RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780841|ref|YP_003065254.1| phosphatidylcholine synthase protein [Candidatus Liberibacter asiaticus str. psy62] (246 letters) >gnl|CDD|31376 COG1183, PssA, Phosphatidylserine synthase [Lipid metabolism]. Length = 234 Score = 137 bits (346), Expect = 3e-33 Identities = 66/231 (28%), Positives = 97/231 (41%), Gaps = 11/231 (4%) Query: 17 AFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNW 76 +++TA G F+ L + AA + R + LALI+DG DG +ARK+ K Sbjct: 9 YLLPNLITALGLFLGLLSIVAALEGRFEAALLLILLALILDGLDGRVARKLNAKSAF--- 65 Query: 77 SGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEH- 135 G LD++ D +++ V PA LY S L +AA + V+ ++ A N+KT + Sbjct: 66 -GAELDSLADLVSFGVAPALLLYSS-GLNTGPLGLLAALLYVLCGALRLARFNVKTNDDK 123 Query: 136 -FFSGFPAVWNMVVF-SLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFF 193 FF G P VV L+ L S+ + S IL + + + I L+ LN Sbjct: 124 NFFIGLPIPAAAVVVVLLVLLYHSLPTGLATVLLSGILLLLSILMVSNIPFPSLKKLNAL 183 Query: 194 VFVCWCLLGFYALIS---NFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLG 241 V V L G L + W G L + Q F LG Sbjct: 184 VRVVLLLAGILLLALLALVLILYPWLLLLVIASGYLLSIPIRVRQWFKKLG 234 >gnl|CDD|144601 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase. All of these members have the ability to catalyse the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond. Length = 96 Score = 46.4 bits (111), Expect = 7e-06 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Query: 18 FSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWS 77 + +++T + L + + L LA ++DG DG +AR+ L Sbjct: 3 ITPNLITLLRLILGLLAALLLLLGQYLLAALLLLLAGLLDGLDGKLARRTGQSSPL---- 58 Query: 78 GDTLDNIIDYLTYVVLPAFALY 99 G LD++ D L+ V L L Sbjct: 59 GALLDSVADRLSDVALLLGLLL 80 >gnl|CDD|145907 pfam03006, HlyIII, Haemolysin-III related. Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus. It has been proposed that YOL002c encodes a Saccharomyces cerevisiae protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adipoQ receptors, and hence have been named PAQR proteins. The mammalian members include progesterone binding proteins. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea. Length = 207 Score = 28.4 bits (64), Expect = 2.1 Identities = 12/49 (24%), Positives = 18/49 (36%) Query: 186 RLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAIL 234 R R L +++ LG + V G LY++GAI Sbjct: 128 RFRWLRTVLYLLMGWLGIIPIKHLILALGGGGLVLLVLGGVLYTLGAIF 176 >gnl|CDD|36830 KOG1617, KOG1617, KOG1617, CDP-alcohol phosphatidyltransferase/Phosphatidylglycerol-phosphate synthase [Lipid transport and metabolism]. Length = 243 Score = 27.6 bits (61), Expect = 3.6 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 4/85 (4%) Query: 52 LALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSS 111 +A I D DG IARKMR+ + + D ++ + + L L G Sbjct: 103 VAGITDLLDGYIARKMRLGSIAGSVLDPLADKVLITCLTLCMVYADLIPVPLASIIIGRD 162 Query: 112 VAAGMMVISSSIYYAYTNMKTEEHF 136 V ++++ + Y Y N+K Sbjct: 163 V----LLVAGAFYLRYQNLKLPYTL 183 >gnl|CDD|176093 cd08543, SAM_PNT-ETS-2, Sterile alpha motif (SAM)/Pointed domain of ETS-2. SAM Pointed domain of ETS-2 subfamily of ETS transcriptional regulators is a protein-protein interaction domain. It contains a docking site for Cdk10 (cyclin-dependent kinase 10), a member of the Cdc2 kinase family. The interaction between ETS-2 and Cdk10 kinase inhibits ETS-2 transactivation activity in mammals. ETS-2 is also regulated by ERK2 MAP kinase. ETS-2, which is phosphorylated by ERK2, can interact with coactivators and enhance transactivation. ETS-2 transcriptional activators are involved in embryonic development and cell cycle control. The Ets-2 gene is a proto-oncogene. It is overexpressed in breast and prostate cancer cells and its overexpression is necessary for transformation of such cells. Members of ETS-2 subfamily are potential molecular targets for selective cancer therapy. Length = 89 Score = 27.5 bits (61), Expect = 3.9 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Query: 211 QVCRWFSFA---FSVCGIYLYSIGAILQIFPNLGKKR 244 QVC+W +A FS+ + G Q NLGK+R Sbjct: 26 QVCQWLLWATNEFSLVNVNFQQFGMNGQELCNLGKER 62 >gnl|CDD|37782 KOG2571, KOG2571, KOG2571, Chitin synthase/hyaluronan synthase (glycosyltransferases) [Cell wall/membrane/envelope biogenesis]. Length = 862 Score = 26.9 bits (59), Expect = 5.6 Identities = 15/99 (15%), Positives = 27/99 (27%), Gaps = 7/99 (7%) Query: 144 WNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFL----HPIRVVRLRPLNFFVFVCWC 199 L+ +L I+ F NF+ R N F + + Sbjct: 614 NLHNSLRYHTLHVEMLYFAIL---GPFFIFSMANFVLLLSFRGRSWNSTVHNLFPILLFI 670 Query: 200 LLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFP 238 LL + + + + LYS+ I + Sbjct: 671 LLCLTFSLFMQLLGARPRGNVYMLAMSLYSVLIIYSLLC 709 >gnl|CDD|113849 pfam05094, LEF-9, Late expression factor 9 (LEF-9). Late expression factor 9 (LEF-9) is one of the primary components of RNA polymerase produced by baculoviruses. LEF-9 is homologous to the largest beta-subunit of prokaryotic DNA-directed RNA polymerase. Length = 487 Score = 26.2 bits (58), Expect = 7.5 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Query: 119 ISSSIYYAYTNMKTEEHFFSGFP---AVWNM 146 +S IYY Y N+ E P A+W M Sbjct: 298 VSQQIYYLYKNINKIERLLKSMPILYALWQM 328 >gnl|CDD|38106 KOG2895, KOG2895, KOG2895, Uncharacterized conserved protein [Function unknown]. Length = 408 Score = 26.5 bits (58), Expect = 7.7 Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 131 KTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIR 183 K+E+ F F + +++I S++ +I TSV + +P IR Sbjct: 176 KSEKLFMVCFSFAEGTLAWAVIVWRNSLVFHSIDKITSVFIHLLPPLVFFTIR 228 >gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1391 Score = 26.4 bits (58), Expect = 7.8 Identities = 12/49 (24%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Query: 193 FVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLG 241 F + + +GFY S F F F F + + ++ + PNL Sbjct: 1218 FFLITYYPIGFYWTASKFFWFLLFMFIFFLYFTT-LGMM-LVSLTPNLQ 1264 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.331 0.142 0.451 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,100,450 Number of extensions: 169388 Number of successful extensions: 617 Number of sequences better than 10.0: 1 Number of HSP's gapped: 612 Number of HSP's successfully gapped: 54 Length of query: 246 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 155 Effective length of database: 4,297,318 Effective search space: 666084290 Effective search space used: 666084290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 56 (25.5 bits)