+-|++.||-|+
T Consensus         1 ~Grpy~~~G~Vv~G~~~   17 (147)
T 1nb0_A            1 RHLPYFCRGQVVRGFGR   17 (147)
T ss_dssp             CCCSEEEEEECBCCSSS
T ss_pred             CCCCEEEEEEEEECCCC
T ss_conf             98898999999708954


No 7  
>>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* (G:829-871)
Probab=11.20  E-value=56  Score=15.39  Aligned_cols=14  Identities=36%  Similarity=1.030  Sum_probs=12.0

Q ss_pred             HHHHHHHHCCHHHH
Q ss_conf             88999875416999
Q gi|254780840|r   17 GLFLWDVLDGRVFQ   30 (52)
Q Consensus        17 glflwdvldgrvfq   30 (52)
                      |..||.-+|.++|.
T Consensus        29 gv~lW~elD~~iFs   42 (43)
T 2uv8_G           29 GVMLWKEFDETIFN   42 (43)
T ss_dssp             ECCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             63268899999887


No 8  
>>3b4s_A Protein LUXT; APC91483.1, LUXT domain, structural genomics, PSI-2, protein structure initiative; 3.10A {Vibrio parahaemolyticus rimd 2210633} (A:1-55)
Probab=7.40  E-value=1.6e+02  Score=12.93  Aligned_cols=10  Identities=40%  Similarity=0.976  Sum_probs=6.0

Q ss_pred             HHCCHHHHHH
Q ss_conf             7541699999
Q gi|254780840|r   23 VLDGRVFQFY   32 (52)
Q Consensus        23 vldgrvfqfy   32 (52)
                      .||||.|+..
T Consensus         2 ALdGRifkmf   11 (55)
T 3b4s_A            2 NADGRIFKXF   11 (55)
T ss_dssp             -CCCHHHHHH
T ss_pred             CCHHHHHHHH
T ss_conf             6237899999


No 9  
>>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* (A:41-147,A:222-326)
Probab=7.31  E-value=1.1e+02  Score=13.75  Aligned_cols=24  Identities=33%  Similarity=0.509  Sum_probs=0.0

Q ss_pred             CCEE--EEEEHHHHHHHHHHHHHCCH
Q ss_conf             7425--22102123788999875416
Q gi|254780840|r    4 YPFY--FWGKISHGIGLFLWDVLDGR   27 (52)
Q Consensus         4 ypfy--fwgkishgiglflwdvldgr   27 (52)
                      .|.|  .|+...-.+||.+.|.|.++
T Consensus        49 ~P~y~~~~~~~~~~~Gl~lYd~l~~~   74 (212)
T 2qcu_A           49 LPHRPHLRPAWMIRIGLFMYDHLGKR   74 (212)
T ss_dssp             EECCTTTSCHHHHHHHHHHHHSSSCC
T ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99538320899999999998743885


No 10 
>>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} (A:1-151)
Probab=7.16  E-value=1.7e+02  Score=12.83  Aligned_cols=10  Identities=40%  Similarity=1.355  Sum_probs=0.0

Q ss_pred             CCCCEEEEEE
Q ss_conf             8774252210
Q gi|254780840|r    2 TGYPFYFWGK   11 (52)
Q Consensus         2 tgypfyfwgk   11 (52)
                      .+|+|-+||+
T Consensus       125 ~~~~~dyWGq  134 (151)
T 2gki_A          125 RGYAMDYWGQ  134 (151)
T ss_dssp             GTTCEEEECC
T ss_pred             CCCEEEECCC
T ss_conf             8885427799


Done!