>TIGR00881 2A0104 phosphoglycerate transporter family protein; InterPro: IPR000849 Proteins in this group are involved in the transport system that mediates the uptake of a number of sugar phosphates as well as the regulatory components that are responsible for induction of this transport system by external glucose 6-phosphate. In Escherichia coli its role in transmembrane signalling may involve sugar-phosphate-binding sites and transmembrane orientations similar to those of the transport protein . The following proteins in this entry, involved in the uptake of phosphorylated metabolites, are evolutionary related , : E. coli, Bacillus subtilis and Haemophilus influenzae glycerol-3- phosphate transporter (gene glpT). Salmonella typhimurium phosphoglycerate transporter (gene pgtP). E. coli and S. typhimurium hexose-6-phosphate transporter (gene uhpT). E. coli and S. typhimurium protein uhpC. UhpC is necessary for the expression of uhpT and seems to act jointly with the uhpB sensor/kinase protein. Human glucose 6-phosphate translocase . These proteins of about 50 kDa apparently contain 12 transmembrane regions.; GO: 0005215 transporter activity, 0006810 transport, 0016021 integral to membrane.

Probab=99.13 E-value=2e-09 Score=63.54 Aligned_cols=154 Identities=14% Similarity=0.101 Sum_probs=121.5 Q ss_pred HHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHCC----HHH-HHHHHHHHHHH Q ss_conf 2012221012468889999876431001111110000000001245555456768996223----368-99999999999 Q gi|254780843|r 263 RHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTT----GFI-SGWSLIAVGLF 337 (420) Q Consensus 263 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~-~~~~~~~~g~~ 337 (420) T Consensus 21 l~E~~~L~~~dlG~~~s~~~i~Yg~sK~~~G~~sDr~~~r~fl~~GL~l~a~v~~~~gfs~watS~l~~~~~l~~l~G~f 100 (404) T TIGR00881 21 LVEEIGLSKTDLGLLLSSFSIAYGISKFVMGMVSDRSNPRVFLAIGLILCAIVNIFFGFSTWATSSLWVMAALMALNGLF 100 (404) T ss_pred HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH T ss_conf 88622888757889999999999874677566532676489999999999999999885223578999999999999887 Q ss_pred HHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999996301565--6999999999999999999999-99996123799--9999999999999999853111 Q gi|254780843|r 338 NSIMFPTIFSLASASLEDQA--SGGSGIICTTISGGVIIPLGVG-YLVDIASLRDA--MFVPAVCYIIIAIYGIYCCYKE 412 (420) Q Consensus 338 ~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~g~~i~p~i~G-~l~d~~g~~~~--~~~~~~~~~~~~~~~~~~~~~~ 412 (420) T Consensus 101 QG~G~P~~~r~~~~W~~~~eRGt~~~~wn~~~nvGG~~~pp~~~~~~~~~~~w~~~~~~~~~g~~aii~s~~~~~~~~~~ 180 (404) T TIGR00881 101 QGMGWPPCGRLLTKWFSRSERGTWVAIWNISHNVGGGLLPPLVLFGIALLYSWHVVSSFIVPGIIAIIVSLICLLLLRDS 180 (404) T ss_pred HHHCCCHHHCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 75067521240232157653112667788898875789999999999988165568899999999999988954411577 Q ss_pred HCCC Q ss_conf 0201 Q gi|254780843|r 413 NNFE 416 (420) Q Consensus 413 ~~~~ 416 (420) T Consensus 181 p~~~ 184 (404) T TIGR00881 181 PQSV 184 (404) T ss_pred CCCC T ss_conf 7778

HHsearch alignment for GI: 254780843 and conserved domain: TIGR00881