RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] (113 letters) >gnl|CDD|145575 pfam02510, SPAN, Surface presentation of antigens protein. Surface presentation of antigens protein (SPAN), also know as invasion protein invJ, is a Salmonella secretory pathway protein involved in presentation of determinants required for mammalian host cell invasion. Length = 336 Score = 28.5 bits (63), Expect = 0.41 Identities = 16/49 (32%), Positives = 19/49 (38%) Query: 60 LVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPT 108 + G + EG + DV S G K K I E LPL PT Sbjct: 174 IAGEGIRKEGALLAGDVAPSRMAAANTGKADDKDHKKIKEAPQLPLQPT 222 >gnl|CDD|38920 KOG3716, KOG3716, KOG3716, Carnitine O-acyltransferase CPTI [Lipid transport and metabolism]. Length = 764 Score = 26.4 bits (58), Expect = 1.7 Identities = 15/65 (23%), Positives = 27/65 (41%), Gaps = 4/65 (6%) Query: 1 MFLRSACRNLLVCILSIQCL-VLFCSEIFAFEKYKAPSYPTT---VALNVLSPLAPLGDG 56 + + + L V L L +L + + FE PSY T V + +LS P+ Sbjct: 100 LAIFATGLWLTVIFLRRLLLKLLLSYKGWLFESPGKPSYATKIWGVVVKILSKRPPMLYS 159 Query: 57 CEQLV 61 ++ + Sbjct: 160 FQRSL 164 >gnl|CDD|39479 KOG4278, KOG4278, KOG4278, Protein tyrosine kinase [Signal transduction mechanisms]. Length = 1157 Score = 26.2 bits (57), Expect = 1.8 Identities = 13/47 (27%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Query: 71 KRSHDVPSSSNQEDQRGSPSPKKTKNILELF----PLPLPPTQYYSF 113 ++S SS ED+ + KT P P PP + SF Sbjct: 601 RKSRIRSPSSLLEDEVSFFNDSKTSKFSSFRKKGPPAPTPPKRSSSF 647 >gnl|CDD|32805 COG2986, HutH, Histidine ammonia-lyase [Amino acid transport and metabolism]. Length = 498 Score = 25.5 bits (56), Expect = 3.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%) Query: 59 QLVGATVHSEGKKRSH-----DVPSSSNQEDQ--RGSPSPKKTKNILEL 100 Q A + SE K +H +P+S+NQED + + +K I+E Sbjct: 384 QYTAAALVSENKVLAHPASVDSIPTSANQEDHVSMATHAARKLLEIIEN 432 >gnl|CDD|39013 KOG3809, KOG3809, KOG3809, Microtubule-binding protein MIP-T3 [Cytoskeleton]. Length = 583 Score = 24.4 bits (52), Expect = 7.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 67 SEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFP 102 S+ K+R SS + ++ S S KK K+ + P Sbjct: 198 SKSKERPKSEDRSSRKNSEKSSKSKKKEKSTTKEKP 233 >gnl|CDD|173876 cd08511, PBP2_NikA_DppA_OppA_like_5, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction. Length = 467 Score = 24.2 bits (53), Expect = 7.4 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 24 CSEIFAFEKYKAPSYPTTVALNVLSPLAPL 53 SE+ + E + P TV + P APL Sbjct: 98 KSELASVESVEVVD-PATVRFRLKQPFAPL 126 >gnl|CDD|31541 COG1350, COG1350, Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only]. Length = 432 Score = 24.1 bits (52), Expect = 9.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 91 PKKTKNILELFPLPLPP 107 PK+ NIL P PLPP Sbjct: 12 PKRWYNILPDLPEPLPP 28 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0719 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,374,285 Number of extensions: 60302 Number of successful extensions: 106 Number of sequences better than 10.0: 1 Number of HSP's gapped: 106 Number of HSP's successfully gapped: 12 Length of query: 113 Length of database: 6,263,737 Length adjustment: 79 Effective length of query: 34 Effective length of database: 4,556,626 Effective search space: 154925284 Effective search space used: 154925284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.4 bits)