RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780840|ref|YP_003065253.1| hypothetical protein CLIBASIA_03675 [Candidatus Liberibacter asiaticus str. psy62] (52 letters) >3epw_A IAG-nucleoside hydrolase; rossmann fold, active site loops, aromatic stacking; HET: JMQ; 1.30A {Trypanosoma vivax} PDB: 3epx_A* 1hoz_A 1hp0_A* 2ff1_A* 2ff2_A* 1kic_A* 1kie_A* 1r4f_A* 3b9g_A* (A:) Length = 338 Score = 24.4 bits (52), Expect = 5.8 Identities = 8/52 (15%), Positives = 15/52 (28%), Gaps = 6/52 (11%) Query: 1 MTGYPFYFWGKISHGIGLFLWDVL------DGRVFQFYRVVVRIALIFEYGR 46 + G G + WD L D +V V + + + + Sbjct: 251 TMWAMCTHCELLRDGDGYYAWDALTAAYVVDQKVANVDPVPIDVVVDKQPNE 302 >2vug_A PAB1020; RNA, ligase, AMPPNP, nucleotidyl- transferase; HET: ANP; 2.9A {Pyrococcus abyssi GE5} (A:105-205) Length = 101 Score = 23.5 bits (51), Expect = 9.3 Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 12 ISHGIGLFLWDVLDGRVFQFYRVVVRIALIFEYG 45 + I FL+DV + + + V R+ + EYG Sbjct: 66 VKEDIQFFLFDVQEIKTGRSLPVEERLKIAEEYG 99 >3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, CT, tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A (A:33-157,A:224-353) Length = 255 Score = 23.4 bits (50), Expect = 9.7 Identities = 4/30 (13%), Positives = 6/30 (20%) Query: 20 LWDVLDGRVFQFYRVVVRIALIFEYGRRFI 49 W V + LI + Sbjct: 15 QWKNFSADVKLTDDFFISNELIEDENGELT 44 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.339 0.159 0.552 Gapped Lambda K H 0.267 0.0571 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 514,078 Number of extensions: 17619 Number of successful extensions: 54 Number of sequences better than 10.0: 1 Number of HSP's gapped: 54 Number of HSP's successfully gapped: 6 Length of query: 52 Length of database: 4,956,049 Length adjustment: 23 Effective length of query: 29 Effective length of database: 4,178,534 Effective search space: 121177486 Effective search space used: 121177486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 50 (23.4 bits)