BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780844|ref|YP_003065257.1| hypothetical protein
CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62]
         (113 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040521|gb|ACT57317.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 113

 Score =  231 bits (590), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60
           MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL
Sbjct: 1   MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60

Query: 61  VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113
           VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF
Sbjct: 61  VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113


>gi|315122731|ref|YP_004063220.1| hypothetical protein CKC_04915 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496133|gb|ADR52732.1| hypothetical protein CKC_04915 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 105

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 7/109 (6%)

Query: 3   LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVG 62
           +R   + ++ C+L +Q    FCS   A + ++  S   T+         PL     Q   
Sbjct: 1   MRFVHKKMIFCVLILQYWAAFCSYSIALQTHEIASESATIGEENF----PLERADGQKEK 56

Query: 63  ATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYY 111
            +  S+    + ++   SN++D +    PK T++IL+ FPLP PP +YY
Sbjct: 57  PSYQSKKDVINKNILVLSNKKDLK---KPKNTESILDTFPLPPPPAKYY 102


>gi|77165579|ref|YP_344104.1| hypothetical protein Noc_2114 [Nitrosococcus oceani ATCC 19707]
 gi|254434205|ref|ZP_05047713.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|76883893|gb|ABA58574.1| Protein of unknown function DUF1631 [Nitrosococcus oceani ATCC
           19707]
 gi|207090538|gb|EDZ67809.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 787

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 66  HSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPL 105
           +S  ++ +HD+P SS  + + G PSP+K K + EL  +PL
Sbjct: 665 NSRSREETHDIPLSSPIKQKSGPPSPEKDKYLQELAAVPL 704


>gi|320588768|gb|EFX01236.1| transporter protein smf2 [Grosmannia clavigera kw1407]
          Length = 651

 Score = 34.3 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 3   LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGC 57
           L  ACR  L C L++   VL  +EI       A    T +ALN+L P  PL  GC
Sbjct: 223 LAEACRAFLPCWLNVTLYVL--AEIAIIATDIAEVIGTAIALNLLQPKIPLVAGC 275


>gi|52080235|ref|YP_079026.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|52785612|ref|YP_091441.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|319645986|ref|ZP_08000216.1| FliY protein [Bacillus sp. BT1B_CT2]
 gi|52003446|gb|AAU23388.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|52348114|gb|AAU40748.1| FliY [Bacillus licheniformis ATCC 14580]
 gi|317391736|gb|EFV72533.1| FliY protein [Bacillus sp. BT1B_CT2]
          Length = 377

 Score = 33.5 bits (75), Expect = 9.1,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 36/76 (47%)

Query: 38  YPTTVALNVLSPLAPLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNI 97
           YP T A +++  L     G E +    V +  +++    P+S+  + QR  P+PK+    
Sbjct: 207 YPLTFAKDLIDELTNQDGGEEPVKTEEVQTPVQEKPAPNPNSAPAQTQRQEPAPKRQGTA 266

Query: 98  LELFPLPLPPTQYYSF 113
               P+ + P ++ SF
Sbjct: 267 KVSEPVQVAPAEFQSF 282


Searching..................................................done


Results from round 2




>gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040521|gb|ACT57317.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 113

 Score =  228 bits (582), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60
           MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL
Sbjct: 1   MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60

Query: 61  VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113
           VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF
Sbjct: 61  VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113


>gi|315122731|ref|YP_004063220.1| hypothetical protein CKC_04915 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496133|gb|ADR52732.1| hypothetical protein CKC_04915 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 105

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 7/109 (6%)

Query: 3   LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVG 62
           +R   + ++ C+L +Q    FCS   A + ++  S   T+         PL     Q   
Sbjct: 1   MRFVHKKMIFCVLILQYWAAFCSYSIALQTHEIASESATIGEENF----PLERADGQKEK 56

Query: 63  ATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYY 111
            +  S+    + ++   SN++D +    PK T++IL+ FPLP PP +YY
Sbjct: 57  PSYQSKKDVINKNILVLSNKKDLK---KPKNTESILDTFPLPPPPAKYY 102


>gi|77165579|ref|YP_344104.1| hypothetical protein Noc_2114 [Nitrosococcus oceani ATCC 19707]
 gi|254434205|ref|ZP_05047713.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|76883893|gb|ABA58574.1| Protein of unknown function DUF1631 [Nitrosococcus oceani ATCC
           19707]
 gi|207090538|gb|EDZ67809.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 787

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 66  HSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPL 105
           +S  ++ +HD+P SS  + + G PSP+K K + EL  +PL
Sbjct: 665 NSRSREETHDIPLSSPIKQKSGPPSPEKDKYLQELAAVPL 704


>gi|308497664|ref|XP_003111019.1| hypothetical protein CRE_04544 [Caenorhabditis remanei]
 gi|308242899|gb|EFO86851.1| hypothetical protein CRE_04544 [Caenorhabditis remanei]
          Length = 587

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 42  VALNVLSPLAPLGDGCEQL-----VGATVHSEGKKRSHD----VPSSSNQEDQRGSPSPK 92
           +A +VL P  P+G+    L     V     + G+  SH     + +S++Q  +R SPSP+
Sbjct: 186 LAEDVLEPEQPIGNTSPSLKYDYVVIQPQVNHGRTSSHQTHQPIQNSASQYSRRKSPSPR 245

Query: 93  KTKNILELFPL 103
           +T+ I+  +PL
Sbjct: 246 ETEAIVRTYPL 256


>gi|52080235|ref|YP_079026.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|52785612|ref|YP_091441.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|319645986|ref|ZP_08000216.1| FliY protein [Bacillus sp. BT1B_CT2]
 gi|52003446|gb|AAU23388.1| flagellar motor switch protein [Bacillus licheniformis ATCC 14580]
 gi|52348114|gb|AAU40748.1| FliY [Bacillus licheniformis ATCC 14580]
 gi|317391736|gb|EFV72533.1| FliY protein [Bacillus sp. BT1B_CT2]
          Length = 377

 Score = 34.6 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 36/76 (47%)

Query: 38  YPTTVALNVLSPLAPLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNI 97
           YP T A +++  L     G E +    V +  +++    P+S+  + QR  P+PK+    
Sbjct: 207 YPLTFAKDLIDELTNQDGGEEPVKTEEVQTPVQEKPAPNPNSAPAQTQRQEPAPKRQGTA 266

Query: 98  LELFPLPLPPTQYYSF 113
               P+ + P ++ SF
Sbjct: 267 KVSEPVQVAPAEFQSF 282


>gi|320588768|gb|EFX01236.1| transporter protein smf2 [Grosmannia clavigera kw1407]
          Length = 651

 Score = 34.6 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 3   LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGC 57
           L  ACR  L C L++   VL  +EI       A    T +ALN+L P  PL  GC
Sbjct: 223 LAEACRAFLPCWLNVTLYVL--AEIAIIATDIAEVIGTAIALNLLQPKIPLVAGC 275


>gi|296227920|ref|XP_002759573.1| PREDICTED: 5'-3' exoribonuclease 1 isoform 2 [Callithrix jacchus]
          Length = 1706

 Score = 34.3 bits (77), Expect = 6.2,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 67   SEGKKRSHDVPSSSNQEDQRGSPS-PKKTKNILELFPLPLPPTQYYS 112
            +E K+  H++P SSN+ D+ G PS PK+ K +      P    +Y++
Sbjct: 1375 NEMKQIGHEIPVSSNRRDEYGLPSQPKQNKKLASYVNKPHSANEYHN 1421


>gi|296227918|ref|XP_002759572.1| PREDICTED: 5'-3' exoribonuclease 1 isoform 1 [Callithrix jacchus]
          Length = 1694

 Score = 34.3 bits (77), Expect = 6.2,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 67   SEGKKRSHDVPSSSNQEDQRGSPS-PKKTKNILELFPLPLPPTQYYS 112
            +E K+  H++P SSN+ D+ G PS PK+ K +      P    +Y++
Sbjct: 1376 NEMKQIGHEIPVSSNRRDEYGLPSQPKQNKKLASYVNKPHSANEYHN 1422


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.320    0.136    0.412 

Lambda     K      H
   0.267   0.0419    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,250,937,770
Number of Sequences: 14124377
Number of extensions: 91058558
Number of successful extensions: 231845
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 231831
Number of HSP's gapped (non-prelim): 21
length of query: 113
length of database: 4,842,793,630
effective HSP length: 81
effective length of query: 32
effective length of database: 3,698,719,093
effective search space: 118359010976
effective search space used: 118359010976
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)